HHsearch alignment for GI: 254780485 and conserved domain: COG0502

>COG0502 BioB Biotin synthase and related enzymes [Coenzyme metabolism].
Probab=100.00  E-value=0  Score=512.33  Aligned_cols=311  Identities=54%  Similarity=0.918  Sum_probs=299.3

Q ss_pred             CCCCCCHHHHHHHHCCCHHH-HHHHHHHHHHHHCCCCEEEEEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHH
Q ss_conf             34478999999997399189-99999999888628985699986453078683423212433547775641000685799
Q gi|254780485|r   15 KPKVWTSKEVFQIYNMPFND-LLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQSVHNKSKLKASKLINVDQV   93 (328)
Q Consensus        15 ~~e~ls~eea~~L~~~~~~e-l~~~Aa~~~r~~~~g~~V~~~~~in~~TN~C~~~C~fCaf~~~~~~~~~~~~~~~~Eei   93 (328)
T Consensus        10 ~~~~~~~~e~~~l~~~~~~~~~L~~aA~~~R~~~~g~~V~l~~ii~iktg~c~edC~yC~qS~~~~~~~~~~~l~~~eeI   89 (335)
T COG0502          10 RGERWTLDEALALLDLPDEDELLFEAAQKHRLHFDGNEVQLSTLISIKTGCCPEDCAYCSQSARYKTGVKARKLMEVEEI   89 (335)
T ss_pred             HCCCCCHHHHHHHHCCCCCHHHHHHHHHHHHHHCCCCEEEEEEEEEEECCCCCCCCCCCCCCCCCCCCCCHHHCCCHHHH
T ss_conf             04676799999997288626899999999998548885899888873348889889876001047679823312899999


Q ss_pred             HHHHHHHHHCCCEEEEEECCCCCCCCCCHHHHHHHHHHHC-CCCCCEEEECCCCCHHHHHHHHCCCCCEEEEECCCCHHH
Q ss_conf             9999999964983899730368887442899999887621-368832410256999999987415760697513437777
Q gi|254780485|r   94 LKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVK-SLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERF  172 (328)
Q Consensus        94 ~~~a~~~~~~G~~~~~l~~~~~~~~~~~~~~~~e~i~~i~-~~~~~i~~~~g~~~~~~~~~Lk~aG~~~~~~~let~~~~  172 (328)
T Consensus        90 le~Ak~ak~~Ga~r~c~~aagr~-~~~~~~~i~~~v~~Vk~~~~le~c~slG~l~~eq~~~L~~aGvd~ynhNLeTs~~~  168 (335)
T COG0502          90 LEAAKKAKAAGATRFCMGAAGRG-PGRDMEEVVEAIKAVKEELGLEVCASLGMLTEEQAEKLADAGVDRYNHNLETSPEF  168 (335)
T ss_pred             HHHHHHHHHCCCCEEEEEEECCC-CCCCHHHHHHHHHHHHHHCCCHHHHCCCCCCHHHHHHHHHCCHHHEECCCCCCHHH
T ss_conf             99999999749950799873167-77448999999999998469286402587999999999971811330355569788


Q ss_pred             HHCCCCCCCHHHHHHHHHHHHHCCCCCCCEEEECCCCCHHHHHHHHHHHHHCCCCCCEEECCCEEECCCCCCCCCCCCCH
Q ss_conf             32058888989999999999987985577078668989999999999997408888602054112048741244568798
Q gi|254780485|r  173 YPHVTTTHTFEDRLQTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDP  252 (328)
Q Consensus       173 ~~~~~~~~~~~~~l~~~~~a~~~G~~~~sg~l~G~gEt~eeri~~l~~lr~l~~~~~~v~~~~~~p~~gt~l~~~~~~~~  252 (328)
T Consensus       169 y~~I~tt~t~edR~~tl~~vk~~Gi~vcsGgI~GlGEs~eDri~~l~~L~~l~~-pdsVPIn~l~P~~GTPle~~~~~~~  247 (335)
T COG0502         169 YENIITTRTYEDRLNTLENVREAGIEVCSGGIVGLGETVEDRAELLLELANLPT-PDSVPINFLNPIPGTPLENAKPLDP  247 (335)
T ss_pred             HCCCCCCCCHHHHHHHHHHHHHCCCCCCCCEEECCCCCHHHHHHHHHHHHHCCC-CCEEEEEEECCCCCCCCCCCCCCCH
T ss_conf             756578988889999999999809850451276189988899999999971899-8854232103799986665899998


Q ss_pred             HHHHHHHHHHHHHCCCCCCEEEEHHHHHCHHHHHHHHHHCCCEEEECCEEECCCCCCHHHHHHHHHHCCCCCCCC
Q ss_conf             999999999999686872142311565165689999980998899778665158889899999999829853247
Q gi|254780485|r  253 IEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTILFNRLGLIPDLS  327 (328)
Q Consensus       253 ~e~lr~iAi~RL~lP~~~i~i~~~~~~~~~~~~~~~L~~GaN~~~~g~~~~t~~g~~~~~~~~~i~~~G~~P~~~  327 (328)
T Consensus       248 ~e~lk~IA~~Ri~~P~~~Ir~s~gr~~~~~~~q~~~~~aGansi~~g~~~ltt~~~~~e~D~~~l~~lgl~~e~~  322 (335)
T COG0502         248 FEFLKTIAVARIIMPKSMIRLSAGRETMLPELQALAFMAGANSIFVGDKYLTTPGPDEDKDLELLKDLGLEPELL  322 (335)
T ss_pred             HHHHHHHHHHHHHCCCCEEECCCCCCCCCHHHHHHHHHHCCCEEEECCEEEECCCCCCHHHHHHHHHCCCCCCCC
T ss_conf             999999999999778645672588352258889999984566356524476248998036899999738872114