HHsearch alignment for GI: 254780485 and conserved domain: COG1243

>COG1243 ELP3 Histone acetyltransferase [Transcription / Chromatin structure and dynamics].
Probab=99.02  E-value=1.3e-07  Score=70.66  Aligned_cols=210  Identities=19%  Similarity=0.247  Sum_probs=139.4

Q ss_pred             EEEECCCCCCC-CCCCCCCCCCCCCCCC------------CCCCCCHHHHHHHHHHHHHCCCE----EEEEECCCCCCCC
Q ss_conf             64530786834-2321243354777564------------10006857999999999964983----8997303688874
Q gi|254780485|r   57 LLNIKTGGCPE-NCGYCNQSVHNKSKLK------------ASKLINVDQVLKEAKNAKENGAT----RYCMGAAWREPKE  119 (328)
Q Consensus        57 ~in~~TN~C~~-~C~fCaf~~~~~~~~~------------~~~~~~~Eei~~~a~~~~~~G~~----~~~l~~~~~~~~~  119 (328)
T Consensus        69 aVmt~p~~CPHg~CvfCpgg~~~~spQSytg~ep~~~R~~~~~ydpY~q~~~Rl~qL~~igh~~~KvEliimGGTFt--a  146 (515)
T COG1243          69 AVMTSPHGCPHGRCVFCPGGPDKDSPQSYTGEEPAALRAIKNRYDPYEQVRARLKQLETIGHTSDKVELIIMGGTFT--A  146 (515)
T ss_pred             EEECCCCCCCCCEEEECCCCCCCCCCCCCCCCCCHHHHHHHHCCCCHHHHHHHHHHHHHCCCCCCEEEEEEECCCCC--C
T ss_conf             98438889999807758997777888554788842667776057918888888999997399864289999626566--8


Q ss_pred             CCHHHHHHHHHH----HC-------------C------CCCCEEEECCCCCHHHHHHHHCCCCCEEEEECCC-CHHHHHC
Q ss_conf             428999998876----21-------------3------6883241025699999998741576069751343-7777320
Q gi|254780485|r  120 RDLSIIVDMIKG----VK-------------S------LGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDT-SERFYPH  175 (328)
Q Consensus       120 ~~~~~~~e~i~~----i~-------------~------~~~~i~~~~g~~~~~~~~~Lk~aG~~~~~~~let-~~~~~~~  175 (328)
T Consensus       147 ~~~~yqe~Fi~~~~~amn~f~~~le~a~~~ne~~~~r~vgitiETRPD~~~ee~ld~mlkyG~TrVELGVQSiyd~Vl~~  226 (515)
T COG1243         147 LSLEYQEWFLKVALKAMNDFGYDLEEAQRKNETAELRCVGITIETRPDYIDEEHLDQMLKYGVTRVELGVQSIYDDVLER  226 (515)
T ss_pred             CCHHHHHHHHHHHHHHHHCCCHHHHHHHHHHCCCCCCEEEEEEECCCCCCCHHHHHHHHHCCCCEEEEEEEEHHHHHHHH
T ss_conf             88789999999999865312204889887400023422679983484100779999999638838998326579999998


Q ss_pred             CCCCCCHHHHHHHHHHHHHCCCCCCCEEEECC-CCCHHHHHHHHHHHHHCC-CCCCEEECCCEEECCCCCCCC------C
Q ss_conf             58888989999999999987985577078668-989999999999997408-888602054112048741244------5
Q gi|254780485|r  176 VTTTHTFEDRLQTLENVRKSGIKVCCGGILGL-GEMIDDRIDMLLTLANLS-TPPESIPINLLIPIPGSKFEE------N  247 (328)
Q Consensus       176 ~~~~~~~~~~l~~~~~a~~~G~~~~sg~l~G~-gEt~eeri~~l~~lr~l~-~~~~~v~~~~~~p~~gt~l~~------~  247 (328)
T Consensus       227 ~~RGHtvedv~~a~rLlKd~GfKv~~HiMpGLPgs~~erDl~~f~~~f~~p~f~PDmlKIYPtLVi~gT~Ly~mwk~G~Y  306 (515)
T COG1243         227 TKRGHTVEDVVEATRLLKDAGFKVGYHIMPGLPGSDFERDLESFREIFEDPRFRPDMLKIYPTLVIEGTELYEMWKRGLY  306 (515)
T ss_pred             HCCCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCCHHHHHHHHHHHHHCCCCCCCEEEEEEEEEECCCHHHHHHHCCCC
T ss_conf             33896199999999999851837999965899998867789999999718888987578840279878269999970898


Q ss_pred             CCCCHHHHHHHHHHHHHHCCC
Q ss_conf             687989999999999996868
Q gi|254780485|r  248 KKVDPIEHVRIISVARILMPK  268 (328)
Q Consensus       248 ~~~~~~e~lr~iAi~RL~lP~  268 (328)
T Consensus       307 kpy~~EEaVeli~~i~~~~p~  327 (515)
T COG1243         307 KPYTTEEAVELIVEIYRLEPK  327 (515)
T ss_pred             CCCCHHHHHHHHHHHHHHCCC
T ss_conf             779889999999999986677