HHsearch alignment for GI: 254780485 and conserved domain: KOG3111

>KOG3111 consensus.
Probab=94.26  E-value=0.46  Score=26.77  Aligned_cols=195  Identities=15%  Similarity=0.179  Sum_probs=117.2

Q ss_pred             HHHHHHHHHHHCCCEEEEE-ECCCCCCCCCCH-HHHHHHHHHHCCCC--CCEEEECCCCCHHHHHHHHCCCCCEEEEECC
Q ss_conf             9999999999649838997-303688874428-99999887621368--8324102569999999874157606975134
Q gi|254780485|r   92 QVLKEAKNAKENGATRYCM-GAAWREPKERDL-SIIVDMIKGVKSLG--LETCMTLGMLSFEQAQILSKAGLDYYNHNID  167 (328)
Q Consensus        92 ei~~~a~~~~~~G~~~~~l-~~~~~~~~~~~~-~~~~e~i~~i~~~~--~~i~~~~g~~~~~~~~~Lk~aG~~~~~~~le  167 (328)
T Consensus        18 nL~~E~~~~~~~GadwlHlDVMDg~FVpNiT~G~pvV~slr~~~~~~~ffD~HmMV-~~Peq~v~~~a~agas~~tfH~E   96 (224)
T KOG3111          18 NLAAECKKMLDAGADWLHLDVMDGHFVPNITFGPPVVESLRKHTGADPFFDVHMMV-ENPEQWVDQMAKAGASLFTFHYE   96 (224)
T ss_pred             HHHHHHHHHHHCCCCEEEEEECCCCCCCCCCCCHHHHHHHHHCCCCCCCEEEEEEE-CCHHHHHHHHHHCCCCEEEEEEE
T ss_conf             89999999997498758786014710477433618899998525888523678764-69888767998647756999864


Q ss_pred             CCHHHHHCCCCCCCHHHHHHHHHHHHHCCCCCCCEEEECCCCCHHHHHHHHHHHHHCCCCCCEEECCCEEECCCCCCCCC
Q ss_conf             37777320588889899999999999879855770786689899999999999974088886020541120487412445
Q gi|254780485|r  168 TSERFYPHVTTTHTFEDRLQTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEEN  247 (328)
Q Consensus       168 t~~~~~~~~~~~~~~~~~l~~~~~a~~~G~~~~sg~l~G~gEt~eeri~~l~~lr~l~~~~~~v~~~~~~p~~gt~l~~~  247 (328)
T Consensus        97 ~~-------------q~~~~lv~~ir~~gmk~G~--alkPgT~Ve~~~~~~~-------~~D~vLvMtVePGFG----GQ  150 (224)
T KOG3111          97 AT-------------QKPAELVEKIREKGMKVGL--ALKPGTPVEDLEPLAE-------HVDMVLVMTVEPGFG----GQ  150 (224)
T ss_pred             EC-------------CCHHHHHHHHHHCCCEEEE--EECCCCCHHHHHHHHH-------HCCEEEEEEECCCCC----HH
T ss_conf             32-------------5789999999974975668--7489995899997641-------025799998548975----04


Q ss_pred             CCCCHHHHHHHHHHHHHHCCCCCCEEEEHHHHHCHHHHHHHHHHCCCEEEECCEEECCCCCCHHHHHHHHHHC
Q ss_conf             6879899999999999968687214231156516568999998099889977866515888989999999982
Q gi|254780485|r  248 KKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTILFNRL  320 (328)
Q Consensus       248 ~~~~~~e~lr~iAi~RL~lP~~~i~i~~~~~~~~~~~~~~~L~~GaN~~~~g~~~~t~~g~~~~~~~~~i~~~  320 (328)
T Consensus       151 k--Fme~mm~KV~~lR~kyp~l~ieVDGG---v~p~ti~~~a~AGAN~iVaGsavf~a~--d~~~vi~~lr~~  216 (224)
T KOG3111         151 K--FMEDMMPKVEWLREKYPNLDIEVDGG---VGPSTIDKAAEAGANMIVAGSAVFGAA--DPSDVISLLRNS  216 (224)
T ss_pred             H--HHHHHHHHHHHHHHHCCCCEEEECCC---CCCCHHHHHHHCCCCEEEECCEEECCC--CHHHHHHHHHHH
T ss_conf             5--78999899999998689843885488---682137799875888798633345279--989999999999