HHsearch alignment for GI: 254780485 and conserved domain: PRK01659

>PRK01659 consensus.
Probab=92.62  E-value=0.85  Score=25.02  Aligned_cols=201  Identities=15%  Similarity=0.135  Sum_probs=114.2

Q ss_pred             HHHHHHHHHHHCCCEEEEEECCCCCCCCCCHHHHHHHHHHH-CCCCCCEEEECCCCCHHHHHHHHCCCCCEEEEECCC--
Q ss_conf             99999999996498389973036888744289999988762-136883241025699999998741576069751343--
Q gi|254780485|r   92 QVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGV-KSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDT--  168 (328)
Q Consensus        92 ei~~~a~~~~~~G~~~~~l~~~~~~~~~~~~~~~~e~i~~i-~~~~~~i~~~~g~~~~~~~~~Lk~aG~~~~~~~let--  168 (328)
T Consensus        31 DP~~~ak~~~~~Gad~ihivDld~a~~g~--~~n~~~I~~i~~~~~ipi~vGGGIrs~e~~~~~l~~GadkViigs~a~~  108 (252)
T PRK01659         31 DPVEIAAAYNEAGADELVFLDITATHEGR--KTMVDVVEKVAAKVFIPLTVGGGISSVKDMKRLLRAGADKVSINSAAVL  108 (252)
T ss_pred             CHHHHHHHHHHCCCCEEEEEECCCCCCCC--HHHHHHHHHHHHHCCCCEEEECCEECHHHHHHHHHCCCCEEEECHHHHH
T ss_conf             99999999998799999999467665688--6489999999975697479963320068888987448855983177752


Q ss_pred             CHHHHHCCCCCCCHHHHHHHHHHHHHCCCC-C------------CCEEEECCC---CCHHHHHHHHHHHHHCCCCCCEEE
Q ss_conf             777732058888989999999999987985-5------------770786689---899999999999974088886020
Q gi|254780485|r  169 SERFYPHVTTTHTFEDRLQTLENVRKSGIK-V------------CCGGILGLG---EMIDDRIDMLLTLANLSTPPESIP  232 (328)
Q Consensus       169 ~~~~~~~~~~~~~~~~~l~~~~~a~~~G~~-~------------~sg~l~G~g---Et~eeri~~l~~lr~l~~~~~~v~  232 (328)
T Consensus       109 n~~~i~~~---------------~~~~G~q~IvvsiD~k~~~~~~~~~i~~~g~~~~~~~~~~~~i~~~~~~g~--geil  171 (252)
T PRK01659        109 RPELITEG---------------ADHFGSQCIVVAIDAKYDAEAGKWNVYTHGGRVDTGLDAIAWAKEAVRLGA--GEIL  171 (252)
T ss_pred             CHHHHHHH---------------HHHCCCEEEEEEEEEEEECCCCCEEEEECCCCCCCCCCHHHHHHHHHHCCC--CEEE
T ss_conf             91532146---------------764686326999998970568868999689957677779999999997699--7799


Q ss_pred             CCCEEECCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCEEEEHHHHHCHHHHHHHHHHCCCEEEECCEEECCCCCCHHH
Q ss_conf             54112048741244568798999999999999686872142311565165689999980998899778665158889899
Q gi|254780485|r  233 INLLIPIPGSKFEENKKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNK  312 (328)
Q Consensus       233 ~~~~~p~~gt~l~~~~~~~~~e~lr~iAi~RL~lP~~~i~i~~~~~~~~~~~~~~~L~~GaN~~~~g~~~~t~~g~~~~~  312 (328)
T Consensus       172 ~-tdI~rDG~-~~---G~d-l~l~~~i~~---~~-~~PiIasGGi-~~~~di~~l~~~~~v~gv~~g~~~-~~~~~sl~e  239 (252)
T PRK01659        172 L-TSMDADGT-KN---GFD-LRLTKAISE---AV-SVPVIASGGA-GNADHMVEVFQKTTADAALAASIF-HYGETSIKE  239 (252)
T ss_pred             E-EEECCCCC-CC---CCC-HHHHHHHHH---HC-CCCEEEEECC-CCHHHHHHHHHHCCCCEEEEHHHH-HCCCCCHHH
T ss_conf             9-98814585-47---689-899999998---68-9999999179-999999999974898265575477-779999999


Q ss_pred             HHHHHHHCCCC
Q ss_conf             99999982985
Q gi|254780485|r  313 DTILFNRLGLI  323 (328)
Q Consensus       313 ~~~~i~~~G~~  323 (328)
T Consensus       240 ~k~~L~~~~~~  250 (252)
T PRK01659        240 VKAKLREAGVN  250 (252)
T ss_pred             HHHHHHHCCCC
T ss_conf             99999987498