HHsearch alignment for GI: 254780485 and conserved domain: PRK02747

>PRK02747 consensus.
Probab=93.82  E-value=0.56  Score=26.23  Aligned_cols=203  Identities=13%  Similarity=0.127  Sum_probs=114.0

Q ss_pred             HHHHHHHHHHHCCCEEEEEECCCCCCCCCCHHHHHHHHHHHC-CCCCCEEEECCCCCHHHHHHHHCCCCCEEEEECCC--
Q ss_conf             999999999964983899730368887442899999887621-36883241025699999998741576069751343--
Q gi|254780485|r   92 QVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVK-SLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDT--  168 (328)
Q Consensus        92 ei~~~a~~~~~~G~~~~~l~~~~~~~~~~~~~~~~e~i~~i~-~~~~~i~~~~g~~~~~~~~~Lk~aG~~~~~~~let--  168 (328)
T Consensus        31 dP~~~ak~~~~~Gadelh~vDl~~a~~~--~~~~~~lI~~i~~~~~ipi~vGGGIrs~e~~~~ll~~GadkViigs~a~~  108 (257)
T PRK02747         31 DPVEAARAYDAAGADELCFLDITASHEN--RGTMLDVVARTAEQCFMPLTVGGGVRTVDDIRKLLLAGADKVSINSAAVA  108 (257)
T ss_pred             CHHHHHHHHHHCCCCEEEEEECCCCCCC--CHHHHHHHHHHHHHCCCCEEEECCCCCHHHHHHHHHCCCCEEEECHHHHH
T ss_conf             9999999999869998999947677567--55289999999986699889848820738878998769968983444654


Q ss_pred             CHHHHHCCCCCCCHHHHHHHHHHHHHCCCC-CCCE---------------EEECC---CCCHHHHHHHHHHHHHCCCCCC
Q ss_conf             777732058888989999999999987985-5770---------------78668---9899999999999974088886
Q gi|254780485|r  169 SERFYPHVTTTHTFEDRLQTLENVRKSGIK-VCCG---------------GILGL---GEMIDDRIDMLLTLANLSTPPE  229 (328)
Q Consensus       169 ~~~~~~~~~~~~~~~~~l~~~~~a~~~G~~-~~sg---------------~l~G~---gEt~eeri~~l~~lr~l~~~~~  229 (328)
T Consensus       109 np~l~~~~---------------~~~fG~q~Iv~siD~k~~~~~~~~~~~~i~~~~~~~~t~~~~~~~~~~~~~~G~--g  171 (257)
T PRK02747        109 RPEFVAEA---------------ADKFGSQCIVVAIDAKRVSPAGENDRWEIFTHGGRKPTGIDAVEFAQKVVSLGA--G  171 (257)
T ss_pred             CCHHHHHH---------------HHHCCCEEEEEEEEEEECCCCCCCCCEEEEECCCCEECCCHHHHHHHHHHHCCC--C
T ss_conf             83477778---------------875596579999987751576778738999889846343039999999997099--8


Q ss_pred             EEECCCEEECCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCEEEEHHHHHCHHHHHHHHHHCCCEEEECCEEECCCCCC
Q ss_conf             02054112048741244568798999999999999686872142311565165689999980998899778665158889
Q gi|254780485|r  230 SIPINLLIPIPGSKFEENKKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPS  309 (328)
Q Consensus       230 ~v~~~~~~p~~gt~l~~~~~~~~~e~lr~iAi~RL~lP~~~i~i~~~~~~~~~~~~~~~L~~GaN~~~~g~~~~t~~g~~  309 (328)
T Consensus       172 eil~-tdI~rDG~-~~---G~d-l~l~~~i~~---~~~-~pvIasGGv-~~~~di~~~~~~~~~~av~~g~~-~~~~~~~  239 (257)
T PRK02747        172 EILL-TSMDRDGT-KA---GFD-LPLTRAIAD---AVR-VPVIASGGV-GTLDHLVEGVRDGHATAVLAASI-FHFGTYT  239 (257)
T ss_pred             EEEE-EEECCCCC-CC---CCC-HHHHHHHHH---CCC-CCEEEECCC-CCHHHHHHHHHHCCCCEEEEHHH-HHCCCCC
T ss_conf             8999-98835573-26---788-699999986---079-989997799-99999999998389849988326-7769989


Q ss_pred             HHHHHHHHHHCCCCCC
Q ss_conf             8999999998298532
Q gi|254780485|r  310 YNKDTILFNRLGLIPD  325 (328)
Q Consensus       310 ~~~~~~~i~~~G~~P~  325 (328)
T Consensus       240 l~~ak~~L~~~~i~vR  255 (257)
T PRK02747        240 IGEAKAHMAAAGIPMR  255 (257)
T ss_pred             HHHHHHHHHHCCCCCC
T ss_conf             9999999998789654