HHsearch alignment for GI: 254780485 and conserved domain: PRK05660

>PRK05660 coproporphyrinogen III oxidase; Provisional.
Probab=99.57  E-value=6.4e-13  Score=106.26  Aligned_cols=205  Identities=14%  Similarity=0.196  Sum_probs=139.1

Q ss_pred             EEECCCCCCCCCCCCCCCCCCC-CC--CCCCCCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCCCCHHHHHHHHHHHCC
Q ss_conf             4530786834232124335477-75--64100068579999999999649838997303688874428999998876213
Q gi|254780485|r   58 LNIKTGGCPENCGYCNQSVHNK-SK--LKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKS  134 (328)
Q Consensus        58 in~~TN~C~~~C~fCaf~~~~~-~~--~~~~~~~~~Eei~~~a~~~~~~G~~~~~l~~~~~~~~~~~~~~~~e~i~~i~~  134 (328)
T Consensus        11 iHiP--FC~~~C~YC~f~~~~~~~~~~~~~Y~~aL~~ei~~~~~~~~~~~i~tiy~--GGGTPs~L~~~~l~~l~~~i~~   86 (378)
T PRK05660         11 IHIP--WCVQKCPYCDFNSHALKGEVPEDEYVDHLLADLDADLPLVQGREVHSIFI--GGGTPSLFSAEAIQRLLDGVRA   86 (378)
T ss_pred             EECC--CCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCEEEEEEE--CCCHHHHCCHHHHHHHHHHHHH
T ss_conf             9727--89876999969650488877699999999999999877617975769997--8953330899999999999998


Q ss_pred             C-----CCCEE--EECCCCCHHHHHHHHCCCCCEEEEECCC-CHHHHHCCCCCCCHHHHHHHHHHHHHCCCC-CCCEEEE
Q ss_conf             6-----88324--1025699999998741576069751343-777732058888989999999999987985-5770786
Q gi|254780485|r  135 L-----GLETC--MTLGMLSFEQAQILSKAGLDYYNHNIDT-SERFYPHVTTTHTFEDRLQTLENVRKSGIK-VCCGGIL  205 (328)
Q Consensus       135 ~-----~~~i~--~~~g~~~~~~~~~Lk~aG~~~~~~~let-~~~~~~~~~~~~~~~~~l~~~~~a~~~G~~-~~sg~l~  205 (328)
T Consensus        87 ~f~~~~~~EiTiE~nP~~~~~~~l~~l~~~GvnRiSiGVQsf~~~~l~~lgR~h~~~~~~~ai~~~r~~gf~~iniDLiy  166 (378)
T PRK05660         87 RLPFAPDAEITMEANPGTVEADRFVGYQRAGVNRISIGVQSFSEEKLKRLGRIHGPDEAKRAAKLAQGAGLRSFNLDLMH  166 (378)
T ss_pred             HCCCCCCCEEEEECCCCCCCHHHHHHHHHCCCCEEEEEECCCCHHHHHHHCCCCCHHHHHHHHHHHHHCCCCEEEECCCC
T ss_conf             57987771489845705330889999998098759996143789999982799999999999999997699606542326


Q ss_pred             CC-CCCHHHHHHHHHHHHHCCCCCCEEECCCEEECCCCCCCCCCC--CCHHHHHHHHHHHHHHCCC
Q ss_conf             68-989999999999997408888602054112048741244568--7989999999999996868
Q gi|254780485|r  206 GL-GEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKK--VDPIEHVRIISVARILMPK  268 (328)
Q Consensus       206 G~-gEt~eeri~~l~~lr~l~~~~~~v~~~~~~p~~gt~l~~~~~--~~~~e~lr~iAi~RL~lP~  268 (328)
T Consensus       167 GlP~Qt~~~~~~~l~~~~~l~p--~his~Y~L~~e~~T~~~~~~~~lp~~~~~~~my~~~~~~L~~  230 (378)
T PRK05660        167 GLPDQSLEEALDDLRQAIALNP--PHLSWYQLTIEPNTVFGSRPPVLPDDDALWDIFEQGHQLLTA  230 (378)
T ss_pred             CCCCCCHHHHHHHHHHHHCCCC--CCEEEEEEEECCCCHHHHCCCCCCCHHHHHHHHHHHHHHHHH
T ss_conf             8999889999999999864498--805788888658973764676699858999999999999997