HHsearch alignment for GI: 254780485 and conserved domain: PRK05926

>PRK05926 hypothetical protein; Provisional.
Probab=100.00  E-value=0  Score=469.91  Aligned_cols=317  Identities=16%  Similarity=0.168  Sum_probs=262.4

Q ss_pred             HHHHHHHHHCCCCCCCCHHHHHHHH---C-CCHHHHHHHHHHHHHHHCCCCEEEEEEEEEEC-CCCCCCCCCCCCCCCCC
Q ss_conf             5732134200234478999999997---3-99189999999998886289856999864530-78683423212433547
Q gi|254780485|r    4 STVVPEENPTKKPKVWTSKEVFQIY---N-MPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIK-TGGCPENCGYCNQSVHN   78 (328)
Q Consensus         4 ~~~~~~~~~~~~~e~ls~eea~~L~---~-~~~~el~~~Aa~~~r~~~~g~~V~~~~~in~~-TN~C~~~C~fCaf~~~~   78 (328)
T Consensus        14 ~~l~~IleKv~~G~RLs~~dg~~L~~l~~~~dl~~lg~~Ad~~R~~-~~Gd~Vtfv~nr~INyTNvC~~~C~FCaF~r~~   92 (371)
T PRK05926         14 SWLKTLFDKYLSGARLSEEDALQLLLLTDKEDQRALWSFADQVRKN-RVGDTVYYSSTLYLYPTNFCDFNCTFCSFYAKP   92 (371)
T ss_pred             HHHHHHHHHHHCCCCCCHHHHHHHHHCCCCCHHHHHHHHHHHHHHH-HCCCEEEEEEECCCCCCHHHHCCCCCCCCCCCC
T ss_conf             6899999999779999999999998348752599999999999997-569978996245865211342679247763689


Q ss_pred             CCCCCCCCCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCCCCHHHHHHHHHHHCCCCCCEEEEC-------------CC
Q ss_conf             77564100068579999999999649838997303688874428999998876213688324102-------------56
Q gi|254780485|r   79 KSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLGLETCMTL-------------GM  145 (328)
Q Consensus        79 ~~~~~~~~~~~~Eei~~~a~~~~~~G~~~~~l~~~~~~~~~~~~~~~~e~i~~i~~~~~~i~~~~-------------g~  145 (328)
T Consensus        93 ~--~~~aY~ls~eei~~~v~e-~~~g~tEv~i~GG~h--P~l~~~yY~~l~~~ik~~~P~v~ihaft~~EI~~~a~~~~~  167 (371)
T PRK05926         93 G--DPKGWFYTPDQLIQSIQE-IKSPITETHIVAGCF--PSCNLAYYEELFSKIKENFPDIHIKALTAIEYAYLSKLDNL  167 (371)
T ss_pred             C--CCCCCCCCHHHHHHHHHH-HHCCCCEEEEECCCC--CCCCHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHCCC
T ss_conf             9--976523899999999999-875996899717889--89986999999999997589874144889999999998099


Q ss_pred             CCHHHHHHHHCCCCCEE-EEECCC-CHHHHHCCCC-CCCHHHHHHHHHHHHHCCCCCCCEEEECCCCCHHHHHHHHHHHH
Q ss_conf             99999998741576069-751343-7777320588-88989999999999987985577078668989999999999997
Q gi|254780485|r  146 LSFEQAQILSKAGLDYY-NHNIDT-SERFYPHVTT-THTFEDRLQTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLA  222 (328)
Q Consensus       146 ~~~~~~~~Lk~aG~~~~-~~~let-~~~~~~~~~~-~~~~~~~l~~~~~a~~~G~~~~sg~l~G~gEt~eeri~~l~~lr  222 (328)
T Consensus       168 s~~EvL~~Lk~AGL~SlPGgGAEIl~d~VR~~I~p~K~~~~~Wlei~~~AH~lGi~t~ATMmyGHiEt~~~rv~HL~~lR  247 (371)
T PRK05926        168 PVREVLQTLKIAGLDSIPGGGAEILVDEIRETLAPGRLSSQDFLEIHKTAHSLGIPSNATMLCYHRETPEDIVTHMSKLR  247 (371)
T ss_pred             CHHHHHHHHHHHCCCCCCCCCHHHCCHHHHHHHCCCCCCHHHHHHHHHHHHHCCCCCCEEEECCCCCCHHHHHHHHHHHH
T ss_conf             99999999998387778887324347789997588989899999999999986997520465246699999999999999


Q ss_pred             HCCCCCCEEE-CCCEE-ECCCCCCCCC----CCCCHHHHHHHHHHHHHHCCCCCCEEEEHHHHHCHHHHHHHHHHCCC--
Q ss_conf             4088886020-54112-0487412445----68798999999999999686872142311565165689999980998--
Q gi|254780485|r  223 NLSTPPESIP-INLLI-PIPGSKFEEN----KKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGAN--  294 (328)
Q Consensus       223 ~l~~~~~~v~-~~~~~-p~~gt~l~~~----~~~~~~e~lr~iAi~RL~lP~~~i~i~~~~~~~~~~~~~~~L~~GaN--  294 (328)
T Consensus       248 ~lQdeTgGF~~FIpl~F~p~nt~l~~~~~~~~~~~~~~~lk~iAvsRL~Ldn-i~hIqasWv~~G~~~aq~aL~~GAnDl  326 (371)
T PRK05926        248 DLQDETLGFKNFILLKFASENNALGKRLRKMGQRHSIPPASIIAVARLFLDN-FSNIKALWNYLGIEVALHLLSCGANDL  326 (371)
T ss_pred             HHHHHCCCCEEEEECCCCCCCCCHHHHCCCCCCCCCHHHHHHHHHHHHHCCC-CCCEEEEHHHCCHHHHHHHHHCCCCCC
T ss_conf             9887529942997244247788220202688887740678999999997069-876785000025999999995699767


Q ss_pred             -EEEECCEEECCCC------CCHHHHHHHHHHCCCCCCCC
Q ss_conf             -8997786651588------89899999999829853247
Q gi|254780485|r  295 -SIFVGDTLLTAKN------PSYNKDTILFNRLGLIPDLS  327 (328)
Q Consensus       295 -~~~~g~~~~t~~g------~~~~~~~~~i~~~G~~P~~~  327 (328)
T Consensus       327 gGT~~eE~I~~aAGa~~~~~~~~~el~~lI~~aGr~P~~R  366 (371)
T PRK05926        327 SSTHMGEKVFQMASSKEPIKMDIEGMAALITQQGRIPCLT  366 (371)
T ss_pred             CCCCCCCEEEHHHCCCCCCCCCHHHHHHHHHHCCCCCCCC
T ss_conf             6553133464310279988789999999999849955605