HHsearch alignment for GI: 254780485 and conserved domain: PRK07028

>PRK07028 bifunctional hexulose-6-phosphate synthase/ribonuclease regulator; Validated.
Probab=94.60  E-value=0.39  Score=27.26  Aligned_cols=214  Identities=15%  Similarity=0.195  Sum_probs=100.1

Q ss_pred             CCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCC-CCCHHHHHHHHHHHCC-CCCCEEEECCCCCHHHHHHHHCCCCCEEE
Q ss_conf             006857999999999964983899730368887-4428999998876213-68832410256999999987415760697
Q gi|254780485|r   86 KLINVDQVLKEAKNAKENGATRYCMGAAWREPK-ERDLSIIVDMIKGVKS-LGLETCMTLGMLSFEQAQILSKAGLDYYN  163 (328)
Q Consensus        86 ~~~~~Eei~~~a~~~~~~G~~~~~l~~~~~~~~-~~~~~~~~e~i~~i~~-~~~~i~~~~g~~~~~~~~~Lk~aG~~~~~  163 (328)
T Consensus       113 DlI~v~d~~~ra~el~~lGvd~I~vH~G~D~Q~~g~~---p~~~l~~v~~~~~~~vAV-AGGi~~~t~~~~v~~GAdIvI  188 (429)
T PRK07028        113 DLINVPDPVKRAVELEELGVDIINVHVGIDQQMLGKD---PLELLKKVSEEVSIPIAA-AGGLDAETAVKAVEAGADIVI  188 (429)
T ss_pred             EECCCCCHHHHHHHHHHCCCCEEEEEEEECHHHCCCC---HHHHHHHHHHHCCCEEEE-ECCCCHHHHHHHHHCCCCEEE
T ss_conf             8558998899999999709988999762335531798---499999999755971899-668787769999975998999


Q ss_pred             EECCCCHHHHHCCCCCCCHHHHHHHHHHHHHCCCCCCCEEEECCCCCHHHHHHHHH-HHHH------CCCCCCEEECCCE
Q ss_conf             51343777732058888989999999999987985577078668989999999999-9974------0888860205411
Q gi|254780485|r  164 HNIDTSERFYPHVTTTHTFEDRLQTLENVRKSGIKVCCGGILGLGEMIDDRIDMLL-TLAN------LSTPPESIPINLL  236 (328)
Q Consensus       164 ~~let~~~~~~~~~~~~~~~~~l~~~~~a~~~G~~~~sg~l~G~gEt~eeri~~l~-~lr~------l~~~~~~v~~~~~  236 (328)
T Consensus       189 VGga--------I~~a~dp~~aAr~ir~ai~~~~~~~~~----~~~~~~~~~~~~~~~vs~~n~sdamhr~~~~~~~~p~  256 (429)
T PRK07028        189 VGGN--------IYKSADVTGAARDIREALDSPPVPTDK----FKKSLDEEIRELFKEVSTSNISDAMHRKGAMKGLKPL  256 (429)
T ss_pred             ECCC--------CCCCCCHHHHHHHHHHHHHCCCCCCCC----CCCCHHHHHHHHHHHCCCCCCCHHHHHHCCCCCCEEC
T ss_conf             8940--------057999799999999997376767652----0022389999999851887611566640455785442


Q ss_pred             EECCCCCCCCCC---CCCHHHHHHHHHHHHHHCCCCCCEEEE-HHH-H-HCHHHHHHHHHHCCCEEEECCEEECCCCCCH
Q ss_conf             204874124456---879899999999999968687214231-156-5-1656899999809988997786651588898
Q gi|254780485|r  237 IPIPGSKFEENK---KVDPIEHVRIISVARILMPKSRLRLAA-GRA-M-MSDELQALCFFSGANSIFVGDTLLTAKNPSY  310 (328)
Q Consensus       237 ~p~~gt~l~~~~---~~~~~e~lr~iAi~RL~lP~~~i~i~~-~~~-~-~~~~~~~~~L~~GaN~~~~g~~~~t~~g~~~  310 (328)
T Consensus       257 --~~~~k~~G~avTV~t~~gD~~~~~~AiD~A~PGDViVId~~G~d~A~WGeLmt~aA~~rGIaG~VIDGa---------  325 (429)
T PRK07028        257 --VRGLKMVGPAVTVQTFAGDWAKPVEAIDVAEPGDVLVIDNCSSDIAPWGGLATLSCLNKGIAGVVIDGA---------  325 (429)
T ss_pred             --CCCCEEEEEEEEEEECCCCCCCHHHHHHCCCCCCEEEEECCCCCCEEEHHHHHHHHHHCCCEEEEEECC---------
T ss_conf             --468634666799995688740567786247999789996799975130899999999879819997015---------


Q ss_pred             HHHHHHHHHCCCCCCCC
Q ss_conf             99999999829853247
Q gi|254780485|r  311 NKDTILFNRLGLIPDLS  327 (328)
Q Consensus       311 ~~~~~~i~~~G~~P~~~  327 (328)
T Consensus       326 vRDv~eIr~lgf-PVFa  341 (429)
T PRK07028        326 VRDVDEIRKLGF-PVFA  341 (429)
T ss_pred             CCCHHHHHHCCC-CEEE
T ss_conf             669999984599-8698