HHsearch alignment for GI: 254780485 and conserved domain: PRK07379

>PRK07379 coproporphyrinogen III oxidase; Provisional.
Probab=99.58  E-value=1.1e-12  Score=104.80  Aligned_cols=208  Identities=15%  Similarity=0.230  Sum_probs=141.5

Q ss_pred             EEEEEECCCCCCCCCCCCCCCCCC---CCCCCCC--CCCCHHHHHHHHHHHHH--CCCEEEEEECCCCCCCCCCHHHHHH
Q ss_conf             986453078683423212433547---7756410--00685799999999996--4983899730368887442899999
Q gi|254780485|r   55 SKLLNIKTGGCPENCGYCNQSVHN---KSKLKAS--KLINVDQVLKEAKNAKE--NGATRYCMGAAWREPKERDLSIIVD  127 (328)
Q Consensus        55 ~~~in~~TN~C~~~C~fCaf~~~~---~~~~~~~--~~~~~Eei~~~a~~~~~--~G~~~~~l~~~~~~~~~~~~~~~~e  127 (328)
T Consensus        12 slYiHIP--FC~~~C~YCdF~~~v~~~~~~~~~~~~~~~Y~~~L~~Ei~~~~~~~~~i~tiy~G--GGTPSlL~~~~l~~   87 (399)
T PRK07379         12 SAYLHIP--FCRRRCFYCDFPISVVGDRQRGGTSGLIEEYVEVLCQEIAITPSLGQPLQTVFFG--GGTPSLLPVEQLER   87 (399)
T ss_pred             EEEEECC--CCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHCCCCCEEEEEEC--CCHHHHCCHHHHHH
T ss_conf             4888650--0669288999975176666665405799999999999997314159962189969--95567489999999


Q ss_pred             HHHHHCCC-----CCCEE--EECCCCCHHHHHHHHCCCCCEEEEECCC-CHHHHHCCCCCCCHHHHHHHHHHHHHCCCC-
Q ss_conf             88762136-----88324--1025699999998741576069751343-777732058888989999999999987985-
Q gi|254780485|r  128 MIKGVKSL-----GLETC--MTLGMLSFEQAQILSKAGLDYYNHNIDT-SERFYPHVTTTHTFEDRLQTLENVRKSGIK-  198 (328)
Q Consensus       128 ~i~~i~~~-----~~~i~--~~~g~~~~~~~~~Lk~aG~~~~~~~let-~~~~~~~~~~~~~~~~~l~~~~~a~~~G~~-  198 (328)
T Consensus        88 ll~~l~~~f~~~~~~EiTiE~nP~~~~~~~l~~l~~~GvNRiSiGvQSf~~~~L~~lgR~h~~~~~~~ai~~~~~~gf~n  167 (399)
T PRK07379         88 ILLTLDQRFGIAPDAEISLEIDPGTFDLEQLQGYRSLGVNRVSLGVQAFQDELLALCGRSHRVKDIYQAVADIHQAGIEN  167 (399)
T ss_pred             HHHHHHHHCCCCCCCEEEEEECCCCCCHHHHHHHHHCCCCEEEEEECCCCHHHHHHHCCCCCHHHHHHHHHHHHHCCCCC
T ss_conf             99999986899988579998458989999999998569885889702386889998489999999999999999769975


Q ss_pred             CCCEEEECC-CCCHHHHHHHHHHHHHCCCCCCEEECCCEEECCCCCCCCC------CCCCHHHHHHHHHHHHHHCCC
Q ss_conf             577078668-9899999999999974088886020541120487412445------687989999999999996868
Q gi|254780485|r  199 VCCGGILGL-GEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEEN------KKVDPIEHVRIISVARILMPK  268 (328)
Q Consensus       199 ~~sg~l~G~-gEt~eeri~~l~~lr~l~~~~~~v~~~~~~p~~gt~l~~~------~~~~~~e~lr~iAi~RL~lP~  268 (328)
T Consensus       168 iniDLIyGlPgQt~~~~~~~l~~~~~l~p--~hiS~Y~L~~e~~T~~~~~~~~~~~~lp~~~~~~~~~~~~~~~L~~  242 (399)
T PRK07379        168 FSLDLISGLPHQTLEDWQASLEAAIAINP--THLSCYDLVLEPVTAFGKQYQPGKAPLPSDETTAAMYRLAQEILTQ  242 (399)
T ss_pred             EEEEEEECCCCCCHHHHHHHHHHHHHCCC--CEEEEEEEEECCCCHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHHH
T ss_conf             54553307899889999999999973388--8078888896389779998605888999989999999999999986