HHsearch alignment for GI: 254780485 and conserved domain: PRK08005

>PRK08005 ribulose-phosphate 3-epimerase; Validated.
Probab=91.19  E-value=1.2  Score=23.97  Aligned_cols=194  Identities=12%  Similarity=0.075  Sum_probs=109.7

Q ss_pred             HHHHHHHHHHHCCCEEEEE-ECCCCCCCC-CCHHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHCCCCCEEEEECCCC
Q ss_conf             9999999999649838997-303688874-42899999887621368832410256999999987415760697513437
Q gi|254780485|r   92 QVLKEAKNAKENGATRYCM-GAAWREPKE-RDLSIIVDMIKGVKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTS  169 (328)
Q Consensus        92 ei~~~a~~~~~~G~~~~~l-~~~~~~~~~-~~~~~~~e~i~~i~~~~~~i~~~~g~~~~~~~~~Lk~aG~~~~~~~let~  169 (328)
T Consensus        14 ~L~~ei~~l~~~g~d~lHiDIMDG~FVPNitfg~~~v~~ir~~t~~p~DvHLMv~-~P~~~i~~~~~~g~d~it~H~Ea~   92 (210)
T PRK08005         14 RYAEALTALHDAPLGSLHLDIEDTSFINNITFGMKTIQAVAQYTRHPLSFHLMVS-SPQRWLPWLAAIRPGWIFIHAESV   92 (210)
T ss_pred             HHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCHHHHHHHHHCCCCCEEEEEEEC-CHHHHHHHHHHCCCCEEEEECCCC
T ss_conf             9999999999779998998288898277456298999999861899807999868-889999999972998599935677


Q ss_pred             HHHHHCCCCCCCHHHHHHHHHHHHHCCCCCCCEEEECCCCCHHHHHHHHHHHHHCCCCCCEEECCCEEECCCCCCCCCCC
Q ss_conf             77732058888989999999999987985577078668989999999999997408888602054112048741244568
Q gi|254780485|r  170 ERFYPHVTTTHTFEDRLQTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKK  249 (328)
Q Consensus       170 ~~~~~~~~~~~~~~~~l~~~~~a~~~G~~~~sg~l~G~gEt~eeri~~l~~lr~l~~~~~~v~~~~~~p~~gt~l~~~~~  249 (328)
T Consensus        93 ~~----------~---~~~i~~Ik~~g~k~--GlAlnP-~T~i~~~~~~--l~~v----D~VLvMtV--~PGf--~GQ~F  146 (210)
T PRK08005         93 QN----------P---SEILADIRAIGAKA--GLALNP-ATPLLPYRYL--ALQL----DALMIMTS--EPDG--RGQQF  146 (210)
T ss_pred             CC----------H---HHHHHHHHHCCCEE--EEEECC-CCCHHHHHHH--HHCC----CEEEEEEE--CCCC--CCCCC
T ss_conf             69----------9---99999999749807--888379-9987998730--4007----98999877--8999--87211


Q ss_pred             CCHHHHHHHHHHHHHHCCCCCCEEEEHHHHHCHHHHHHHHHHCCCEEEECCEEECCCCCCHHHHHHHHHH
Q ss_conf             7989999999999996868721423115651656899999809988997786651588898999999998
Q gi|254780485|r  250 VDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTILFNR  319 (328)
Q Consensus       250 ~~~~e~lr~iAi~RL~lP~~~i~i~~~~~~~~~~~~~~~L~~GaN~~~~g~~~~t~~g~~~~~~~~~i~~  319 (328)
T Consensus       147 --i~~~~~KI~~~r~~~~~~~I~vDGG---In~~t~~~~~~aGad~~V~GSaiF~~~--d~~~~i~~lr~  209 (210)
T PRK08005        147 --IAAMCEKVSQSREHFPAAECWADGG---ITLRAARLLAAAGAQHLVIGRALFTTA--NYDVTLSQFTA  209 (210)
T ss_pred             --CHHHHHHHHHHHHHCCCCCEEEECC---CCHHHHHHHHHCCCCEEEECHHHHCCC--CHHHHHHHHHC
T ss_conf             --7889999999996287788899788---788999999986999999790653699--99999999863