HHsearch alignment for GI: 254780485 and conserved domain: PRK08444

>PRK08444 hypothetical protein; Provisional.
Probab=100.00  E-value=0  Score=500.07  Aligned_cols=312  Identities=18%  Similarity=0.220  Sum_probs=273.3

Q ss_pred             HHHHHCCCCCCCCHHHHHHHHCCCHHHHHHHHHHHHHHHCCCCEEEEEEEEEEC-CCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             134200234478999999997399189999999998886289856999864530-7868342321243354777564100
Q gi|254780485|r    8 PEENPTKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIK-TGGCPENCGYCNQSVHNKSKLKASK   86 (328)
Q Consensus         8 ~~~~~~~~~e~ls~eea~~L~~~~~~el~~~Aa~~~r~~~~g~~V~~~~~in~~-TN~C~~~C~fCaf~~~~~~~~~~~~   86 (328)
T Consensus         2 dIleKv~~gerls~ee~~~L~~~dl~~L~~~Ad~~R~~-~~G~~vtfv~n~~IN~TNiC~~~C~FCaF~r~~~~--~~aY   78 (353)
T PRK08444          2 NLLEKLENNERLNQEEAVALYDLDLFTLGKYADRKRTK-LHGKKVYFNINRHINPTNICADVCKFCAFSAHRKN--PNPY   78 (353)
T ss_pred             CHHHHHHCCCCCCHHHHHHHHCCCHHHHHHHHHHHHHH-HCCCEEEEEECCCCCCCCCCCCCCCCCCCCCCCCC--CCCE
T ss_conf             48889876998999999999868999999999999998-77991699820574566445688856756168999--9876


Q ss_pred             CCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCCCCHHHHHHHHHHHCCCCCCEEEEC-------------CCCCHHHHHH
Q ss_conf             068579999999999649838997303688874428999998876213688324102-------------5699999998
Q gi|254780485|r   87 LINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLGLETCMTL-------------GMLSFEQAQI  153 (328)
Q Consensus        87 ~~~~Eei~~~a~~~~~~G~~~~~l~~~~~~~~~~~~~~~~e~i~~i~~~~~~i~~~~-------------g~~~~~~~~~  153 (328)
T Consensus        79 ~ls~eei~~~~~ea~~~G~tev~i~GG~~P--~~~~eyY~~l~r~ik~~~P~i~i~aft~~EI~~~a~~~~~s~~evL~~  156 (353)
T PRK08444         79 TMSHEEILEIVKESVKRGIKEVHIVSAHNP--NYGYQWYLEIFKMIKEAYPNLHVKAMTAAEVDFLSRKFGKSYEEVLED  156 (353)
T ss_pred             ECCHHHHHHHHHHHHHCCCCEEEEECCCCC--CCCHHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHHCCCCHHHHHHH
T ss_conf             669999999999999759878998147598--997588999999999858850477177899999999809999999999


Q ss_pred             HHCCCCCEE-EEECCC-CHHHHHCCCCCC-CHHHHHHHHHHHHHCCCCCCCEEEECCCCCHHHHHHHHHHHHHCCCCCCE
Q ss_conf             741576069-751343-777732058888-98999999999998798557707866898999999999999740888860
Q gi|254780485|r  154 LSKAGLDYY-NHNIDT-SERFYPHVTTTH-TFEDRLQTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPES  230 (328)
Q Consensus       154 Lk~aG~~~~-~~~let-~~~~~~~~~~~~-~~~~~l~~~~~a~~~G~~~~sg~l~G~gEt~eeri~~l~~lr~l~~~~~~  230 (328)
T Consensus       157 Lk~AGL~slpGggAEIl~d~VR~~I~p~K~~~~~Wl~i~~~AH~lGi~ttaTmmyGhvEt~e~rv~HL~~lR~lQd~tgG  236 (353)
T PRK08444        157 MLEYGVDSMPGGGAEIFDEEVRKKICKGKVSSERWLEIHKYWHKKGKQSNATMLFGHIENREHRIDHMLRLRDLQDKTGG  236 (353)
T ss_pred             HHHHCCCCCCCCCCHHCCHHHHHHHCCCCCCHHHHHHHHHHHHHCCCCCCEEEECCCCCCHHHHHHHHHHHHHHCCCCCC
T ss_conf             99819875789872003777897618998999999999999998299664146778879999999999999983655798


Q ss_pred             EECCCEEE----CCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCEEEEHHHHHCHHHHHHHHHHCCC---EEEECCEEE
Q ss_conf             20541120----48741244568798999999999999686872142311565165689999980998---899778665
Q gi|254780485|r  231 IPINLLIP----IPGSKFEENKKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGAN---SIFVGDTLL  303 (328)
Q Consensus       231 v~~~~~~p----~~gt~l~~~~~~~~~e~lr~iAi~RL~lP~~~i~i~~~~~~~~~~~~~~~L~~GaN---~~~~g~~~~  303 (328)
T Consensus       237 F~--~FIPl~f~~~~t~l~~~~~~t~~e~Lr~~AisRl~Ldn-i~~IqasWv~~G~~~aq~aL~~GanDlggT~~eE~i~  313 (353)
T PRK08444        237 FN--AFIPLVYQRENNYLKVEKFPSSQEILKTIAISRILLDN-IPHIKAYWATLTLNLALVAQEFGANDLDGTIEKESIQ  313 (353)
T ss_pred             EE--EEEECCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHCC-CCCCEEEEEECCHHHHHHHHHCCCCCCCCCCCCCCEE
T ss_conf             35--89765657899857778999989999999999998638-7861544562378999999966996775555545244


Q ss_pred             CCCC------CCHHHHHHHHHHCCCCCCCC
Q ss_conf             1588------89899999999829853247
Q gi|254780485|r  304 TAKN------PSYNKDTILFNRLGLIPDLS  327 (328)
Q Consensus       304 t~~g------~~~~~~~~~i~~~G~~P~~~  327 (328)
T Consensus       314 ~~aGa~~~~~~~~~~l~~~I~~aG~~P~eR  343 (353)
T PRK08444        314 SAAGAKSAHGLSKEDFIFLIKDSGFIPVER  343 (353)
T ss_pred             CCCCCCCCCCCCHHHHHHHHHHCCCCEEEE
T ss_conf             212589988899999999999859975521