HHsearch alignment for GI: 254780485 and conserved domain: PRK08508

>PRK08508 biotin synthase; Provisional.
Probab=100.00  E-value=0  Score=491.61  Aligned_cols=274  Identities=40%  Similarity=0.653  Sum_probs=262.5

Q ss_pred             CEEEEEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCCCCHHHHHHHH
Q ss_conf             85699986453078683423212433547775641000685799999999996498389973036888744289999988
Q gi|254780485|r   50 NHIQLSKLLNIKTGGCPENCGYCNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMI  129 (328)
Q Consensus        50 ~~V~~~~~in~~TN~C~~~C~fCaf~~~~~~~~~~~~~~~~Eei~~~a~~~~~~G~~~~~l~~~~~~~~~~~~~~~~e~i  129 (328)
T Consensus         2 ~~v~lcsi~n~KSG~C~edC~yCaQs~~~~t~i~~Y~l~~~eeIl~~A~~a~~~G~~rf~lv~sg~~~~~~~~e~v~~~v   81 (279)
T PRK08508          2 QEIFLCAISNISSGNCKEDCKYCTQSAHYKADIKRYKRKEIEQIVQEAKMARANGALGFCLVTAGRGLDDKKLEYVAKAA   81 (279)
T ss_pred             CEEEEEEEEECCCCCCCCCCCCCCCCCCCCCCCCEECCCCHHHHHHHHHHHHHCCCCEEEEEEECCCCCHHHHHHHHHHH
T ss_conf             64799888734137999878644481767999861078999999999999997599768999823688754499999999


Q ss_pred             HHHCCC--CCCEEEECCCCCHHHHHHHHCCCCCEEEEECCCCHHHHHCCCCCCCHHHHHHHHHHHHHCCCCCCCEEEECC
Q ss_conf             762136--883241025699999998741576069751343777732058888989999999999987985577078668
Q gi|254780485|r  130 KGVKSL--GLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSGIKVCCGGILGL  207 (328)
Q Consensus       130 ~~i~~~--~~~i~~~~g~~~~~~~~~Lk~aG~~~~~~~let~~~~~~~~~~~~~~~~~l~~~~~a~~~G~~~~sg~l~G~  207 (328)
T Consensus        82 ~~Ik~~~~~l~~c~slG~l~~e~~~~LkeAGvdrY~hNlETs~~~y~~I~tThty~dRl~tl~~~k~aGl~vCsGgIiGl  161 (279)
T PRK08508         82 KAVKKEVPGLHLIACNGMASVEQLKELKKAGIFSYNHNLETSKEFFPKICTTHSWEERFQTCLNAKEAGLGLCSGGIFGL  161 (279)
T ss_pred             HHHHHCCCCEEEEEECCCCCHHHHHHHHHCCCCEECCCCCCCHHHHCCCCCCCCHHHHHHHHHHHHHCCCEEECCCEEEC
T ss_conf             99863379935761178579999999998397123076676768757658998889999999999981994867854478


Q ss_pred             CCCHHHHHHHHHHHHHCCCCCCEEECCCEEECCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCEEEEHHHHHCHHHHHH
Q ss_conf             98999999999999740888860205411204874124456879899999999999968687214231156516568999
Q gi|254780485|r  208 GEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQAL  287 (328)
Q Consensus       208 gEt~eeri~~l~~lr~l~~~~~~v~~~~~~p~~gt~l~~~~~~~~~e~lr~iAi~RL~lP~~~i~i~~~~~~~~~~~~~~  287 (328)
T Consensus       162 GEt~edrve~a~~L~eL~--~dsVPIN~liPi~GTPLe-~~~l~~~e~lr~iAl~RlilP~a~Ir~agGRe~~l~~~q~~  238 (279)
T PRK08508        162 GESWEDRISMLKSLASLS--PHSTPINFFIPNPALPLD-TPTLSADEALEIVRLAKEALPNARLMVAGGREVVFGERQYE  238 (279)
T ss_pred             CCCHHHHHHHHHHHHHCC--CCEECCCCCCCCCCCCCC-CCCCCHHHHHHHHHHHHHHCCCCEEEECCCHHHHCHHHHHH
T ss_conf             999899999999998389--987515676589999888-89999999999999999978987656246524455636999


Q ss_pred             HHHHCCCEEEECCEEECCCCCCHHHHHHHHHHCCCCCCCC
Q ss_conf             9980998899778665158889899999999829853247
Q gi|254780485|r  288 CFFSGANSIFVGDTLLTAKNPSYNKDTILFNRLGLIPDLS  327 (328)
Q Consensus       288 ~L~~GaN~~~~g~~~~t~~g~~~~~~~~~i~~~G~~P~~~  327 (328)
T Consensus       239 ~~~aGaN~i~~G~yL-Tt~G~~~~~D~~mi~~lG~~v~~~  277 (279)
T PRK08508        239 IFEAGANAIVIGDYL-TTKGEAPKKDIEKLKSLGFEFASS  277 (279)
T ss_pred             HHHHCCCEEEECCCC-CCCCCCHHHHHHHHHHCCCEEECC
T ss_conf             998468468886652-789978679999999869934124