HHsearch alignment for GI: 254780485 and conserved domain: PRK08949

>PRK08949 consensus.
Probab=99.54  E-value=1.3e-12  Score=104.25  Aligned_cols=199  Identities=17%  Similarity=0.273  Sum_probs=135.6

Q ss_pred             EEECCCCCCCCCCCCCCCCCC-CCCC--CCCCCCCHHHHHHHHHH----HHHCCCEEEEEECCCCCCCCCCHHHHHHHHH
Q ss_conf             453078683423212433547-7756--41000685799999999----9964983899730368887442899999887
Q gi|254780485|r   58 LNIKTGGCPENCGYCNQSVHN-KSKL--KASKLINVDQVLKEAKN----AKENGATRYCMGAAWREPKERDLSIIVDMIK  130 (328)
Q Consensus        58 in~~TN~C~~~C~fCaf~~~~-~~~~--~~~~~~~~Eei~~~a~~----~~~~G~~~~~l~~~~~~~~~~~~~~~~e~i~  130 (328)
T Consensus        11 iHIP--FC~~~C~YCdf~s~~~~~~~~~~~Y~----~aL~~El~~~~~~~~~~~~~tiy~GG--GTPs~L~~~~l~~ll~   82 (378)
T PRK08949         11 IHIP--WCVQKCPYCDFNSHALKGEVPHQDYV----QHLLADLDADVAYAQGRELHTIFIGG--GTPSLLSAEAMQTLLD   82 (378)
T ss_pred             EEEC--CCCCCCCCCCCCCCCCCCCCCHHHHH----HHHHHHHHHHHHHCCCCEEEEEEEEC--CHHHHCCHHHHHHHHH
T ss_conf             9808--87671899999863288887599999----99999999865650797687999728--2320079999999999


Q ss_pred             HHCC-----CCCCEE--EECCCCCHHHHHHHHCCCCCEEEEECCC-CHHHHHCCCCCCCHHHHHHHHHHHHHCCCC-CCC
Q ss_conf             6213-----688324--1025699999998741576069751343-777732058888989999999999987985-577
Q gi|254780485|r  131 GVKS-----LGLETC--MTLGMLSFEQAQILSKAGLDYYNHNIDT-SERFYPHVTTTHTFEDRLQTLENVRKSGIK-VCC  201 (328)
Q Consensus       131 ~i~~-----~~~~i~--~~~g~~~~~~~~~Lk~aG~~~~~~~let-~~~~~~~~~~~~~~~~~l~~~~~a~~~G~~-~~s  201 (328)
T Consensus        83 ~i~~~f~~~~~~EiTiE~nP~~~~~~~l~~l~~~GvNRiSlGvQsf~~~~L~~lgR~h~~~~~~~a~~~~~~~gf~~ini  162 (378)
T PRK08949         83 GVRARLPFAADAEITMEANPGTVEADRFVGYQRAGVNRISIGVQSFSEEKLKRLGRIHGPQEAKRAAKLASGLGLRSFNL  162 (378)
T ss_pred             HHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHCCCEEEEEECCCCHHHHHHHCCCCCHHHHHHHHHHHHHCCCCCEEE
T ss_conf             99986798767058995582523188999999719866999503489899998379999999999999998659962502


Q ss_pred             EEEECC-CCCHHHHHHHHHHHHHCCCCCCEEECCCEEECCCCCCCCCCCC--CHHHHHHHHHHHHHHC
Q ss_conf             078668-9899999999999974088886020541120487412445687--9899999999999968
Q gi|254780485|r  202 GGILGL-GEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKV--DPIEHVRIISVARILM  266 (328)
Q Consensus       202 g~l~G~-gEt~eeri~~l~~lr~l~~~~~~v~~~~~~p~~gt~l~~~~~~--~~~e~lr~iAi~RL~l  266 (328)
T Consensus       163 DLiyglP~Qt~~~~~~~l~~~~~l~p--~hiS~Y~L~ie~~t~~~~~~~~lp~~~~~~~~y~~~~~~L  228 (378)
T PRK08949        163 DLMHGLPDQSLEEALDDLRQAIALNP--PHLSWYQLTIEPNTLFGSRPPVLPDDDALWDIFEQGHQLL  228 (378)
T ss_pred             CCCCCCCCCCHHHHHHHHHHHHCCCC--CEEEEEEEEECCCCHHHHCCCCCCCHHHHHHHHHHHHHHH
T ss_conf             32368999899999999999966699--8378874686489737646778997599999999999999