HHsearch alignment for GI: 254780485 and conserved domain: PRK09058

>PRK09058 coproporphyrinogen III oxidase; Provisional.
Probab=99.57  E-value=3.1e-13  Score=108.40  Aligned_cols=203  Identities=15%  Similarity=0.265  Sum_probs=138.8

Q ss_pred             EEEEEEECCCCCCCCCCCCCCCCCCC--CCCCCCCCCCHHHHHHHHHHHHH----C--CCEEEEEECCCCCCCCCCHHHH
Q ss_conf             99864530786834232124335477--75641000685799999999996----4--9838997303688874428999
Q gi|254780485|r   54 LSKLLNIKTGGCPENCGYCNQSVHNK--SKLKASKLINVDQVLKEAKNAKE----N--GATRYCMGAAWREPKERDLSII  125 (328)
Q Consensus        54 ~~~~in~~TN~C~~~C~fCaf~~~~~--~~~~~~~~~~~Eei~~~a~~~~~----~--G~~~~~l~~~~~~~~~~~~~~~  125 (328)
T Consensus        59 LYiHIP----FC~~~C~yC~F~~~~~~~~~~~~Y----~~aL~~Ei~~~~~~~~~~~~~i~tvy~GGG--TPs~L~~~~l  128 (447)
T PRK09058         59 LYIHIP----FCRTHCTFCGFFQNAWNPELVARY----TDALIRELAMEADSPLTQSAPIHAVYFGGG--TPTALSADDL  128 (447)
T ss_pred             EEEECC----CCCCCCCCCCCCCCCCCCCCHHHH----HHHHHHHHHHHHCCCCCCCCEEEEEEEECC--HHHHCCHHHH
T ss_conf             999825----415868999884848881209999----999999999985410126981689998086--3474899999


Q ss_pred             HHHHHHHCC-----CCCCEEE--ECCCCCHHHHHHHHCCCCCEEEEECCC-CHHHHHCCCCCCCHHHHHHHHHHHHHCCC
Q ss_conf             998876213-----6883241--025699999998741576069751343-77773205888898999999999998798
Q gi|254780485|r  126 VDMIKGVKS-----LGLETCM--TLGMLSFEQAQILSKAGLDYYNHNIDT-SERFYPHVTTTHTFEDRLQTLENVRKSGI  197 (328)
Q Consensus       126 ~e~i~~i~~-----~~~~i~~--~~g~~~~~~~~~Lk~aG~~~~~~~let-~~~~~~~~~~~~~~~~~l~~~~~a~~~G~  197 (328)
T Consensus       129 ~~l~~~i~~~f~l~~d~EiTiE~nP~~~~~~~l~~l~~~GvNRiSiGVQSf~~~vlk~lgR~h~~~~~~~~l~~l~~~g~  208 (447)
T PRK09058        129 ARLIEALREYLPLAPDCEITLEGRINGFDDEKIDAALDAGANRFSFGVQSFNTQVRRRAGRKDDREEVLAFLEELVARDR  208 (447)
T ss_pred             HHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHCCCCEEEEECCCCCHHHHHHCCCCCCHHHHHHHHHHHHHCCC
T ss_conf             99999999768998884698833878799999999996499805772544888899864799999999999999997499


Q ss_pred             -CCCCEEEECC-CCCHHHHHHHHHHHHHCCCCCCEEECCCEEECCCCCCCCC------C-CCCHHHHHHHHHHHHHHCCC
Q ss_conf             -5577078668-9899999999999974088886020541120487412445------6-87989999999999996868
Q gi|254780485|r  198 -KVCCGGILGL-GEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEEN------K-KVDPIEHVRIISVARILMPK  268 (328)
Q Consensus       198 -~~~sg~l~G~-gEt~eeri~~l~~lr~l~~~~~~v~~~~~~p~~gt~l~~~------~-~~~~~e~lr~iAi~RL~lP~  268 (328)
T Consensus       209 ~~iniDLIyGlPgQT~e~~~~dl~~~~~l~p--~his~Y~L~~~~~t~~~~~~~~g~l~~~~d~~~~~~my~~a~~~L~~  286 (447)
T PRK09058        209 AAVVCDLIFGLPGQTPEIWQQDLAIVRDLGL--DGVDLYALNVLPGTPLAKAVEKGKLPPPATPAEQADMYAYGVEFLAQ  286 (447)
T ss_pred             CCEEEHHHCCCCCCCHHHHHHHHHHHHCCCC--CEEEEEEEEECCCCHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHHH
T ss_conf             6376476427988999999999999964599--86887654504897799998749999985999999999999999997