HHsearch alignment for GI: 254780485 and conserved domain: PRK10076

>PRK10076 pyruvate formate lyase II activase; Provisional.
Probab=97.79  E-value=0.0038  Score=40.79  Aligned_cols=185  Identities=13%  Similarity=0.104  Sum_probs=122.6

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHH-----CCCEEEEEECCCCCCCCCCHHHHHHHHHHHCCCCCC
Q ss_conf             683423212433547775641000685799999999996-----498389973036888744289999988762136883
Q gi|254780485|r   64 GCPENCGYCNQSVHNKSKLKASKLINVDQVLKEAKNAKE-----NGATRYCMGAAWREPKERDLSIIVDMIKGVKSLGLE  138 (328)
Q Consensus        64 ~C~~~C~fCaf~~~~~~~~~~~~~~~~Eei~~~a~~~~~-----~G~~~~~l~~~~~~~~~~~~~~~~e~i~~i~~~~~~  138 (328)
T Consensus         2 rca~~Cp~~A~~~-------~G~~~tveel~~~i~kd~~fy~~SgGGVT--~-SGGE-pl-~Q~~F~~ellk~~k~~gih   69 (213)
T PRK10076          2 RDADECPSGAFER-------IGRDISLDALEREVMKDDIFFRTSGGGVT--L-SGGE-VL-MQAEFATRFLQRLRLWGVS   69 (213)
T ss_pred             CCHHHCHHHHHHH-------HCEEEEHHHHHHHHHHHHHHHHCCCCEEE--E-ECCH-HH-CCHHHHHHHHHHHHHCCCC
T ss_conf             8556787788875-------26681099999999971999824798078--6-0752-63-5999999999999866998


Q ss_pred             EEE-ECCCCCHHHHHHHHCCCCCEEEEECCC-CHHHHHCCCCCCCHHHHHHHHHHHHHCCCCCCC--EEEECCCCCHHHH
Q ss_conf             241-025699999998741576069751343-777732058888989999999999987985577--0786689899999
Q gi|254780485|r  139 TCM-TLGMLSFEQAQILSKAGLDYYNHNIDT-SERFYPHVTTTHTFEDRLQTLENVRKSGIKVCC--GGILGLGEMIDDR  214 (328)
Q Consensus       139 i~~-~~g~~~~~~~~~Lk~aG~~~~~~~let-~~~~~~~~~~~~~~~~~l~~~~~a~~~G~~~~s--g~l~G~gEt~eer  214 (328)
T Consensus        70 taieTsG~~~~~~~~~~~~~-~Dl~L~DiK~~d~~~h~~~-TG~~n~~il~Nl~~l~~~~~~v~iR~pvIPg~nd~~e~i  147 (213)
T PRK10076         70 CAIETAGDAPASKLLPLAKL-CDEVLFDLKIMDATQARDV-VKMNLPRVLENLRLLVSEGVNVIPRLPLIPGFTLSRENM  147 (213)
T ss_pred             EEEECCCCCCHHHHHHHHHH-CCEEEEEECCCCHHHHHHH-HCCCHHHHHHHHHHHHHCCCCEEEEEEEECCCCCCHHHH
T ss_conf             89976888889999999984-5989986177984899999-799939999999999967996899886779978999999


Q ss_pred             HHHHHHHHHCCCCCCEEECCCEEECC---------CCCCCCCCCCCHHHHHHHHHHHHH
Q ss_conf             99999997408888602054112048---------741244568798999999999999
Q gi|254780485|r  215 IDMLLTLANLSTPPESIPINLLIPIP---------GSKFEENKKVDPIEHVRIISVARI  264 (328)
Q Consensus       215 i~~l~~lr~l~~~~~~v~~~~~~p~~---------gt~l~~~~~~~~~e~lr~iAi~RL  264 (328)
T Consensus       148 ~~~~~f~~~l~v--~~veLLPYH~~G~~Ky~~Lg~~Y~l~~~~~p~~e~~~~~~~i~~~  204 (213)
T PRK10076        148 QQALDVLIPLNI--RQIHLLPFHQYGEPKYRLLGKTWSMKEVPAPSSADVATMREMAER  204 (213)
T ss_pred             HHHHHHHHHCCC--CEEEECCCCHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHH
T ss_conf             999999998699--779971884130799999788787789998599999999999996