HHsearch alignment for GI: 254780485 and conserved domain: PTZ00170

>PTZ00170 D-ribulose-5-phosphate 3-epimerase; Provisional.
Probab=90.47  E-value=1.4  Score=23.54  Aligned_cols=196  Identities=14%  Similarity=0.167  Sum_probs=105.3

Q ss_pred             HHHHHHHHHHHHCCCEEEEE-ECCCCCCCCCC-HHHHHHHHHH-HCCCCCCEEEECCCCCHHHHHHHHCCCCCEEEEECC
Q ss_conf             79999999999649838997-30368887442-8999998876-213688324102569999999874157606975134
Q gi|254780485|r   91 DQVLKEAKNAKENGATRYCM-GAAWREPKERD-LSIIVDMIKG-VKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNID  167 (328)
Q Consensus        91 Eei~~~a~~~~~~G~~~~~l-~~~~~~~~~~~-~~~~~e~i~~-i~~~~~~i~~~~g~~~~~~~~~Lk~aG~~~~~~~le  167 (328)
T Consensus        17 ~~ei~~~~~~~~~g~d~lHiDImDG~FVpN~t~g~~~v~~ir~~~~~~~lDvHLMv~~-P~~~i~~~~~~gad~I~~H~E   95 (224)
T PTZ00170         17 LDESQDVLSPEGGGADWLHVDVMDGHFVPNLSFGPPVVSSLRKHLPNTFLDVHLMVSD-PERWVDSFAKAGASQFTFHIE   95 (224)
T ss_pred             HHHHHHHHHHHCCCCCEEEEECCCCCCCCCCCCCHHHHHHHHHHCCCCCEEEEEEECC-HHHHHHHHHHCCCCEEEECCC
T ss_conf             9999999863405997899944058507765749789999997179986468998638-888799998628967998500


Q ss_pred             CCHHHHHCCCCCCCHHHHHHHHHHHHHCCCCCCCEEEECCCCCHHHHHHHHHHHHHCCCCCCEEECCCEEECCCCCCCCC
Q ss_conf             37777320588889899999999999879855770786689899999999999974088886020541120487412445
Q gi|254780485|r  168 TSERFYPHVTTTHTFEDRLQTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEEN  247 (328)
Q Consensus       168 t~~~~~~~~~~~~~~~~~l~~~~~a~~~G~~~~sg~l~G~gEt~eeri~~l~~lr~l~~~~~~v~~~~~~p~~gt~l~~~  247 (328)
T Consensus        96 ~~~~-------------~~~~i~~ik~~g~k~G--lAln-P~T~i~~l~~~l--~~~--~iD~VLlMsV--~PG--f~GQ  151 (224)
T PTZ00170         96 ATED-------------PKAVARKIRAAGMQVG--VALK-PKTPAEELFPLI--DAG--LVDMVLVMTV--EPG--FGGQ  151 (224)
T ss_pred             CCCC-------------HHHHHHHHHHHCCCEE--EEEC-CCCCHHHHHHHH--HHC--CCCEEEEEEE--CCC--CCCC
T ss_conf             1339-------------9999999997147645--5607-999879999997--114--4578999855--699--8762


Q ss_pred             CCCCHHHHHHHHHHHHHHCCCCCCEEEEHHHHHCHHHHHHHHHHCCCEEEECCEEECCCCCCHHHHHHHHH
Q ss_conf             68798999999999999686872142311565165689999980998899778665158889899999999
Q gi|254780485|r  248 KKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTILFN  318 (328)
Q Consensus       248 ~~~~~~e~lr~iAi~RL~lP~~~i~i~~~~~~~~~~~~~~~L~~GaN~~~~g~~~~t~~g~~~~~~~~~i~  318 (328)
T Consensus       152 ~F--i~~~l~KI~~lr~~~~~~~I~VDGG---In~~ti~~l~~aGad~~V~GSaiF~~~d--~~~~i~~lr  215 (224)
T PTZ00170        152 SF--MHDMMPKVRQLRQRYPHLNIQVDGG---INPDTIDLAAEAGANVIVAGTSIFKAND--RKESIETLR  215 (224)
T ss_pred             CC--CHHHHHHHHHHHHCCCCCEEEEECC---CCHHHHHHHHHCCCCEEEECHHHHCCCC--HHHHHHHHH
T ss_conf             14--5889999999985489975999589---9989999999869999997858867999--999999999