HHsearch alignment for GI: 254780485 and conserved domain: TIGR00676

>TIGR00676 fadh2 5,10-methylenetetrahydrofolate reductase; InterPro: IPR004620 The enzyme activities methylenetetrahydrofolate reductase (1.5.1.20 from EC) and 5,10-methylenetetrahydrofolate reductase (FADH) (1.7.99.5 from EC) differ in that the former (assigned in many eukaryotes) is defined to use NADP+ as an acceptor, while the latter (assigned in many bacteria) is flexible with respect to the acceptor. Both convert 5-methyltetrahydrofolate to 5,10-methylenetetrahydrofolate. From a larger set of proteins assigned as one or the other, this family describes the subset of proteins found in bacteria, and currently designated 5,10-methylenetetrahydrofolate reductase. This protein is an FAD-containing flavoprotein.; GO: 0009086 methionine biosynthetic process.
Probab=94.40  E-value=0.34  Score=27.65  Aligned_cols=106  Identities=14%  Similarity=0.153  Sum_probs=68.6

Q ss_pred             CCCHHHHHHHHHHHHHCCCEEEEEECCCCC------CCCCCHHHHHHHHHHHCCC--CC-----------CEEEEC----
Q ss_conf             068579999999999649838997303688------8744289999988762136--88-----------324102----
Q gi|254780485|r   87 LINVDQVLKEAKNAKENGATRYCMGAAWRE------PKERDLSIIVDMIKGVKSL--GL-----------ETCMTL----  143 (328)
Q Consensus        87 ~~~~Eei~~~a~~~~~~G~~~~~l~~~~~~------~~~~~~~~~~e~i~~i~~~--~~-----------~i~~~~----  143 (328)
T Consensus        84 ~~t~~e~~~~L~~y~~~Gi~~ilALRGD~p~~~~~~~~~~~~~yA~eLV~~Ir~~~g~~GIy~~~E~V~~~F~I~VAaYP  163 (302)
T TIGR00676        84 GSTREEIEEILREYRELGIRNILALRGDPPDETDFEPAPGGFKYASELVEFIRSEHGFGGIYLDGEDVTEDFEIGVAAYP  163 (302)
T ss_pred             CCCHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCHHHHHHHHHHCCCCCCEEECCCCCCCCCEEEEEECC
T ss_conf             68989999999999874886798743768888865658876677689999998368998556477645765505564258


Q ss_pred             ----CCCCH----HHHHHHHCCCCCEEEEECCCCHHHHHCCCCCCCHHHHHHHHHHHHHCCC--CCCCEEE
Q ss_conf             ----56999----9999874157606975134377773205888898999999999998798--5577078
Q gi|254780485|r  144 ----GMLSF----EQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSGI--KVCCGGI  204 (328)
Q Consensus       144 ----g~~~~----~~~~~Lk~aG~~~~~~~let~~~~~~~~~~~~~~~~~l~~~~~a~~~G~--~~~sg~l  204 (328)
T Consensus       164 E~Hpea~~~~~D~~nLK~KVdAGAd~aIT-----QlFF-------dnd~y~rF~d~c~~aGI~~PI~PGIM  222 (302)
T TIGR00676       164 EKHPEAPNLEEDIENLKRKVDAGADYAIT-----QLFF-------DNDDYYRFVDRCRAAGIDVPIIPGIM  222 (302)
T ss_pred             CCCCCCCCHHHHHHHHHHHHHHCCCCEEE-----EEEC-------CHHHHHHHHHHHHHCCCCEEEECCCC
T ss_conf             87888888899999999988627780331-----1111-------56678889999998789500016723