HHsearch alignment for GI: 254780485 and conserved domain: TIGR01125

>TIGR01125 TIGR01125 MiaB-like tRNA modifying enzyme YliG, TIGR01125; InterPro: IPR005840 This is a family of mainly hypothetical proteins of unknown function. .
Probab=99.19  E-value=3.8e-09  Score=80.98  Aligned_cols=190  Identities=18%  Similarity=0.257  Sum_probs=136.2

Q ss_pred             EEEEC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCCCC----------H---
Q ss_conf             64530-786834232124335477756410006857999999999964983899730368887442----------8---
Q gi|254780485|r   57 LLNIK-TGGCPENCGYCNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERD----------L---  122 (328)
Q Consensus        57 ~in~~-TN~C~~~C~fCaf~~~~~~~~~~~~~~~~Eei~~~a~~~~~~G~~~~~l~~~~~~~~~~~----------~---  122 (328)
T Consensus       165 YAYlKvaEGC~~~CaFCiIP~~-r---G~~rSR~ie~i~~Ea~~L~~~GvKEiiliaQDTt~YG~DL~~R~~~~~~e~v~  240 (475)
T TIGR01125       165 YAYLKVAEGCNRRCAFCIIPSL-R---GKLRSRPIEEILKEAKRLVDQGVKEIILIAQDTTAYGVDLYTRESEFDGEQVK  240 (475)
T ss_pred             EEEEEECCCCCCCCCEECCCCC-C---CCCCCCCHHHHHHHHHHHHHCCCCEEEEEEEECCCCCCEEEECCCCCCCHHHH
T ss_conf             0368700577898652136233-6---77677688889999999984398389999640347764111105522401457


Q ss_pred             HHHHHHHHHHCCCC-C-CE---EEECCCCCHHHHHHHHCCCCCEEEEECC-----CCHHHHHCCCCCCCHHHHHHHHHHH
Q ss_conf             99999887621368-8-32---4102569999999874157606975134-----3777732058888989999999999
Q gi|254780485|r  123 SIIVDMIKGVKSLG-L-ET---CMTLGMLSFEQAQILSKAGLDYYNHNID-----TSERFYPHVTTTHTFEDRLQTLENV  192 (328)
Q Consensus       123 ~~~~e~i~~i~~~~-~-~i---~~~~g~~~~~~~~~Lk~aG~~~~~~~le-----t~~~~~~~~~~~~~~~~~l~~~~~a  192 (328)
T Consensus       241 ~~L~~Ll~~L~k~~G~~WiR~~YlYP~~~~~~vI~~m~~~~--KvLPYlDiPLQH~sd~ILK~M~R~~~~~~~~~~i~~~  318 (475)
T TIGR01125       241 SKLVELLEELGKLGGIYWIRLLYLYPDELTDDVIDLMAEGP--KVLPYLDIPLQHASDRILKLMRRPGSGEEQLDLIERL  318 (475)
T ss_pred             HHHHHHHHHHHHCCCCCEEEEEEECCCCCCHHHHHHHHCCC--CCCCEECCCCCCCCHHHHHCCCCCCCHHHHHHHHHHH
T ss_conf             89999999740058962278887608888667889986389--8051225431238737874278996388999999999


Q ss_pred             HHC--CCCCCCEEEECC-CCCHHHHHHHHHHHHHCCCCCCEEECCCEEECCCCCCCCCCCCCHHH
Q ss_conf             987--985577078668-98999999999999740888860205411204874124456879899
Q gi|254780485|r  193 RKS--GIKVCCGGILGL-GEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIE  254 (328)
Q Consensus       193 ~~~--G~~~~sg~l~G~-gEt~eeri~~l~~lr~l~~~~~~v~~~~~~p~~gt~l~~~~~~~~~e  254 (328)
T Consensus       319 R~~~P~~vlRttfIVGFPGETEEdF~eL~~Fv~e~~~--D~lG~F~YS~eEgt~A~~Lpd~vPeE  381 (475)
T TIGR01125       319 REKVPDAVLRTTFIVGFPGETEEDFQELLDFVEEGQF--DRLGVFTYSPEEGTDAFALPDQVPEE  381 (475)
T ss_pred             HHHCCCCEEEEEEEECCCCCCHHHHHHHHHHHHHHCC--CEEEEEECCCCCCCHHHCCCCCCCHH
T ss_conf             9755661772246886889987889999999852021--50000207832366035077887888