HHsearch alignment for GI: 254780485 and conserved domain: TIGR01212

>TIGR01212 TIGR01212 radical SAM protein, TIGR01212 family; InterPro: IPR005911 This uncharacterised protein family shows significant similarity to IPR005910 from INTERPRO, a longer protein that is a histone acetyltransferase at its C-terminus and is a subunit of RNA polymerase II (in yeast). This family lacks the GNAT acetyltransferase domain..
Probab=99.72  E-value=3.2e-15  Score=121.64  Aligned_cols=229  Identities=19%  Similarity=0.352  Sum_probs=171.1

Q ss_pred             HHHHHHHCCCCEEE-EEEEEEECCCCCCCC--------CCCCCCCCCCCCC--CCCCCCCCHHHHHHHHHHHHHCCCEEE
Q ss_conf             99988862898569-998645307868342--------3212433547775--641000685799999999996498389
Q gi|254780485|r   40 HTVHRKNFEPNHIQ-LSKLLNIKTGGCPEN--------CGYCNQSVHNKSK--LKASKLINVDQVLKEAKNAKENGATRY  108 (328)
Q Consensus        40 a~~~r~~~~g~~V~-~~~~in~~TN~C~~~--------C~fCaf~~~~~~~--~~~~~~~~~Eei~~~a~~~~~~G~~~~  108 (328)
T Consensus         6 ~~ylk~~y-G~kV~Ki~~~gGF-~--CPNRDGT~G~GGCtfC~~a~~~~f~~~~~~~~~~~~~~i~~~~~~~~k~G~kkf   81 (307)
T TIGR01212         6 GDYLKERY-GEKVFKITLHGGF-S--CPNRDGTIGRGGCTFCNDASKPSFADEVTQARIPIKEQIKKRKKKYKKDGIKKF   81 (307)
T ss_pred             HHHHHHHH-CCCEEEEEEECCC-C--CCCCCCCCCCCCEEECCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCEEE
T ss_conf             57999980-8944999864578-8--778887002577252178888852451023544689999999976531573157


Q ss_pred             EE--ECCCCCCCCCCHHHHHHHHHHHCCCCCCEEEECC----CCCHHH---HHHHHCCCCC-EEEEECCC-CHHHHHCCC
Q ss_conf             97--3036888744289999988762136883241025----699999---9987415760-69751343-777732058
Q gi|254780485|r  109 CM--GAAWREPKERDLSIIVDMIKGVKSLGLETCMTLG----MLSFEQ---AQILSKAGLD-YYNHNIDT-SERFYPHVT  177 (328)
Q Consensus       109 ~l--~~~~~~~~~~~~~~~~e~i~~i~~~~~~i~~~~g----~~~~~~---~~~Lk~aG~~-~~~~~let-~~~~~~~~~  177 (328)
T Consensus        82 ~aYFQ~yTn--TYApve~Lk~~y~~aL~~~~vVGlsvgTRPDC~P~~VLDlL~ey~~~GyevWvELGLQtah~~TL~~IN  159 (307)
T TIGR01212        82 IAYFQAYTN--TYAPVEVLKEMYEQALSEDDVVGLSVGTRPDCVPDEVLDLLAEYKERGYEVWVELGLQTAHDRTLKKIN  159 (307)
T ss_pred             EEEECCCCC--CCHHHHHHHHHHHHHHHHCCEEEEEECCCCCCCHHHHHHHHHHHHHCCEEEEEECCCCCHHHHHHHHHC
T ss_conf             899738876--500268888999987632780577536889877478999999995497589996053565589999851


Q ss_pred             CCCCHHHHHHHHHHHHHCCCCCCCEEEECC-CCCHHHHHHHHHHHHHCCCCCCEEECCCEEECCCCCCCCC------CCC
Q ss_conf             888989999999999987985577078668-9899999999999974088886020541120487412445------687
Q gi|254780485|r  178 TTHTFEDRLQTLENVRKSGIKVCCGGILGL-GEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEEN------KKV  250 (328)
Q Consensus       178 ~~~~~~~~l~~~~~a~~~G~~~~sg~l~G~-gEt~eeri~~l~~lr~l~~~~~~v~~~~~~p~~gt~l~~~------~~~  250 (328)
T Consensus       160 RgHd~~~y~~a~~~~~krGikVC~H~I~GLPgE~~~~~~eTak~~~~l~v--dGiKiH~LhvvkGt~m~k~Y~~G~~~~l  237 (307)
T TIGR01212       160 RGHDFACYVDAVKRARKRGIKVCSHVILGLPGEDREEMLETAKIVASLDV--DGIKIHPLHVVKGTKMAKQYEKGELKTL  237 (307)
T ss_pred             CCCCHHHHHHHHHHHHHCCCEEEEEEEECCCCCCHHHHHHHHHHHHHCCC--CEEEEEEEEEEECCHHHHHHHCCCEEEC
T ss_conf             43787899999999976598899998742898888899999999983798--8488720178735757887545740104


Q ss_pred             CHHHHHHHHH-HHHHHCCCCCCE-EEEH
Q ss_conf             9899999999-999968687214-2311
Q gi|254780485|r  251 DPIEHVRIIS-VARILMPKSRLR-LAAG  276 (328)
Q Consensus       251 ~~~e~lr~iA-i~RL~lP~~~i~-i~~~  276 (328)
T Consensus       238 ~~e~Y~~~~~d~le~lpP~vv~HRi~~d  265 (307)
T TIGR01212       238 SLEEYISLACDFLEHLPPEVVVHRISGD  265 (307)
T ss_pred             CHHHHHHHHHHHHHCCCCCEEEEEECCC
T ss_conf             7677999999998508985599841277