HHsearch alignment for GI: 254780485 and conserved domain: TIGR01578

>TIGR01578 MiaB-like-B MiaB-like tRNA modifying enzyme, archaeal-type; InterPro: IPR006466 This clade of sequences is closely related to MiaB, a modifier of isopentenylated adenosine-37 of certain eukaryotic and bacterial tRNAs (see IPR006463 from INTERPRO). Sequence alignments suggest that this family of sequences perform the same chemical transformation as MiaB, perhaps on a different (or differently modified) tRNA base substrate. This clade represents a subfamily that spans the archaea and eukaryotes. The only archaeal miaB-like genes are in this group of sequences , , ..
Probab=99.15  E-value=2.2e-09  Score=82.50  Aligned_cols=205  Identities=20%  Similarity=0.353  Sum_probs=136.0

Q ss_pred             EEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCEEEEEECCCCCC-----CCCC-HHHHHH
Q ss_conf             9986453078683423212433547775641000685799999999996498389973036888-----7442-899999
Q gi|254780485|r   54 LSKLLNIKTGGCPENCGYCNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREP-----KERD-LSIIVD  127 (328)
Q Consensus        54 ~~~~in~~TN~C~~~C~fCaf~~~~~~~~~~~~~~~~Eei~~~a~~~~~~G~~~~~l~~~~~~~-----~~~~-~~~~~e  127 (328)
T Consensus       144 ~i~i~pI-~~GC~~~CsYCi-~K~ARG~L~S---~PpEkiV~~ar~l~~~G~kEI~iT-s~DT~~YG~DiG~~kLPeLL~  217 (487)
T TIGR01578       144 LIEILPI-NQGCLGNCSYCI-TKIARGKLAS---YPPEKIVEKARELVAEGAKEIWIT-SQDTAAYGKDIGERKLPELLR  217 (487)
T ss_pred             CCCCCCC-CCCCCCCCCEEE-EEEEECCCCC---CCCHHHHHHHHHHHHCCCCEEEEC-CCCCCCCCCCCCCCCCHHHHH
T ss_conf             7555543-666356887546-7776445248---872256899999997053126513-446663442237621279999


Q ss_pred             -HHHHHCCCCCCEEEECCCCC--------HHHHHHHHC-CCCCEEEE-ECCC-CHHHHHCCCCCCCHHHHHHHHHHHHHC
Q ss_conf             -88762136883241025699--------999998741-57606975-1343-777732058888989999999999987
Q gi|254780485|r  128 -MIKGVKSLGLETCMTLGMLS--------FEQAQILSK-AGLDYYNH-NIDT-SERFYPHVTTTHTFEDRLQTLENVRKS  195 (328)
Q Consensus       128 -~i~~i~~~~~~i~~~~g~~~--------~~~~~~Lk~-aG~~~~~~-~let-~~~~~~~~~~~~~~~~~l~~~~~a~~~  195 (328)
T Consensus       218 ~~~t~I~g~---F~~RVGMmnP~~~~~IldeL~~v~~~h~kV~kFLHlPvQSGsD~VL~~M~R~y~v~~f~~Iv~~FR~~  294 (487)
T TIGR01578       218 RLITEIPGD---FRLRVGMMNPKNVLEILDELIEVFQSHDKVYKFLHLPVQSGSDSVLKEMKREYTVDDFEDIVEKFRER  294 (487)
T ss_pred             HHHHHCCCC---CEEEEECCCCCCHHHHHHHHHHHHHCCCCEEEECCCCCCCCCHHHHHHCCCCCCHHHHHHHHHHHHHH
T ss_conf             998625993---27876258876334788999999854882000115420158758897448565257789999999876


Q ss_pred             --CCCCCCEEEECC-CCCHHHHHHHHHHHHHCCCCCCEEECCCEEECCCCCCCCCCCCCH---HHHHHHHH-HHHHHCCC
Q ss_conf             --985577078668-989999999999997408888602054112048741244568798---99999999-99996868
Q gi|254780485|r  196 --GIKVCCGGILGL-GEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDP---IEHVRIIS-VARILMPK  268 (328)
Q Consensus       196 --G~~~~sg~l~G~-gEt~eeri~~l~~lr~l~~~~~~v~~~~~~p~~gt~l~~~~~~~~---~e~lr~iA-i~RL~lP~  268 (328)
T Consensus       295 ~~~~tl~TDiIvGFp~EtdddFE~T~~l~~k~R--Pe~In~~~fS~RpgT~Aa~~~~~~~~i~K~Rs~~l~dlfysyePy  372 (487)
T TIGR01578       295 FPDLTLSTDIIVGFPTETDDDFEETMELLRKYR--PEKINVTKFSPRPGTEAAKMKRLDTNIKKKRSKALTDLFYSYEPY  372 (487)
T ss_pred             HCCCEEEEEEEECCCCCCHHHHHHHHHHHHHHC--CCEEEEECCCCCCCCHHHHHCCCCCCEEHHHHHHHHHHHHHCCCC
T ss_conf             268647300167178988355899999999828--983453024688887113305899620116667777654202630


Q ss_pred             C
Q ss_conf             7
Q gi|254780485|r  269 S  269 (328)
Q Consensus       269 ~  269 (328)
T Consensus       373 a  373 (487)
T TIGR01578       373 A  373 (487)
T ss_pred             C
T ss_conf             0