HHsearch alignment for GI: 254780485 and conserved domain: TIGR03279

>TIGR03279 cyano_FeS_chp putative FeS-containing Cyanobacterial-specific oxidoreductase. Members of this protein family are predicted FeS-containing oxidoreductases of unknown function, apparently restricted to and universal across the Cyanobacteria. The high trusted cutoff score for this model, 700 bits, excludes homologs from other lineages. This exclusion seems justified because a significant number of sequence positions are simultaneously unique to and invariant across the Cyanobacteria, suggesting a specialized, conserved function, perhaps related to photosynthesis. A distantly related protein family, TIGR03278, in universal in and restricted to archaeal methanogens, and may be linked to methanogenesis.
Probab=96.20  E-value=0.11  Score=30.84  Aligned_cols=140  Identities=14%  Similarity=0.071  Sum_probs=62.1

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCEEEE-EECCCCCCCCCCHHHHHHHHHHH-CCCCCCEE
Q ss_conf             86834232124335477756410006857999999999964983899-73036888744289999988762-13688324
Q gi|254780485|r   63 GGCPENCGYCNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYC-MGAAWREPKERDLSIIVDMIKGV-KSLGLETC  140 (328)
Q Consensus        63 N~C~~~C~fCaf~~~~~~~~~~~~~~~~Eei~~~a~~~~~~G~~~~~-l~~~~~~~~~~~~~~~~e~i~~i-~~~~~~i~  140 (328)
T Consensus        82 r~C~N~C~FCFidQlP~GmR~sLY~KDDD--------------yRLSFL~GNfiTLTNl~e~D~~RIi~~rLSPl~ISVH  147 (433)
T TIGR03279        82 IQCNNRCPFCFIDQQPPGKRESLYLKDDD--------------YRLSFLYGSYLTLTNLPPAEWQRIEQLRLSPLYVSVH  147 (433)
T ss_pred             HHCCCCCCEEEECCCCCCCCCCEEEECCC--------------EEEEEECCCEEEEECCCHHHHHHHHHHCCCCEEEEEE
T ss_conf             33177785686466885554641462486--------------3453201525765179989999999825786389986


Q ss_pred             EECC------------CCCHHHHHHHHCCCCCEEEEECCCCHHHHHCCCCCC-CHHHHHHHHHHHHHCC------CCCCC
Q ss_conf             1025------------699999998741576069751343777732058888-9899999999999879------85577
Q gi|254780485|r  141 MTLG------------MLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTH-TFEDRLQTLENVRKSG------IKVCC  201 (328)
Q Consensus       141 ~~~g------------~~~~~~~~~Lk~aG~~~~~~~let~~~~~~~~~~~~-~~~~~l~~~~~a~~~G------~~~~s  201 (328)
T Consensus       148 aT~pelR~~mL~n~~ag~il~~l~~L~~~gI~~h~Q---------IVLCPGiNDG~~L~rTi~DL~~~~~~~~P~v~Sva  218 (433)
T TIGR03279       148 ATEPSLRARLLKNPRAGLILEQLKWFQERRLQLHAQ---------VVVCPGINDGKHLERTLRDLAQFHDGDWPTVLSVA  218 (433)
T ss_pred             CCCHHHHHHHHCCCCHHHHHHHHHHHHHCCCEEEEE---------EEECCCCCCHHHHHHHHHHHHHHHCCCCCCEEEEE
T ss_conf             399899999876995789999999999769879847---------99879967669999899999986124688425777


Q ss_pred             EEEECCC-----------CCHHHHHHHHHHHHHCC
Q ss_conf             0786689-----------89999999999997408
Q gi|254780485|r  202 GGILGLG-----------EMIDDRIDMLLTLANLS  225 (328)
Q Consensus       202 g~l~G~g-----------Et~eeri~~l~~lr~l~  225 (328)
T Consensus       219 vVPVGlTk~R~~l~~l~~~~~e~A~~vi~~ve~~Q  253 (433)
T TIGR03279       219 VVPVGLTRFRPEEDELTPVTPECARRVIAQVEALQ  253 (433)
T ss_pred             EEECCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHH
T ss_conf             88324213578999872189999999999999999