HHsearch alignment for GI: 254780485 and conserved domain: TIGR03471

>TIGR03471 HpnJ hopanoid biosynthesis associated radical SAM protein HpnJ. One of the well-described hopanoid intermediates is bacteriohopanetetrol. In the conversion from hopene several reactions must occur in the side chain for which a radical mechanism might be reasonable. These include the four (presumably anaerobic) hydroxylations and a methyl shift.
Probab=99.80  E-value=1.4e-17  Score=137.38  Aligned_cols=178  Identities=20%  Similarity=0.322  Sum_probs=141.6

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHC--CCEEEEEECCCCCCCCCCHHHHHHHHHHHCCCCCCE
Q ss_conf             786834232124335477756410006857999999999964--983899730368887442899999887621368832
Q gi|254780485|r   62 TGGCPENCGYCNQSVHNKSKLKASKLINVDQVLKEAKNAKEN--GATRYCMGAAWREPKERDLSIIVDMIKGVKSLGLET  139 (328)
Q Consensus        62 TN~C~~~C~fCaf~~~~~~~~~~~~~~~~Eei~~~a~~~~~~--G~~~~~l~~~~~~~~~~~~~~~~e~i~~i~~~~~~i  139 (328)
T Consensus       203 SRGCP~~C~FC~~p~~~--~Gr~~R~RSpe~VvdEIe~l~~~y~gv~~~~f~DD~---Ft~~~~r~~eic~~i~~l~i~W  277 (472)
T TIGR03471       203 GRGCPSKCTFCLWPQTV--GGHRYRTRSAESVIEEVKYALENFPEVREFFFDDDT---FTDDKPRAEEIARKLGPLGVTW  277 (472)
T ss_pred             CCCCCCCCCCCCCCCCC--CCCCCCCCCHHHHHHHHHHHHHHCCCCCEEEEECCC---CCCCHHHHHHHHHHHHHCCCEE
T ss_conf             79988779687882102--688662159999999999999866897589994776---6789999999999998769827


Q ss_pred             EEEC-CCCCHHHHHHHHCCCCCEEEEECCC-CHHHHHCCCCCCCHHHHHHHHHHHHHCCCCCCCEEEECC-CCCHHHHHH
Q ss_conf             4102-5699999998741576069751343-777732058888989999999999987985577078668-989999999
Q gi|254780485|r  140 CMTL-GMLSFEQAQILSKAGLDYYNHNIDT-SERFYPHVTTTHTFEDRLQTLENVRKSGIKVCCGGILGL-GEMIDDRID  216 (328)
Q Consensus       140 ~~~~-g~~~~~~~~~Lk~aG~~~~~~~let-~~~~~~~~~~~~~~~~~l~~~~~a~~~G~~~~sg~l~G~-gEt~eeri~  216 (328)
T Consensus       278 ~~~~Rv~~d~E~l~~mk~AGc~~v~~GiESgsq~iL~~i~K~~t~e~~~~av~~~k~~GI~v~~~FIiG~PgET~Eti~~  357 (472)
T TIGR03471       278 SCNARANVDYETLKVMKENGLRLLLVGYESGDQQILKNIKKGLTVEIARRFTRDCHKLGIKVHGTFILGLPGETRETIRK  357 (472)
T ss_pred             EEEEECCCCHHHHHHHHHHCCEEEEEECCCCCHHHHHHHCCCCCHHHHHHHHHHHHHCCCEEEEEEEECCCCCCHHHHHH
T ss_conf             87630348999999999839848998037589999998538998999999999887579879999987799998899999


Q ss_pred             HHHHHHHCCCCCCEEECCCEEECCCCCCCC
Q ss_conf             999997408888602054112048741244
Q gi|254780485|r  217 MLLTLANLSTPPESIPINLLIPIPGSKFEE  246 (328)
Q Consensus       217 ~l~~lr~l~~~~~~v~~~~~~p~~gt~l~~  246 (328)
T Consensus       358 Ti~fa~~l~~--d~~~~si~tPyPGT~ly~  385 (472)
T TIGR03471       358 TIDFAKELNP--HTIQVSLAAPYPGTELYD  385 (472)
T ss_pred             HHHHHHHCCC--CEEEEEEECCCCCCHHHH
T ss_conf             9999997598--908998725889969999