Query         gi|254780485|ref|YP_003064898.1| biotin synthase [Candidatus Liberibacter asiaticus str. psy62]
Match_columns 328
No_of_seqs    191 out of 2102
Neff          8.3 
Searched_HMMs 39220
Date          Sun May 29 17:18:07 2011
Command       /home/congqian_1/programs/hhpred/hhsearch -i 254780485.hhm -d /home/congqian_1/database/cdd/Cdd.hhm 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PRK06256 biotin synthase; Vali 100.0       0       0  551.4  33.2  319    4-326     3-325 (325)
  2 COG0502 BioB Biotin synthase a 100.0       0       0  512.3  31.6  311   15-327    10-322 (335)
  3 PRK08444 hypothetical protein; 100.0       0       0  500.1  29.0  312    8-327     2-343 (353)
  4 TIGR00433 bioB biotin synthase 100.0       0       0  499.7  22.3  296   27-322     1-350 (350)
  5 PRK08508 biotin synthase; Prov 100.0       0       0  491.6  28.1  274   50-327     2-277 (279)
  6 PRK07094 biotin synthase; Prov 100.0       0       0  476.9  31.5  300   19-325     1-322 (323)
  7 PRK05927 hypothetical protein; 100.0       0       0  480.4  27.9  310   13-327     1-339 (350)
  8 PRK07360 FO synthase subunit 2 100.0       0       0  473.3  27.9  323    1-327     2-364 (375)
  9 PRK08445 hypothetical protein; 100.0       0       0  472.4  26.8  306   17-327     2-338 (348)
 10 PRK05926 hypothetical protein; 100.0       0       0  469.9  28.2  317    4-327    14-366 (371)
 11 PRK09234 fbiC FO synthase; Rev 100.0       0       0  457.9  28.1  315    9-327   481-829 (846)
 12 TIGR00423 TIGR00423 conserved  100.0       0       0  461.9  22.0  272   52-327     1-320 (331)
 13 TIGR03551 F420_cofH 7,8-dideme 100.0       0       0  453.8  26.7  303   19-327     1-338 (343)
 14 COG1060 ThiH Thiamine biosynth 100.0       0       0  419.1  26.4  321    2-327     5-356 (370)
 15 KOG2900 consensus              100.0       0       0  416.8  17.4  310   18-327    47-360 (380)
 16 TIGR03550 F420_cofG 7,8-dideme 100.0       0       0  383.2  20.4  266   53-327     1-300 (322)
 17 PRK06245 cofG FO synthase subu 100.0       0       0  366.6  24.5  272   46-326     2-302 (336)
 18 PRK06267 hypothetical protein; 100.0       0       0  358.2  24.2  253   31-296     5-262 (324)
 19 PRK09240 thiH thiamine biosynt 100.0       0       0  351.1  27.3  309    9-327    26-362 (371)
 20 TIGR02351 thiH thiazole biosyn 100.0       0       0  355.4  20.2  309   10-327    28-373 (378)
 21 PRK09613 thiH thiamine biosynt 100.0       0       0  343.5  28.7  317    3-326    30-384 (471)
 22 PRK09234 fbiC FO synthase; Rev 100.0 1.4E-38 3.6E-43  278.2  26.1  309   10-323    22-370 (846)
 23 PRK05481 lipoyl synthase; Prov  99.8 7.4E-19 1.9E-23  146.0  17.2  186   62-256    59-253 (289)
 24 COG0320 LipA Lipoate synthase   99.8 8.6E-19 2.2E-23  145.6  17.5  188   62-258    77-272 (306)
 25 cd01335 Radical_SAM Radical SA  99.8 1.5E-18 3.7E-23  144.1  17.6  198   58-260     1-203 (204)
 26 smart00729 Elp3 Elongator prot  99.8 1.1E-18 2.8E-23  144.9  16.3  186   57-249     4-202 (216)
 27 PRK12928 lipoyl synthase; Prov  99.8 2.2E-18 5.5E-23  142.9  17.5  190   62-260    67-267 (290)
 28 pfam06968 BATS Biotin and Thia  99.8 1.1E-19 2.9E-24  151.5   9.6   93  232-324     1-93  (93)
 29 TIGR03471 HpnJ hopanoid biosyn  99.8 1.4E-17 3.7E-22  137.4  18.2  178   62-246   203-385 (472)
 30 smart00876 BATS Biotin and Thi  99.8 2.7E-18 6.8E-23  142.3   8.4   93  232-324     1-94  (94)
 31 COG1856 Uncharacterized homolo  99.8 2.4E-16   6E-21  129.2  18.4  230   57-297    13-250 (275)
 32 PRK08207 coproporphyrinogen II  99.7 7.8E-15   2E-19  119.1  22.3  242   17-266   127-401 (497)
 33 TIGR02666 moaA molybdenum cofa  99.7   3E-15 7.6E-20  121.9  20.0  210   48-263     5-224 (346)
 34 TIGR01212 TIGR01212 radical SA  99.7 3.2E-15 8.2E-20  121.6  19.3  229   40-276     6-265 (307)
 35 PRK13361 molybdenum cofactor b  99.7 6.7E-15 1.7E-19  119.5  19.1  204   48-260     9-216 (329)
 36 PRK00164 moaA molybdenum cofac  99.7 1.3E-14 3.4E-19  117.5  18.2  209   44-260     9-222 (334)
 37 TIGR02668 moaA_archaeal probab  99.6 1.6E-14   4E-19  117.1  15.1  169   48-223     5-184 (324)
 38 PRK08208 coproporphyrinogen II  99.6 1.1E-13 2.8E-18  111.4  17.8  210   46-267    40-267 (436)
 39 COG2516 Biotin synthase-relate  99.6 2.9E-14 7.5E-19  115.2  14.7  209   52-268    29-254 (339)
 40 PRK05904 coproporphyrinogen II  99.6 2.2E-13 5.6E-18  109.4  18.5  191   64-258    15-215 (353)
 41 PRK08599 coproporphyrinogen II  99.6 3.6E-13 9.1E-18  107.9  18.9  199   58-266     6-225 (377)
 42 PRK05799 coproporphyrinogen II  99.6 8.1E-13 2.1E-17  105.6  19.4  200   58-267     8-225 (374)
 43 COG2896 MoaA Molybdenum cofact  99.6 1.2E-12 3.1E-17  104.4  19.4  205   48-261     6-214 (322)
 44 PRK07379 coproporphyrinogen II  99.6 1.1E-12 2.7E-17  104.8  19.0  208   55-268    12-242 (399)
 45 PRK05628 coproporphyrinogen II  99.6   6E-13 1.5E-17  106.4  17.6  201   58-268     7-235 (376)
 46 PRK05660 coproporphyrinogen II  99.6 6.4E-13 1.6E-17  106.3  17.3  205   58-268    11-230 (378)
 47 PRK09058 coproporphyrinogen II  99.6 3.1E-13 7.8E-18  108.4  15.6  203   54-268    59-286 (447)
 48 pfam04055 Radical_SAM Radical   99.6 1.5E-13 3.8E-18  110.5  14.0  158   59-220     2-164 (165)
 49 PRK08807 consensus              99.6   6E-13 1.5E-17  106.4  16.8  195   64-266    17-231 (385)
 50 COG1032 Fe-S oxidoreductase [E  99.6 1.2E-12 2.9E-17  104.5  17.9  191   55-253   199-410 (490)
 51 PRK06582 coproporphyrinogen II  99.5 1.1E-12 2.9E-17  104.6  17.1  207   49-267     9-236 (390)
 52 PRK08949 consensus              99.5 1.3E-12 3.3E-17  104.2  16.7  199   58-266    11-228 (378)
 53 PRK09057 coproporphyrinogen II  99.5 9.4E-13 2.4E-17  105.1  15.6  202   58-265     9-228 (381)
 54 COG1242 Predicted Fe-S oxidore  99.5 7.6E-12 1.9E-16   99.0  20.2  232   35-275     7-267 (312)
 55 PRK06294 coproporphyrinogen II  99.5 1.1E-12 2.7E-17  104.8  15.6  203   58-266    11-228 (374)
 56 PRK08446 coproporphyrinogen II  99.5 1.7E-12 4.4E-17  103.4  16.3  179   64-250     9-202 (351)
 57 PRK13347 coproporphyrinogen II  99.5 1.1E-11 2.9E-16   97.9  18.4  206   49-266    48-276 (453)
 58 TIGR00089 TIGR00089 RNA modifi  99.5 1.5E-11 3.8E-16   97.1  18.2  189   54-249   153-360 (455)
 59 PRK08898 coproporphyrinogen II  99.5 5.7E-12 1.4E-16   99.9  16.1  196   58-263    24-238 (393)
 60 COG0621 MiaB 2-methylthioadeni  99.5 9.8E-12 2.5E-16   98.3  17.0  188   54-248   144-346 (437)
 61 PRK09249 coproporphyrinogen II  99.5 1.4E-11 3.6E-16   97.2  17.6  204   49-264    49-275 (456)
 62 PRK05301 pyrroloquinoline quin  99.5   4E-11   1E-15   94.2  19.3  174   54-238    17-194 (375)
 63 KOG2672 consensus               99.4 5.3E-12 1.4E-16  100.1  14.3  177   54-237   110-294 (360)
 64 COG0635 HemN Coproporphyrinoge  99.4 3.3E-11 8.4E-16   94.8  17.0  201   51-263    34-258 (416)
 65 TIGR03470 HpnH hopanoid biosyn  99.4 1.2E-10   3E-15   91.0  18.6  194   31-236     4-200 (318)
 66 PRK08629 coproporphyrinogen II  99.4 1.2E-10 3.1E-15   91.0  16.7  207   49-268    41-262 (424)
 67 TIGR01574 miaB-methiolase tRNA  99.3 8.1E-10 2.1E-14   85.4  16.9  192   53-253   154-369 (456)
 68 TIGR00510 lipA lipoic acid syn  99.2 2.3E-10   6E-15   89.1  12.6  196   62-264    76-282 (310)
 69 TIGR02026 BchE magnesium-proto  99.2 5.4E-10 1.4E-14   86.6  13.1  209   56-273   199-443 (506)
 70 TIGR00539 hemN_rel putative ox  99.2 2.4E-10 6.2E-15   88.9  10.6  236   58-302     5-279 (371)
 71 TIGR01125 TIGR01125 MiaB-like   99.2 3.8E-09 9.6E-14   81.0  16.3  190   57-254   165-381 (475)
 72 TIGR01578 MiaB-like-B MiaB-lik  99.2 2.2E-09 5.7E-14   82.5  13.9  205   54-269   144-373 (487)
 73 COG2100 Predicted Fe-S oxidore  99.1 2.1E-08 5.4E-13   76.0  18.5  205   58-263   109-325 (414)
 74 TIGR01579 MiaB-like-C MiaB-lik  99.1   8E-09 2.1E-13   78.8  15.5  181   62-249   217-415 (492)
 75 COG2108 Uncharacterized conser  99.1 2.1E-09 5.4E-14   82.7  11.2  212   44-279    22-256 (353)
 76 COG1243 ELP3 Histone acetyltra  99.0 1.3E-07 3.3E-12   70.7  18.0  210   57-268    69-327 (515)
 77 COG0535 Predicted Fe-S oxidore  99.0 1.9E-07   5E-12   69.5  18.3  173   54-239    19-198 (347)
 78 PRK13758 anaerobic sulfatase-m  99.0 2.5E-07 6.3E-12   68.8  17.8  164   58-226     9-186 (370)
 79 COG4277 Predicted DNA-binding   98.9 8.7E-08 2.2E-12   71.9  15.0  190   62-257    61-276 (404)
 80 TIGR02109 PQQ_syn_pqqE coenzym  98.9   2E-08 5.1E-13   76.1   9.7  196   58-266    11-216 (363)
 81 TIGR00538 hemN oxygen-independ  98.9 1.7E-07 4.4E-12   69.8  13.7  239   51-302    51-337 (462)
 82 PRK11145 pflA pyruvate formate  98.8 3.3E-06 8.4E-11   61.3  19.3  194   62-263    27-238 (246)
 83 COG1180 PflA Pyruvate-formate   98.8 1.8E-06 4.5E-11   63.1  16.6  194   62-265    42-240 (260)
 84 COG0641 AslB Arylsulfatase reg  98.7 1.2E-05 3.1E-10   57.5  19.2  191   57-257     8-214 (378)
 85 COG0731 Fe-S oxidoreductases [  98.7 4.5E-06 1.1E-10   60.4  16.7  169   60-236    28-212 (296)
 86 TIGR02493 PFLA pyruvate format  98.7 4.2E-06 1.1E-10   60.6  16.2  193   62-263    22-241 (243)
 87 TIGR01290 nifB nitrogenase cof  98.6 3.3E-06 8.3E-11   61.3  14.2  196   54-255    24-248 (461)
 88 KOG4355 consensus               98.5 9.8E-06 2.5E-10   58.1  14.5  210   54-270   187-415 (547)
 89 PRK11194 hypothetical protein;  98.5 3.3E-05 8.3E-10   54.6  17.1  223   64-316   112-361 (372)
 90 COG1031 Uncharacterized Fe-S o  98.5 7.3E-05 1.9E-09   52.3  18.2  201   38-247   168-414 (560)
 91 PRK08195 4-hydroxy-2-ketovaler  98.4  0.0002 5.2E-09   49.3  22.3  214   86-326    20-250 (337)
 92 PRK13745 anaerobic sulfatase-m  98.4 3.4E-05 8.8E-10   54.4  15.5  162   62-227    21-196 (412)
 93 TIGR03217 4OH_2_O_val_ald 4-hy  98.4 0.00024   6E-09   48.8  23.4  213   86-325    19-248 (333)
 94 COG1509 KamA Lysine 2,3-aminom  98.4 0.00013 3.4E-09   50.5  18.1  193   57-268   114-318 (369)
 95 PRK01254 hypothetical protein;  98.4 2.5E-05 6.3E-10   55.4  13.1  203   62-269   379-647 (742)
 96 pfam00682 HMGL-like HMGL-like.  98.3 0.00044 1.1E-08   47.0  21.0  217   87-321    10-237 (237)
 97 KOG2876 consensus               98.3 2.3E-06 5.9E-11   62.3   6.2  190   62-259    18-212 (323)
 98 PRK00955 hypothetical protein;  98.2 8.3E-05 2.1E-09   51.9  13.6  202   62-268   298-561 (599)
 99 TIGR02495 NrdG2 anaerobic ribo  98.2 4.1E-05   1E-09   53.9  11.6  158   57-226    20-208 (220)
100 KOG2492 consensus               98.2 0.00024 6.2E-09   48.8  15.1  224   62-294   227-499 (552)
101 COG0820 Predicted Fe-S-cluster  98.1 0.00041   1E-08   47.3  15.0  171   64-246   110-302 (349)
102 TIGR01211 ELP3 histone acetylt  98.1 0.00019 4.9E-09   49.5  12.4  262   10-274     3-384 (573)
103 COG1533 SplB DNA repair photol  98.0  0.0008   2E-08   45.3  15.1  165   57-226    32-213 (297)
104 COG1313 PflX Uncharacterized F  98.0  0.0011 2.7E-08   44.4  15.1  195   55-265   120-327 (335)
105 COG1244 Predicted Fe-S oxidore  97.9  0.0029 7.4E-08   41.5  17.5  181   61-246    53-255 (358)
106 PRK05692 hydroxymethylglutaryl  97.8  0.0032 8.2E-08   41.3  21.7  219   86-325    21-265 (287)
107 PRK10076 pyruvate formate lyas  97.8  0.0038 9.6E-08   40.8  15.2  185   64-264     2-204 (213)
108 TIGR00048 TIGR00048 radical SA  97.8  0.0018 4.6E-08   42.9  13.4  195   51-260   120-342 (378)
109 COG5014 Predicted Fe-S oxidore  97.5   0.007 1.8E-07   39.0  13.3  165   61-231    47-219 (228)
110 TIGR03278 methan_mark_10 putat  97.4   0.014 3.7E-07   36.9  19.3  135   87-226    53-197 (404)
111 pfam05853 DUF849 Prokaryotic p  97.3   0.019 4.8E-07   36.1  22.0  231   79-325    15-263 (274)
112 PRK13762 tRNA-modifying enzyme  97.2    0.02 5.2E-07   35.9  13.6  183   64-257    67-281 (321)
113 pfam10113 Fibrillarin_2 Fibril  97.0  0.0084 2.1E-07   38.5   9.2  105  180-299   203-307 (505)
114 TIGR03365 Bsubt_queE 7-cyano-7  96.7  0.0078   2E-07   38.7   7.0   88   58-149    25-114 (238)
115 PRK00915 2-isopropylmalate syn  96.5   0.074 1.9E-06   32.1  20.5   19  191-209   216-234 (511)
116 COG1625 Fe-S oxidoreductase, r  96.5   0.079   2E-06   31.9  13.2  204   62-275    34-255 (414)
117 TIGR03279 cyano_FeS_chp putati  96.2    0.11 2.9E-06   30.8  11.6  140   63-225    82-253 (433)
118 PRK11858 aksA trans-homoaconit  96.2    0.12   3E-06   30.8  23.3  215   86-325    21-249 (378)
119 TIGR02494 PFLE_PFLC glycyl-rad  95.8    0.17 4.3E-06   29.7  14.9  197   52-262    81-301 (305)
120 COG0602 NrdG Organic radical a  95.8   0.032 8.2E-07   34.5   6.1   87   57-148    24-112 (212)
121 COG4018 Uncharacterized protei  95.7   0.052 1.3E-06   33.1   6.9  104  181-299   204-307 (505)
122 PRK09389 (R)-citramalate synth  95.7    0.19 4.8E-06   29.4  21.1   20  190-209   204-223 (487)
123 cd00003 PNPsynthase Pyridoxine  95.6    0.13 3.2E-06   30.6   8.6  117   90-214    72-196 (234)
124 PRK05211 consensus              95.5    0.22 5.6E-06   29.0   9.8  215   92-324    22-246 (248)
125 pfam00478 IMPDH IMP dehydrogen  95.4    0.24 6.2E-06   28.6  12.0   71   91-166   222-293 (467)
126 PRK03220 consensus              95.2    0.27 6.8E-06   28.4  11.6  200   92-323    32-255 (257)
127 PRK05265 pyridoxine 5'-phospha  95.2   0.079   2E-06   31.9   6.3  132   90-234    75-214 (240)
128 PRK13597 imidazole glycerol ph  95.1    0.28 7.2E-06   28.2   9.8  202   92-325    32-250 (252)
129 pfam03740 PdxJ Pyridoxal phosp  95.0     0.3 7.8E-06   28.0   9.6  118   89-214    72-199 (239)
130 PRK00507 deoxyribose-phosphate  94.9    0.17 4.4E-06   29.6   7.3   44   89-132    72-115 (221)
131 PRK07028 bifunctional hexulose  94.6    0.39   1E-05   27.3  16.7  214   86-327   113-341 (429)
132 TIGR00676 fadh2 5,10-methylene  94.4    0.34 8.7E-06   27.7   8.0  106   87-204    84-222 (302)
133 COG0119 LeuA Isopropylmalate/h  94.3    0.46 1.2E-05   26.8  21.3  220   86-325    19-254 (409)
134 KOG3111 consensus               94.3    0.46 1.2E-05   26.8  19.5  195   92-320    18-216 (224)
135 TIGR01302 IMP_dehydrog inosine  94.1    0.35 8.8E-06   27.6   7.5  108   87-201   234-347 (476)
136 PRK04281 consensus              94.0    0.52 1.3E-05   26.4  10.1  201   92-324    31-252 (254)
137 PRK02747 consensus              93.8    0.56 1.4E-05   26.2   9.5  203   92-325    31-255 (257)
138 TIGR02660 nifV_homocitr homoci  93.8    0.57 1.5E-05   26.2   8.3  208   84-323    16-245 (369)
139 PRK09140 2-dehydro-3-deoxy-6-p  93.6     0.6 1.5E-05   26.0  15.1  178   87-319    18-198 (206)
140 cd04739 DHOD_like Dihydroorota  93.6     0.6 1.5E-05   26.0  14.1  189  121-323    83-294 (325)
141 COG1964 Predicted Fe-S oxidore  93.2     0.7 1.8E-05   25.6  11.0  137   72-218    78-225 (475)
142 PRK13585 1-(5-phosphoribosyl)-  93.1    0.73 1.9E-05   25.5  10.2  203   91-319    31-240 (240)
143 PRK05581 ribulose-phosphate 3-  93.0    0.74 1.9E-05   25.4  19.1  197   89-319    14-216 (220)
144 KOG2550 consensus               92.9    0.79   2E-05   25.2   7.8  169   91-274   250-434 (503)
145 PRK07807 inositol-5-monophosph  92.7    0.81 2.1E-05   25.1   9.2   98   92-199   227-333 (479)
146 PRK01659 consensus              92.6    0.85 2.2E-05   25.0  12.0  201   92-323    31-250 (252)
147 KOG4039 consensus               92.5    0.16 4.1E-06   29.9   3.7   63   62-124    79-142 (238)
148 PTZ00314 inosine-5'-monophosph  92.3    0.93 2.4E-05   24.8   8.2   28  273-301   345-372 (499)
149 pfam05913 DUF871 Bacterial pro  92.1    0.98 2.5E-05   24.6   9.9  118   89-207    11-178 (357)
150 PRK02621 consensus              91.6     1.1 2.8E-05   24.3   9.1  201   92-323    31-251 (254)
151 cd00429 RPE Ribulose-5-phospha  91.5     1.1 2.9E-05   24.2  18.5  185   89-305    10-200 (211)
152 PRK07565 dihydroorotate dehydr  91.5     1.1 2.9E-05   24.2  15.5  189  121-323    85-296 (333)
153 PRK12595 bifunctional 3-deoxy-  91.4     1.2 2.9E-05   24.1  13.5  200   88-320   129-350 (360)
154 KOG2535 consensus               91.4     1.2   3E-05   24.1  13.8  173   88-260   150-357 (554)
155 PRK08745 ribulose-phosphate 3-  91.4     1.2   3E-05   24.1  18.4  195   91-319    16-217 (223)
156 PRK11613 folP dihydropteroate   91.2     1.2 3.1E-05   24.0  12.3  136   88-225    35-208 (282)
157 PRK08005 ribulose-phosphate 3-  91.2     1.2 3.1E-05   24.0  19.0  194   92-319    14-209 (210)
158 PRK12331 oxaloacetate decarbox  90.8     1.3 3.4E-05   23.7  18.1  174   89-276   152-343 (463)
159 PTZ00170 D-ribulose-5-phosphat  90.5     1.4 3.6E-05   23.5  17.1  196   91-318    17-215 (224)
160 TIGR00559 pdxJ pyridoxal phosp  90.2     1.5 3.8E-05   23.4  10.0  137   88-231    71-243 (265)
161 COG0854 PdxJ Pyridoxal phospha  90.1     1.5 3.9E-05   23.3   8.8  111   89-211    72-197 (243)
162 PRK07455 keto-hydroxyglutarate  90.0     1.5 3.9E-05   23.3  14.6  182   85-319    19-204 (210)
163 PRK12330 oxaloacetate decarbox  90.0     1.5   4E-05   23.3  19.9  165   89-268   153-336 (499)
164 PRK02083 imidazole glycerol ph  89.9     1.6   4E-05   23.2  11.9  202   92-324    31-251 (253)
165 COG0800 Eda 2-keto-3-deoxy-6-p  89.6     1.6 4.2E-05   23.1  11.2  105   84-218    18-123 (211)
166 cd00331 IGPS Indole-3-glycerol  88.9     1.8 4.7E-05   22.7  12.6  179   91-307    31-209 (217)
167 pfam00218 IGPS Indole-3-glycer  88.9     1.9 4.7E-05   22.7  14.4  178   92-307    69-246 (254)
168 TIGR02090 LEU1_arch isopropylm  88.8     1.9 4.8E-05   22.7   9.9  107   87-199    18-130 (371)
169 TIGR01182 eda 2-dehydro-3-deox  88.4       2   5E-05   22.5  10.0  106   84-219    13-120 (205)
170 PRK06843 inositol-5-monophosph  88.4       2 5.1E-05   22.5   8.1  115   91-218   152-275 (404)
171 PRK12344 putative alpha-isopro  88.0     2.1 5.3E-05   22.4  21.5  123   88-218   119-254 (530)
172 COG3623 SgaU Putative L-xylulo  87.9     2.1 5.4E-05   22.4  10.0   54  168-223   220-274 (287)
173 pfam01081 Aldolase KDPG and KH  87.9     2.1 5.4E-05   22.3  14.9  166   85-303    14-180 (196)
174 TIGR01496 DHPS dihydropteroate  87.8     2.2 5.5E-05   22.3   9.8  141   83-225    15-201 (268)
175 PRK13802 bifunctional indole-3  87.8     2.2 5.5E-05   22.3  14.3  178   92-307    71-248 (695)
176 PRK11121 nrdG anaerobic ribonu  87.7     2.2 5.6E-05   22.3   7.8   84   62-148    23-110 (154)
177 PRK05567 inositol-5'-monophosp  87.6     2.2 5.6E-05   22.2   9.4   68   94-166   230-298 (486)
178 PRK13957 indole-3-glycerol-pho  87.6     2.2 5.7E-05   22.2  14.0  177   92-307    62-238 (247)
179 PRK00748 1-(5-phosphoribosyl)-  87.2     2.3   6E-05   22.1  11.8  203   92-319    30-240 (241)
180 PRK09722 allulose-6-phosphate   87.0     2.4 6.1E-05   22.0  17.4  187  102-319    23-215 (227)
181 cd00959 DeoC 2-deoxyribose-5-p  87.0    0.75 1.9E-05   25.4   3.4   23   88-110    14-36  (203)
182 cd00423 Pterin_binding Pterin   86.8     2.5 6.3E-05   21.9  12.5  138   87-225    20-195 (258)
183 pfam00834 Ribul_P_3_epim Ribul  86.7     2.5 6.3E-05   21.9  16.4  181   90-302    11-197 (201)
184 COG0107 HisF Imidazoleglycerol  86.7     2.5 6.4E-05   21.9  11.8  208   91-324    30-253 (256)
185 PRK00278 trpC indole-3-glycero  85.9     2.7 6.9E-05   21.6  14.5  188   92-319    71-258 (261)
186 cd00452 KDPG_aldolase KDPG and  85.6     2.8 7.2E-05   21.5  10.7  163   85-301    10-173 (190)
187 COG3589 Uncharacterized conser  85.5     2.8 7.2E-05   21.5   9.1  113   89-201    14-175 (360)
188 PRK06552 keto-hydroxyglutarate  85.5     2.8 7.3E-05   21.5  16.8  182   86-318    20-203 (209)
189 TIGR00007 TIGR00007 phosphorib  85.5     2.9 7.3E-05   21.5   6.9  182   89-300    26-229 (241)
190 PRK05718 keto-hydroxyglutarate  84.8     3.1 7.8E-05   21.3  10.1  181   85-319    21-206 (212)
191 cd00739 DHPS DHPS subgroup of   84.2     3.2 8.3E-05   21.1  15.7  138   87-225    20-195 (257)
192 PRK12581 oxaloacetate decarbox  84.0     3.3 8.4E-05   21.1  19.8  174   89-277   161-353 (468)
193 PRK08091 ribulose-phosphate 3-  83.8     3.4 8.6E-05   21.0  16.2  198   90-320    24-233 (235)
194 cd00381 IMPDH IMPDH: The catal  83.3     3.5   9E-05   20.9   9.6   99   96-215    50-150 (325)
195 pfam00809 Pterin_bind Pterin b  83.1     3.6 9.1E-05   20.8  13.8   75   87-163    15-95  (208)
196 PRK09776 putative sensor prote  82.9     3.7 9.3E-05   20.8  12.4   14  310-323  1000-1013(1116)
197 PRK09358 adenosine deaminase;   82.8     3.7 9.4E-05   20.7   9.2   22  181-202   175-196 (333)
198 COG0826 Collagenase and relate  82.4     3.8 9.7E-05   20.7  13.7   77   87-165    45-144 (347)
199 PRK09426 methylmalonyl-CoA mut  82.4     3.8 9.7E-05   20.6   6.9   14  231-244   455-468 (715)
200 TIGR03572 WbuZ glycosyl amidat  82.0     3.9  0.0001   20.5   7.0  180   91-300    30-228 (232)
201 COG0134 TrpC Indole-3-glycerol  81.9       4  0.0001   20.5  12.3  177   94-308    69-245 (254)
202 PRK09432 metF 5,10-methylenete  81.7       4  0.0001   20.5   9.3  188   88-326    94-296 (296)
203 PRK13129 consensus              81.4     4.1 0.00011   20.4  18.6  185   89-303    31-239 (267)
204 PRK01033 imidazole glycerol ph  81.4     4.1 0.00011   20.4   7.8  181   92-302    31-229 (253)
205 cd03465 URO-D_like The URO-D _  81.2     4.2 0.00011   20.4  12.5  180   31-226    35-244 (330)
206 TIGR01361 DAHP_synth_Bsub phos  81.1     4.2 0.00011   20.3  14.2  202   88-321    36-260 (262)
207 COG0685 MetF 5,10-methylenetet  81.0     4.3 0.00011   20.3   9.1  100   86-197    87-202 (291)
208 COG2876 AroA 3-deoxy-D-arabino  80.1     4.5 0.00012   20.1  12.8  201   88-320    56-277 (286)
209 PRK13119 consensus              79.8     4.6 0.00012   20.1  18.6  201   89-319    27-255 (261)
210 PRK13396 3-deoxy-7-phosphohept  79.5     4.8 0.00012   20.0  13.2  200   88-319   112-333 (352)
211 cd04731 HisF The cyclase subun  79.2     4.9 0.00012   19.9  12.9  197   92-319    28-242 (243)
212 PRK06015 keto-hydroxyglutarate  79.1     4.9 0.00012   19.9   9.1  181   85-319    21-206 (212)
213 COG0106 HisA Phosphoribosylfor  79.0     4.9 0.00013   19.9  10.1  196   91-319    31-240 (241)
214 PRK06857 consensus              78.2     5.2 0.00013   19.7  10.7  181   85-319    18-203 (209)
215 cd00740 MeTr MeTr subgroup of   77.5     5.4 0.00014   19.6  11.7  196   87-298    22-237 (252)
216 PRK08673 3-deoxy-7-phosphohept  76.5     5.8 0.00015   19.4  17.9  202   88-320   104-325 (335)
217 PRK13117 consensus              76.3     5.8 0.00015   19.4  19.1  185   89-303    29-238 (268)
218 PRK08904 consensus              76.2     5.9 0.00015   19.4  11.8  182   85-320    16-202 (207)
219 PRK13352 thiamine biosynthesis  76.1     5.9 0.00015   19.4  13.2  194   66-266    48-354 (433)
220 cd01320 ADA Adenosine deaminas  76.0       6 0.00015   19.3   9.2   22  181-202   171-192 (325)
221 PRK13307 bifunctional formalde  75.3     6.2 0.00016   19.2  14.7  177  121-320   183-378 (392)
222 CHL00200 trpA tryptophan synth  75.3     6.2 0.00016   19.2  18.8  186   89-303    27-235 (263)
223 TIGR00693 thiE thiamine-phosph  75.1     6.3 0.00016   19.2  15.0  167   91-297    15-192 (210)
224 TIGR02826 RNR_activ_nrdG3 anae  74.7     6.4 0.00016   19.1   7.7   95   45-147    10-113 (165)
225 pfam01964 ThiC ThiC family. Th  74.5     6.5 0.00017   19.1  13.1  196   64-266    44-349 (421)
226 PRK08883 ribulose-phosphate 3-  73.5     6.9 0.00018   18.9  19.4  196   91-318    12-212 (220)
227 COG5016 Pyruvate/oxaloacetate   73.0     7.1 0.00018   18.8   8.2  124   88-224   153-278 (472)
228 TIGR01060 eno phosphopyruvate   72.6     7.2 0.00018   18.8   9.8   38  181-222   347-386 (430)
229 PRK13209 L-xylulose 5-phosphat  72.4     7.3 0.00019   18.8   8.8  137   85-227    93-247 (283)
230 PRK13586 1-(5-phosphoribosyl)-  72.0     7.4 0.00019   18.7   7.0  201   58-300     7-218 (231)
231 PRK08782 consensus              71.3     7.7  0.0002   18.6  10.5  163   85-301    23-186 (219)
232 PRK05283 deoxyribose-phosphate  71.3     7.7  0.0002   18.6  11.3  134   88-266    81-222 (258)
233 pfam09370 TIM-br_sig_trns TIM-  71.2     7.7  0.0002   18.6   8.9  108  178-299   132-246 (268)
234 TIGR00735 hisF imidazoleglycer  71.1     7.7  0.0002   18.6   5.0   72   92-165    43-129 (312)
235 COG0274 DeoC Deoxyribose-phosp  71.0     7.8  0.0002   18.6   7.3  120   89-221    75-205 (228)
236 TIGR01108 oadA oxaloacetate de  70.7     7.9  0.0002   18.5   6.8  118   89-224   148-273 (616)
237 PRK07114 keto-hydroxyglutarate  70.4       8  0.0002   18.5  11.6  188   84-319    21-212 (223)
238 PRK02145 consensus              70.0     8.2 0.00021   18.4  14.4  201   92-324    32-255 (257)
239 COG2185 Sbm Methylmalonyl-CoA   69.9     8.2 0.00021   18.4   5.5   70   87-163    49-120 (143)
240 PRK00830 consensus              69.8     8.3 0.00021   18.4  14.8  218   91-324    34-271 (273)
241 PRK13753 dihydropteroate synth  69.4     8.4 0.00021   18.3  13.7  155   52-225     2-198 (279)
242 pfam04131 NanE Putative N-acet  68.8     8.7 0.00022   18.2   6.3  163   95-302     3-176 (192)
243 PRK08318 dihydropyrimidine deh  68.7     8.7 0.00022   18.2  16.3  193  120-323    81-310 (413)
244 PRK10060 RNase II stability mo  68.6     8.7 0.00022   18.2  14.8   10  188-197   380-389 (663)
245 PRK03659 glutathione-regulated  67.8     9.1 0.00023   18.1   4.4   46  250-299   473-518 (602)
246 pfam02662 FlpD Methyl-viologen  67.1     8.1 0.00021   18.4   3.7   18  281-298    41-58  (124)
247 cd02810 DHOD_DHPD_FMN Dihydroo  66.8     9.5 0.00024   18.0  14.9  170  120-297    80-270 (289)
248 PRK02227 hypothetical protein;  66.1     9.8 0.00025   17.9  10.4  129   89-227    65-203 (239)
249 PRK09282 pyruvate carboxylase   65.8     9.9 0.00025   17.9  19.3   68  209-277   262-342 (580)
250 TIGR02491 NrdG anaerobic ribon  65.5      10 0.00026   17.8   7.2   94   54-152    16-113 (158)
251 PRK13113 consensus              65.5      10 0.00026   17.8  19.1  202   89-320    29-256 (263)
252 PRK13587 1-(5-phosphoribosyl)-  65.3      10 0.00026   17.8  12.4  178   96-300    36-222 (234)
253 PRK13127 consensus              65.0      10 0.00026   17.8  19.5  187   88-303    22-231 (262)
254 COG4739 Uncharacterized protei  64.5     4.3 0.00011   20.3   1.9   21   56-76     76-97  (182)
255 TIGR01522 ATPase-IIA2_Ca calci  63.9      11 0.00027   17.6   7.1  148   66-225   437-610 (856)
256 pfam00977 His_biosynth Histidi  63.6      11 0.00028   17.6   7.7  178   91-300    29-221 (229)
257 COG0036 Rpe Pentose-5-phosphat  63.5      11 0.00028   17.6  19.0  194   91-318    16-214 (220)
258 TIGR01678 FAD_lactone_ox sugar  61.8      12  0.0003   17.4   4.5  135   85-220    19-206 (505)
259 pfam04481 DUF561 Protein of un  61.2      12 0.00031   17.3  18.5  205   87-319    23-232 (243)
260 TIGR01367 pyrE_Therm orotate p  61.0     8.8 0.00023   18.2   2.9   96  106-204    15-147 (205)
261 PRK07535 methyltetrahydrofolat  60.7      12 0.00031   17.3  16.4  188   87-298    21-227 (268)
262 PRK07328 histidinol-phosphatas  60.0      13 0.00032   17.2  10.9  198   94-325    20-254 (268)
263 PTZ00124 adenosine deaminase;   59.8      13 0.00032   17.1   7.5   95  185-297   208-306 (362)
264 cd02071 MM_CoA_mut_B12_BD meth  59.7      13 0.00032   17.1   7.4   67   88-162    37-106 (122)
265 PRK11059 regulatory protein Cs  59.4      13 0.00033   17.1  11.5   12  214-225   537-548 (642)
266 cd01311 PDC_hydrolase 2-pyrone  59.4      13 0.00033   17.1  17.5  185   89-303    29-222 (263)
267 pfam00113 Enolase_C Enolase, C  59.2      13 0.00033   17.1   8.1   34  181-218   213-248 (296)
268 PRK11359 cAMP phosphodiesteras  58.7      13 0.00034   17.0  15.6   13  311-323   681-693 (799)
269 cd00945 Aldolase_Class_I Class  58.3      13 0.00034   17.0  17.1  179   88-298    10-200 (201)
270 COG1908 FrhD Coenzyme F420-red  57.4      14 0.00035   16.9   5.0   17  181-197    75-92  (132)
271 TIGR02291 rimK_rel_E_lig alpha  57.1      12 0.00032   17.2   3.2   47   83-133    30-76  (320)
272 PRK08104 consensus              57.0      14 0.00036   16.8  16.4  182   85-319    21-206 (212)
273 PTZ00081 enolase (2-phospho-D-  56.4      14 0.00037   16.8  10.8   74  245-323   352-429 (442)
274 pfam07085 DRTGG DRTGG domain.   55.4      15 0.00038   16.7   5.7   51  267-327    40-90  (105)
275 pfam00490 ALAD Delta-aminolevu  54.9      15 0.00039   16.6   9.1   56   85-141    51-115 (322)
276 PRK03562 glutathione-regulated  54.3      15 0.00039   16.6   4.3   40  123-162   475-514 (615)
277 PRK04302 triosephosphate isome  54.2      16  0.0004   16.5  12.3  147  148-319    75-221 (223)
278 COG4822 CbiK Cobalamin biosynt  54.1      16  0.0004   16.5  12.4   84  136-223   169-255 (265)
279 TIGR01163 rpe ribulose-phospha  53.8      16  0.0004   16.5  17.1  183   92-306    13-204 (216)
280 PRK13131 consensus              53.3      16 0.00041   16.5   7.8  186   89-303    23-231 (257)
281 TIGR01090 apt adenine phosphor  53.1      10 0.00025   17.8   2.1   39  283-323   104-143 (175)
282 cd04732 HisA HisA.  Phosphorib  53.1      16 0.00041   16.4   7.4  185   92-301    30-221 (234)
283 TIGR01501 MthylAspMutase methy  51.6      17 0.00044   16.3   4.8   45  283-328    71-117 (134)
284 pfam04476 DUF556 Protein of un  51.5      17 0.00044   16.3   9.7  127   91-227    67-203 (235)
285 cd00954 NAL N-Acetylneuraminic  51.0      17 0.00044   16.2   8.1   78   87-164    17-102 (288)
286 PRK08392 hypothetical protein;  50.4      18 0.00045   16.2  18.1   57  269-325   151-207 (215)
287 TIGR01369 CPSaseII_lrg carbamo  50.4      18 0.00045   16.2   4.3   88  136-223   649-758 (1089)
288 pfam02449 Glyco_hydro_42 Beta-  50.2      18 0.00046   16.1   5.4   70  251-320   273-373 (376)
289 TIGR02153 gatD_arch glutamyl-t  50.2      14 0.00037   16.8   2.6   42  177-225   293-337 (413)
290 COG0034 PurF Glutamine phospho  49.2      19 0.00047   16.0   3.3   31  290-322   346-376 (470)
291 COG0422 ThiC Thiamine biosynth  49.2      19 0.00047   16.0  13.0   74  187-266   248-351 (432)
292 pfam01207 Dus Dihydrouridine s  48.9      19 0.00048   16.0  13.4  166   45-220    18-204 (309)
293 pfam10758 DUF2586 Protein of u  48.9      12 0.00031   17.3   2.0   99  195-295   194-316 (363)
294 COG2200 Rtn c-di-GMP phosphodi  48.7      19 0.00048   16.0  12.4  175   17-227    47-229 (256)
295 cd03313 enolase Enolase: Enola  48.4      19 0.00049   15.9   8.7   53  246-300   336-389 (408)
296 COG0159 TrpA Tryptophan syntha  48.1      19 0.00049   15.9  18.0  201   88-319    28-258 (265)
297 PRK05096 guanosine 5'-monophos  47.8      19  0.0005   15.9   9.0   45  123-167   136-181 (347)
298 PRK13132 consensus              47.7      20  0.0005   15.9  17.7  202   88-320    22-245 (246)
299 TIGR02390 RNA_pol_rpoA1 DNA-di  47.6      10 0.00026   17.8   1.5   63   14-76    533-607 (901)
300 TIGR01430 aden_deam adenosine   47.2      20 0.00051   15.8   8.4   91  182-294   186-286 (346)
301 pfam01729 QRPTase_C Quinolinat  46.9      20 0.00051   15.8   7.5   16  147-162    89-104 (169)
302 PRK00077 eno phosphopyruvate h  46.8      20 0.00051   15.8  12.0   73  246-323   338-414 (427)
303 cd04740 DHOD_1B_like Dihydroor  46.8      20 0.00052   15.8  15.6  189  121-323    73-287 (296)
304 PRK09856 fructoselysine 3-epim  46.5      20 0.00052   15.8  10.9  168   85-268    84-273 (276)
305 COG1717 RPL32 Ribosomal protei  46.5      19 0.00047   16.0   2.7   63  138-200    58-126 (133)
306 cd04824 eu_ALAD_PBGS_cysteine_  45.8      21 0.00053   15.7   5.3   57   85-141    45-110 (320)
307 PRK12653 fructose-6-phosphate   45.8      21 0.00053   15.7  11.6  140  123-296    41-184 (220)
308 smart00052 EAL Putative diguan  45.6      21 0.00054   15.7   9.7   96  120-227   130-226 (241)
309 TIGR00411 redox_disulf_1 redox  45.6      21 0.00054   15.7   3.8   37  283-319    41-80  (82)
310 pfam00343 Phosphorylase Carboh  45.5      14 0.00035   16.9   1.9   66  259-325   533-612 (712)
311 COG0149 TpiA Triosephosphate i  45.5      21 0.00054   15.7  13.4  171  118-305    44-237 (251)
312 PRK10551 hypothetical protein;  45.4      21 0.00054   15.7  13.3   10  314-323   403-412 (518)
313 PRK02271 methylenetetrahydrome  45.2      21 0.00054   15.6   4.3   41  272-317   279-319 (324)
314 PRK09427 bifunctional indole-3  44.7      22 0.00055   15.6  16.3   45  272-319   410-455 (459)
315 pfam09587 PGA_cap Bacterial ca  44.0      22 0.00057   15.5   5.9  135  145-297    62-208 (237)
316 cd00953 KDG_aldolase KDG (2-ke  43.7      22 0.00057   15.5   7.9   77   88-164    17-97  (279)
317 PRK11572 copper homeostasis pr  43.6      23 0.00058   15.5  12.8  118   84-216    66-186 (248)
318 pfam00701 DHDPS Dihydrodipicol  43.2      23 0.00058   15.4  16.0   78   87-164    18-102 (289)
319 PRK06740 histidinol-phosphatas  42.8      23 0.00059   15.4   8.3  111   89-199    59-217 (338)
320 cd03316 MR_like Mandelate race  42.4      24  0.0006   15.3  10.2  144   88-266   138-291 (357)
321 PRK13811 orotate phosphoribosy  42.0      24 0.00061   15.3   3.2   28  186-213   121-149 (170)
322 cd03319 L-Ala-DL-Glu_epimerase  41.7      24 0.00061   15.3   8.7  153   88-279   133-290 (316)
323 pfam00563 EAL EAL domain. This  41.6      24 0.00062   15.3   9.8   90  124-226   132-222 (233)
324 COG2350 Uncharacterized protei  41.6      24  0.0006   15.3   2.6   34  210-243    17-50  (92)
325 PRK13135 consensus              41.5      24 0.00062   15.3  18.8  182   89-303    29-236 (267)
326 TIGR03247 glucar-dehydr glucar  41.5      24 0.00062   15.3   8.9  107   86-205   177-288 (441)
327 PRK13810 orotate phosphoribosy  41.4      24 0.00062   15.2   2.9   13  186-198   139-151 (187)
328 PRK13136 consensus              41.3      24 0.00062   15.2  18.9  203   88-320    23-249 (253)
329 PRK07107 inositol-5-monophosph  40.6      25 0.00064   15.2   6.4  147  136-302   231-384 (497)
330 pfam00962 A_deaminase Adenosin  40.5      25 0.00064   15.2   8.0   39  179-219   174-212 (329)
331 COG3246 Uncharacterized conser  40.0      26 0.00065   15.1  17.9  229   68-324     8-283 (298)
332 PRK00455 pyrE orotate phosphor  39.5      26 0.00066   15.1   2.5   22  185-206   127-149 (200)
333 PRK08562 rpl32e 50S ribosomal   39.0      26 0.00067   15.0   2.7   64  137-200    56-125 (127)
334 TIGR00337 PyrG CTP synthase; I  38.9      27 0.00068   15.0   5.7   73   91-165   122-220 (571)
335 pfam01373 Glyco_hydro_14 Glyco  38.9      27 0.00068   15.0   4.2   12  257-268   251-262 (399)
336 cd04723 HisA_HisF Phosphoribos  38.8      27 0.00068   15.0   8.1  187   91-313    35-231 (233)
337 COG3867 Arabinogalactan endo-1  38.8      27 0.00068   15.0   4.8   95  146-242   157-259 (403)
338 TIGR02033 D-hydantoinase dihyd  37.4      28 0.00071   14.8   5.2   60  100-159   146-207 (466)
339 PRK13137 consensus              36.9      28 0.00073   14.8  15.1  167  122-317    85-260 (266)
340 cd00537 MTHFR Methylenetetrahy  36.9      28 0.00073   14.8   8.0  105   88-204    70-196 (274)
341 cd02812 PcrB_like PcrB_like pr  36.9      29 0.00073   14.8   8.9  177   88-302    12-207 (219)
342 cd00951 KDGDH 5-dehydro-4-deox  36.7      29 0.00073   14.8   7.9   77   88-164    18-100 (289)
343 TIGR03249 KdgD 5-dehydro-4-deo  36.1      29 0.00075   14.7   7.4   77   88-164    23-105 (296)
344 PRK13126 consensus              35.7      30 0.00076   14.7  12.4  144  148-319    85-228 (237)
345 cd02801 DUS_like_FMN Dihydrour  35.6      30 0.00076   14.7  13.4  158  107-301    56-215 (231)
346 pfam02219 MTHFR Methylenetetra  35.5      30 0.00076   14.6   7.9  185   87-321    80-286 (286)
347 cd00384 ALAD_PBGS Porphobilino  35.0      30 0.00078   14.6   9.4   55   85-140    45-106 (314)
348 TIGR00078 nadC nicotinate-nucl  35.0      30 0.00078   14.6   7.4   39  125-163   172-211 (276)
349 PRK13122 consensus              34.4      31 0.00079   14.5   8.1  194   94-320    16-236 (242)
350 PRK13139 consensus              34.0      32 0.00081   14.5  18.1  200   89-320    28-253 (254)
351 cd00513 Ribosomal_L32_L32e Rib  33.5      32 0.00082   14.4   2.3   65  136-200    34-106 (107)
352 PRK01362 putative translaldola  33.4      32 0.00082   14.4   9.5  102  173-296    81-182 (214)
353 COG4943 Predicted signal trans  33.3      32 0.00083   14.4  11.4   92  149-260   405-515 (524)
354 KOG1643 consensus               33.2      32 0.00083   14.4   6.9  157   89-268    19-193 (247)
355 COG0434 SgcQ Predicted TIM-bar  33.2      33 0.00083   14.4  10.3  212   85-319    24-256 (263)
356 pfam10443 RNA12 RNA12 protein.  33.1      33 0.00083   14.4   3.9   58   89-154   167-224 (428)
357 PRK10415 tRNA-dihydrouridine s  32.7      33 0.00084   14.4  11.9  123   88-219    74-214 (321)
358 PRK08350 hypothetical protein;  32.7      33 0.00084   14.3  10.6   34  181-218   266-301 (341)
359 TIGR00238 TIGR00238 lysine 2,3  32.5      33 0.00085   14.3   5.3  192   61-268   137-342 (357)
360 PRK03620 5-dehydro-4-deoxygluc  32.3      34 0.00086   14.3   8.0   76   88-163    19-100 (296)
361 TIGR02151 IPP_isom_2 isopenten  32.2      34 0.00086   14.3   4.8  102  179-294   169-294 (349)
362 cd00408 DHDPS-like Dihydrodipi  32.1      34 0.00086   14.3  17.7  178   87-299    14-201 (281)
363 TIGR01934 MenG_MenH_UbiE ubiqu  32.0      34 0.00087   14.3   2.8  111  184-325   109-225 (242)
364 COG0148 Eno Enolase [Carbohydr  32.0      34 0.00087   14.3   9.9   51  247-299   336-387 (423)
365 PRK13210 putative L-xylulose 5  31.9      34 0.00087   14.3  10.8  135   87-227    90-248 (284)
366 COG4109 Predicted transcriptio  31.8      34 0.00087   14.3   5.5   20   12-31     64-83  (432)
367 PRK13809 orotate phosphoribosy  31.4      35 0.00089   14.2   2.7   16  186-201   135-150 (206)
368 TIGR02773 addB_Gpos ATP-depend  31.0      16 0.00041   16.5   0.3   18  189-206   263-280 (1192)
369 PRK07695 transcriptional regul  30.8      36 0.00091   14.1  15.4  182   88-319    12-199 (202)
370 TIGR01236 D1pyr5carbox1 1-pyrr  30.6      26 0.00067   15.0   1.4  186  131-324   151-395 (551)
371 TIGR03555 F420_mer 5,10-methyl  30.3      36 0.00092   14.1   3.9   41  272-317   279-319 (325)
372 PRK06739 pyruvate kinase; Vali  30.2      36 0.00093   14.1   6.5  146  146-318   166-322 (352)
373 TIGR00789 flhB_rel FlhB domain  29.6      37 0.00095   14.0   2.5   28  186-222    30-57  (84)
374 TIGR03557 F420_G6P_family F420  29.4      37 0.00095   14.0   4.1   33  279-317   274-306 (316)
375 COG3684 LacD Tagatose-1,6-bisp  29.0      38 0.00097   13.9   4.4   45  278-323   242-288 (306)
376 cd03113 CTGs CTP synthetase (C  28.9      38 0.00098   13.9   5.9   72  217-294   152-230 (255)
377 cd04735 OYE_like_4_FMN Old yel  28.9      38 0.00098   13.9   7.1  140  151-299   150-313 (353)
378 TIGR01703 hybrid_clust hydroxy  28.7      36 0.00091   14.1   1.8   53  142-194   211-268 (567)
379 cd02072 Glm_B12_BD B12 binding  28.5      39 0.00099   13.9   4.8   28  187-218    99-126 (128)
380 PRK13121 consensus              28.4      39 0.00099   13.9  10.7  184   89-303    29-237 (265)
381 COG1410 MetH Methionine syntha  28.3      39   0.001   13.9  14.2   37  186-222   137-175 (842)
382 COG4464 CapC Capsular polysacc  28.3      39   0.001   13.9  10.2   73   88-160    17-97  (254)
383 pfam01208 URO-D Uroporphyrinog  28.2      39   0.001   13.8  13.4   69  147-226   181-254 (337)
384 TIGR01326 OAH_OAS_sulfhy O-ace  27.9      36 0.00093   14.1   1.7   83   81-165   121-204 (434)
385 pfam01301 Glyco_hydro_35 Glyco  27.9      40   0.001   13.8   3.8   59   87-145    20-85  (317)
386 TIGR00247 TIGR00247 conserved   27.8      28 0.00071   14.9   1.1   32  195-226   266-297 (373)
387 TIGR02045 P_fruct_ADP ADP-spec  27.7      24 0.00061   15.3   0.8  204   47-268   149-377 (466)
388 cd01948 EAL EAL domain. This d  27.4      41   0.001   13.8  10.0   93  122-226   131-224 (240)
389 pfam02677 DUF208 Uncharacteriz  27.4      41   0.001   13.8   6.6   30  182-211    89-120 (176)
390 TIGR01769 GGGP geranylgeranylg  27.4      41   0.001   13.8   5.9  183   88-299    10-212 (212)
391 PRK13111 trpA tryptophan synth  27.3      41   0.001   13.8  19.3  186   88-303    20-228 (256)
392 TIGR00585 mutl DNA mismatch re  27.3      41   0.001   13.8   3.4   12   62-73     61-72  (367)
393 PRK13812 orotate phosphoribosy  27.2      41   0.001   13.7   3.0   28  186-213   124-152 (174)
394 PRK09283 delta-aminolevulinic   27.1      41   0.001   13.7   5.5   55   85-140    53-114 (321)
395 PRK03170 dihydrodipicolinate s  27.1      41   0.001   13.7   8.7   77   88-164    19-102 (292)
396 PRK12376 putative translaldola  27.0      41   0.001   13.7  11.7  144  123-296    49-198 (238)
397 cd00956 Transaldolase_FSA Tran  26.6      42  0.0011   13.7  11.6   94  184-296    89-182 (211)
398 pfam08902 DUF1848 Domain of un  26.6      23 0.00059   15.4   0.5   45   89-133    57-106 (264)
399 TIGR02041 CysI sulfite reducta  26.5      42  0.0011   13.7   3.6   27  193-219   376-405 (550)
400 cd00952 CHBPH_aldolase Trans-o  25.9      43  0.0011   13.6  10.8   78   87-164    25-109 (309)
401 PRK04128 1-(5-phosphoribosyl)-  25.5      44  0.0011   13.5   7.0  187   92-315    31-226 (228)
402 COG1574 Predicted metal-depend  25.4      44  0.0011   13.5   5.6   27  178-204   316-342 (535)
403 PRK12999 pyruvate carboxylase;  25.3      44  0.0011   13.5  14.0  170   89-276   690-878 (1147)
404 TIGR01210 TIGR01210 conserved   25.2      44  0.0011   13.5   8.8  203   61-268    22-259 (329)
405 cd00311 TIM Triosephosphate is  25.2      44  0.0011   13.5  15.2  174  122-317    41-241 (242)
406 PRK09490 metH B12-dependent me  25.1      44  0.0011   13.5  14.1  115  183-298   468-601 (1229)
407 PRK10550 tRNA-dihydrouridine s  25.0      45  0.0011   13.5   8.7  119   88-218    72-213 (312)
408 cd06556 ICL_KPHMT Members of t  24.7      45  0.0012   13.4   7.8   62  150-226    94-167 (240)
409 cd04823 ALAD_PBGS_aspartate_ri  24.6      45  0.0012   13.4   6.6   57   85-141    48-112 (320)
410 COG1456 CdhE CO dehydrogenase/  24.4      46  0.0012   13.4  14.0  249    5-275    32-313 (467)
411 PRK00043 thiE thiamine-phospha  24.1      46  0.0012   13.4   6.0  171   89-306    18-193 (210)
412 PRK01130 N-acetylmannosamine-6  23.8      47  0.0012   13.3  10.7  179   86-302    18-206 (222)
413 pfam08671 SinI Anti-repressor   23.7      47  0.0012   13.3   2.2   15  183-197     3-17  (30)
414 pfam08981 consensus             23.7      47  0.0012   13.3   8.9  118   89-215    10-146 (181)
415 TIGR02051 MerR Hg(II)-responsi  23.6      29 0.00074   14.7   0.5   30  181-210    41-71  (126)
416 PRK05458 guanosine 5'-monophos  23.4      48  0.0012   13.3   7.7   15  286-300   217-231 (326)
417 KOG0623 consensus               23.3      48  0.0012   13.3   6.3   13  314-326   477-489 (541)
418 COG3813 Uncharacterized protei  23.3      20  0.0005   15.9  -0.4   14   63-76     23-36  (84)
419 PRK08645 bifunctional homocyst  23.3      48  0.0012   13.3  20.8  166   32-225    81-290 (608)
420 PRK13227 consensus              23.0      49  0.0012   13.2   3.2   16  184-199   100-115 (228)
421 TIGR02706 P_butyryltrans phosp  23.0      49  0.0012   13.2   2.8   26   87-112    20-45  (295)
422 PRK07259 dihydroorotate dehydr  23.0      49  0.0012   13.2  15.4  188  122-323    76-290 (301)
423 COG0552 FtsY Signal recognitio  22.9      49  0.0012   13.2   7.4   18  151-168   160-177 (340)
424 TIGR00973 leuA_bact 2-isopropy  22.8      49  0.0013   13.2  18.5  204   86-318    18-251 (514)
425 pfam04898 Glu_syn_central Glut  22.7      49  0.0013   13.2   8.1   23  190-212   185-207 (288)
426 PRK13288 pyrophosphatase PpaX;  22.6      50  0.0013   13.2   3.9   15  185-199    87-101 (214)
427 TIGR03554 F420_G6P_DH glucose-  22.6      50  0.0013   13.2   4.0   32  279-316   290-321 (331)
428 pfam00290 Trp_syntA Tryptophan  22.5      50  0.0013   13.2  10.1  185   89-303    21-229 (258)
429 PRK10669 putative cation:proto  22.5      50  0.0013   13.2   3.9   48  250-301   490-537 (558)
430 COG2217 ZntA Cation transport   22.3      50  0.0013   13.1   6.2  115  123-268   540-660 (713)
431 PRK09568 DNA primase large sub  22.3      21 0.00054   15.7  -0.4   18   34-51     36-53  (306)
432 COG0011 Uncharacterized conser  22.2      50  0.0013   13.1   2.4   27  181-207    49-80  (100)
433 cd00530 PTE Phosphotriesterase  22.2      51  0.0013   13.1   9.1   24  185-209   163-186 (293)
434 pfam02702 KdpD Osmosensitive K  22.1      51  0.0013   13.1   6.4  186   92-294    21-209 (211)
435 PRK11057 ATP-dependent DNA hel  22.1      51  0.0013   13.1   4.8   32  178-209   313-344 (607)
436 TIGR01754 flav_RNR ribonucleot  22.0      47  0.0012   13.3   1.4   31  179-210    65-96  (145)
437 KOG2368 consensus               21.7      52  0.0013   13.1   5.0  220   87-324    36-278 (316)
438 PRK08462 biotin carboxylase; V  21.6      52  0.0013   13.0   8.4   11  189-199   262-272 (446)
439 TIGR01743 purR_Bsub pur operon  21.5      52  0.0013   13.0   3.7   34  284-319   187-220 (269)
440 PRK00042 tpiA triosephosphate   21.3      53  0.0013   13.0   7.6  179  122-320    44-249 (251)
441 cd00958 DhnA Class I fructose-  21.2      53  0.0013   13.0  11.3  134  157-319    88-232 (235)
442 cd04914 ACT_AKi-DapG-BS_1 ACT   21.1      53  0.0014   13.0   2.8   33  295-327    34-66  (67)
443 PRK06111 acetyl-CoA carboxylas  21.0      53  0.0014   13.0   8.4   10   88-97     61-70  (449)
444 TIGR00875 talC transaldolase,   21.0      53  0.0014   13.0  11.6  172   87-296     7-185 (216)
445 PRK13116 consensus              20.9      53  0.0014   13.0  19.0  186   89-303    29-239 (278)
446 PRK10329 glutaredoxin-like pro  20.9      34 0.00088   14.2   0.5   49   65-114     7-57  (81)
447 pfam06906 DUF1272 Protein of u  20.9      25 0.00063   15.2  -0.2   11   63-73     23-33  (57)
448 KOG1122 consensus               20.8      54  0.0014   12.9   4.7   40  224-266   225-264 (460)
449 PRK09206 pyruvate kinase; Prov  20.7      54  0.0014   12.9   5.8   37  187-223   262-304 (470)
450 PRK05294 carB carbamoyl phosph  20.7      54  0.0014   12.9   8.1  128   93-222   576-736 (1063)
451 pfam01884 PcrB PcrB family. Th  20.6      54  0.0014   12.9   5.2  177   89-302    20-214 (231)
452 PRK06096 molybdenum transport   20.5      55  0.0014   12.9   7.5   49  249-300   217-265 (284)
453 PRK09875 putative hydrolase; P  20.5      55  0.0014   12.9   9.8   14  147-160   165-178 (292)
454 COG3345 GalA Alpha-galactosida  20.5      55  0.0014   12.9   4.4  100   32-149   267-383 (687)
455 KOG3333 consensus               20.5      55  0.0014   12.9   3.2   13   64-76      3-16  (188)
456 TIGR00014 arsC arsenate reduct  20.4      55  0.0014   12.9   4.0   22  147-168    12-34  (114)
457 KOG0564 consensus               20.2      55  0.0014   12.9   6.8   75   88-163    89-186 (590)
458 TIGR02951 DMSO_dmsB dimethylsu  20.1      56  0.0014   12.8   1.9   24   56-80     89-112 (162)

No 1  
>PRK06256 biotin synthase; Validated
Probab=100.00  E-value=0  Score=551.40  Aligned_cols=319  Identities=37%  Similarity=0.681  Sum_probs=293.7

Q ss_pred             HHHHHHHHHCCCC-CCCCHHHHHHHHCCCHHHH--HHHHHHHHHHHCCCCEEEEEEEEEECCCCCCCCCCCCCCCCCCCC
Q ss_conf             5732134200234-4789999999973991899--999999988862898569998645307868342321243354777
Q gi|254780485|r    4 STVVPEENPTKKP-KVWTSKEVFQIYNMPFNDL--LFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQSVHNKS   80 (328)
Q Consensus         4 ~~~~~~~~~~~~~-e~ls~eea~~L~~~~~~el--~~~Aa~~~r~~~~g~~V~~~~~in~~TN~C~~~C~fCaf~~~~~~   80 (328)
                      .-+-...+|+.++ ++||++||++|++.++.++  ++.+|+.+|++|+||.|++++++|++||.|++||+||+||+++++
T Consensus         3 ~~i~~~~~kvl~gg~~ls~eEal~Ll~~~d~dl~~L~~~A~~iR~~~~G~~v~l~~iin~kng~C~edC~yCaqs~~~~~   82 (325)
T PRK06256          3 DILDKLAEKVLEGGEGLTKEEALALLNLPDDDLLELLAAAYEVRKHYFGKEVKLNSIINLKSGLCPEDCGYCSQSAGSSS   82 (325)
T ss_pred             HHHHHHHHHHHCCCCCCCHHHHHHHHHCCCHHHHHHHHHHHHHHHHHCCCEEEEEEEEEECCCCCCCCCCCCCCCCCCCC
T ss_conf             79999999998089999999999998099376999999999999984899799998887618988999962989076789


Q ss_pred             CCCCCCCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCCCCHHHHHHHHHHHCC-CCCCEEEECCCCCHHHHHHHHCCCC
Q ss_conf             564100068579999999999649838997303688874428999998876213-6883241025699999998741576
Q gi|254780485|r   81 KLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKS-LGLETCMTLGMLSFEQAQILSKAGL  159 (328)
Q Consensus        81 ~~~~~~~~~~Eei~~~a~~~~~~G~~~~~l~~~~~~~~~~~~~~~~e~i~~i~~-~~~~i~~~~g~~~~~~~~~Lk~aG~  159 (328)
                      ...+|.+++.|+|++.|+.+.+.|++++|+|++++.+...++++++++++.||+ .++++++|+|.++++++++||+||+
T Consensus        83 ~~~~y~ll~~eeI~~~a~~a~~~G~~~~~lvtsg~~~~~~~~e~v~~~i~~Ik~~~~l~i~~slG~l~~e~~~~LkeAGv  162 (325)
T PRK06256         83 PIYRYAWLDIEEIVEAAKEAIENGAGRFCIVASGRGPSGREVDQVIEAVKAIKEETDLEICACLGLLTEEQAERLKEAGV  162 (325)
T ss_pred             CCCCCCCCCHHHHHHHHHHHHHCCCCEEEEEEECCCCCHHHHHHHHHHHHHHHHCCCEEEEEECCCCCHHHHHHHHHCCC
T ss_conf             97412789999999999999986998899986045897678999999999986228936887348899999999998699


Q ss_pred             CEEEEECCCCHHHHHCCCCCCCHHHHHHHHHHHHHCCCCCCCEEEECCCCCHHHHHHHHHHHHHCCCCCCEEECCCEEEC
Q ss_conf             06975134377773205888898999999999998798557707866898999999999999740888860205411204
Q gi|254780485|r  160 DYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPI  239 (328)
Q Consensus       160 ~~~~~~let~~~~~~~~~~~~~~~~~l~~~~~a~~~G~~~~sg~l~G~gEt~eeri~~l~~lr~l~~~~~~v~~~~~~p~  239 (328)
                      ++|++++||++++|+++||+|+|++|+++++.||++|+++|||+|||+|||++||++|++.||++|.  ++||+|+|+|+
T Consensus       163 d~y~~nlETs~~~f~~i~~tht~~~Rl~ti~~a~~aGi~vcsG~i~GlGEt~edrve~l~~Lr~l~~--~sipin~l~P~  240 (325)
T PRK06256        163 DRYNHNLETSRSYFPNVVTTHTYEDRVDTCEMVKAAGIEPCSGGIIGMGETLEDRAEHAFFLKELDA--DSIPINFLNPI  240 (325)
T ss_pred             CEECCCCCCCHHHCCCCCCCCCHHHHHHHHHHHHHCCCCCCCCEEECCCCCHHHHHHHHHHHHCCCC--CEEECCCCEEC
T ss_conf             8886664406876388689988999999999999859964664376689998999999999971999--88954670106


Q ss_pred             CCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCEEEEHHHHHCHHHHHHHHHHCCCEEEECCEEECCCCCCHHHHHHHHHH
Q ss_conf             87412445687989999999999996868721423115651656899999809988997786651588898999999998
Q gi|254780485|r  240 PGSKFEENKKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTILFNR  319 (328)
Q Consensus       240 ~gt~l~~~~~~~~~e~lr~iAi~RL~lP~~~i~i~~~~~~~~~~~~~~~L~~GaN~~~~g~~~~t~~g~~~~~~~~~i~~  319 (328)
                      +||||++.+++++.|.+|+||++||++|++.|++++||+.+..+.+.+ +.+||||+|+|+|+ |+.|+++++|++||++
T Consensus       241 ~gTpl~~~~~l~~~e~lr~iAi~Rl~~P~~~Ir~agGr~~~~~~~~~~-~~~gan~~~~G~~l-Tt~g~~~~~d~~~i~~  318 (325)
T PRK06256        241 KGTPLEDLPELTPLECLKTIAIFRLINPDKEIRIAGGREIALRSLQPL-ALKGANSIFVGNYL-TTLGQPAEADLKMIED  318 (325)
T ss_pred             CCCCCCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCHHHHHH-HHHHCHHHEECCCC-CCCCCCHHHHHHHHHH
T ss_conf             998668899989999999999999978995489707855225567999-98617351466653-7899786799999998


Q ss_pred             CCCCCCC
Q ss_conf             2985324
Q gi|254780485|r  320 LGLIPDL  326 (328)
Q Consensus       320 ~G~~P~~  326 (328)
                      +||+|.+
T Consensus       319 lg~~~~~  325 (325)
T PRK06256        319 LGFEIKL  325 (325)
T ss_pred             CCCCCCC
T ss_conf             6994009


No 2  
>COG0502 BioB Biotin synthase and related enzymes [Coenzyme metabolism]
Probab=100.00  E-value=0  Score=512.33  Aligned_cols=311  Identities=54%  Similarity=0.918  Sum_probs=299.3

Q ss_pred             CCCCCCHHHHHHHHCCCHHH-HHHHHHHHHHHHCCCCEEEEEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHH
Q ss_conf             34478999999997399189-99999999888628985699986453078683423212433547775641000685799
Q gi|254780485|r   15 KPKVWTSKEVFQIYNMPFND-LLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQSVHNKSKLKASKLINVDQV   93 (328)
Q Consensus        15 ~~e~ls~eea~~L~~~~~~e-l~~~Aa~~~r~~~~g~~V~~~~~in~~TN~C~~~C~fCaf~~~~~~~~~~~~~~~~Eei   93 (328)
                      .++.||.+|++.||+.|+.+ +++.||+..|++|+|+.|.+++++|++|+.|+.+|+||+||++++++...+++++.|+|
T Consensus        10 ~~~~~~~~e~~~l~~~~~~~~~L~~aA~~~R~~~~g~~V~l~~ii~iktg~c~edC~yC~qS~~~~~~~~~~~l~~~eeI   89 (335)
T COG0502          10 RGERWTLDEALALLDLPDEDELLFEAAQKHRLHFDGNEVQLSTLISIKTGCCPEDCAYCSQSARYKTGVKARKLMEVEEI   89 (335)
T ss_pred             HCCCCCHHHHHHHHCCCCCHHHHHHHHHHHHHHCCCCEEEEEEEEEEECCCCCCCCCCCCCCCCCCCCCCHHHCCCHHHH
T ss_conf             04676799999997288626899999999998548885899888873348889889876001047679823312899999


Q ss_pred             HHHHHHHHHCCCEEEEEECCCCCCCCCCHHHHHHHHHHHC-CCCCCEEEECCCCCHHHHHHHHCCCCCEEEEECCCCHHH
Q ss_conf             9999999964983899730368887442899999887621-368832410256999999987415760697513437777
Q gi|254780485|r   94 LKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVK-SLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERF  172 (328)
Q Consensus        94 ~~~a~~~~~~G~~~~~l~~~~~~~~~~~~~~~~e~i~~i~-~~~~~i~~~~g~~~~~~~~~Lk~aG~~~~~~~let~~~~  172 (328)
                      ++.|+.+++.|+.++|++++|++ ..++++++.++++.++ +.++++++++|.++++++++|+++|++.|+||+||++++
T Consensus        90 le~Ak~ak~~Ga~r~c~~aagr~-~~~~~~~i~~~v~~Vk~~~~le~c~slG~l~~eq~~~L~~aGvd~ynhNLeTs~~~  168 (335)
T COG0502          90 LEAAKKAKAAGATRFCMGAAGRG-PGRDMEEVVEAIKAVKEELGLEVCASLGMLTEEQAEKLADAGVDRYNHNLETSPEF  168 (335)
T ss_pred             HHHHHHHHHCCCCEEEEEEECCC-CCCCHHHHHHHHHHHHHHCCCHHHHCCCCCCHHHHHHHHHCCHHHEECCCCCCHHH
T ss_conf             99999999749950799873167-77448999999999998469286402587999999999971811330355569788


Q ss_pred             HHCCCCCCCHHHHHHHHHHHHHCCCCCCCEEEECCCCCHHHHHHHHHHHHHCCCCCCEEECCCEEECCCCCCCCCCCCCH
Q ss_conf             32058888989999999999987985577078668989999999999997408888602054112048741244568798
Q gi|254780485|r  173 YPHVTTTHTFEDRLQTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDP  252 (328)
Q Consensus       173 ~~~~~~~~~~~~~l~~~~~a~~~G~~~~sg~l~G~gEt~eeri~~l~~lr~l~~~~~~v~~~~~~p~~gt~l~~~~~~~~  252 (328)
                      |++++|+++|++|+++++.++++|+++|||+|+|+|||.+||++++..|+++.. +++||+++|+|+|||||++.+++++
T Consensus       169 y~~I~tt~t~edR~~tl~~vk~~Gi~vcsGgI~GlGEs~eDri~~l~~L~~l~~-pdsVPIn~l~P~~GTPle~~~~~~~  247 (335)
T COG0502         169 YENIITTRTYEDRLNTLENVREAGIEVCSGGIVGLGETVEDRAELLLELANLPT-PDSVPINFLNPIPGTPLENAKPLDP  247 (335)
T ss_pred             HCCCCCCCCHHHHHHHHHHHHHCCCCCCCCEEECCCCCHHHHHHHHHHHHHCCC-CCEEEEEEECCCCCCCCCCCCCCCH
T ss_conf             756578988889999999999809850451276189988899999999971899-8854232103799986665899998


Q ss_pred             HHHHHHHHHHHHHCCCCCCEEEEHHHHHCHHHHHHHHHHCCCEEEECCEEECCCCCCHHHHHHHHHHCCCCCCCC
Q ss_conf             999999999999686872142311565165689999980998899778665158889899999999829853247
Q gi|254780485|r  253 IEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTILFNRLGLIPDLS  327 (328)
Q Consensus       253 ~e~lr~iAi~RL~lP~~~i~i~~~~~~~~~~~~~~~L~~GaN~~~~g~~~~t~~g~~~~~~~~~i~~~G~~P~~~  327 (328)
                      .|++|+||++||+||+..|++++||+++++++|.++|.+|||++++|+.++|+.|+..++|.+|++++|+.|...
T Consensus       248 ~e~lk~IA~~Ri~~P~~~Ir~s~gr~~~~~~~q~~~~~aGansi~~g~~~ltt~~~~~e~D~~~l~~lgl~~e~~  322 (335)
T COG0502         248 FEFLKTIAVARIIMPKSMIRLSAGRETMLPELQALAFMAGANSIFVGDKYLTTPGPDEDKDLELLKDLGLEPELL  322 (335)
T ss_pred             HHHHHHHHHHHHHCCCCEEECCCCCCCCCHHHHHHHHHHCCCEEEECCEEEECCCCCCHHHHHHHHHCCCCCCCC
T ss_conf             999999999999778645672588352258889999984566356524476248998036899999738872114


No 3  
>PRK08444 hypothetical protein; Provisional
Probab=100.00  E-value=0  Score=500.07  Aligned_cols=312  Identities=18%  Similarity=0.220  Sum_probs=273.3

Q ss_pred             HHHHHCCCCCCCCHHHHHHHHCCCHHHHHHHHHHHHHHHCCCCEEEEEEEEEEC-CCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             134200234478999999997399189999999998886289856999864530-7868342321243354777564100
Q gi|254780485|r    8 PEENPTKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIK-TGGCPENCGYCNQSVHNKSKLKASK   86 (328)
Q Consensus         8 ~~~~~~~~~e~ls~eea~~L~~~~~~el~~~Aa~~~r~~~~g~~V~~~~~in~~-TN~C~~~C~fCaf~~~~~~~~~~~~   86 (328)
                      .+.+|+.+++|||.+|++.||+.|+.+|+..|+.+|++ ++||.|+|+.++|+| ||+|+.+|+||||+++++.  +..+
T Consensus         2 dIleKv~~gerls~ee~~~L~~~dl~~L~~~Ad~~R~~-~~G~~vtfv~n~~IN~TNiC~~~C~FCaF~r~~~~--~~aY   78 (353)
T PRK08444          2 NLLEKLENNERLNQEEAVALYDLDLFTLGKYADRKRTK-LHGKKVYFNINRHINPTNICADVCKFCAFSAHRKN--PNPY   78 (353)
T ss_pred             CHHHHHHCCCCCCHHHHHHHHCCCHHHHHHHHHHHHHH-HCCCEEEEEECCCCCCCCCCCCCCCCCCCCCCCCC--CCCE
T ss_conf             48889876998999999999868999999999999998-77991699820574566445688856756168999--9876


Q ss_pred             CCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCCCCHHHHHHHHHHHCCCCCCEEEEC-------------CCCCHHHHHH
Q ss_conf             068579999999999649838997303688874428999998876213688324102-------------5699999998
Q gi|254780485|r   87 LINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLGLETCMTL-------------GMLSFEQAQI  153 (328)
Q Consensus        87 ~~~~Eei~~~a~~~~~~G~~~~~l~~~~~~~~~~~~~~~~e~i~~i~~~~~~i~~~~-------------g~~~~~~~~~  153 (328)
                      .++.|||++.++++.+.|++++++|+|.++  ..+++||++++|.+|+..|.++++.             |...++.+.+
T Consensus        79 ~ls~eei~~~~~ea~~~G~tev~i~GG~~P--~~~~eyY~~l~r~ik~~~P~i~i~aft~~EI~~~a~~~~~s~~evL~~  156 (353)
T PRK08444         79 TMSHEEILEIVKESVKRGIKEVHIVSAHNP--NYGYQWYLEIFKMIKEAYPNLHVKAMTAAEVDFLSRKFGKSYEEVLED  156 (353)
T ss_pred             ECCHHHHHHHHHHHHHCCCCEEEEECCCCC--CCCHHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHHCCCCHHHHHHH
T ss_conf             669999999999999759878998147598--997588999999999858850477177899999999809999999999


Q ss_pred             HHCCCCCEE-EEECCC-CHHHHHCCCCCC-CHHHHHHHHHHHHHCCCCCCCEEEECCCCCHHHHHHHHHHHHHCCCCCCE
Q ss_conf             741576069-751343-777732058888-98999999999998798557707866898999999999999740888860
Q gi|254780485|r  154 LSKAGLDYY-NHNIDT-SERFYPHVTTTH-TFEDRLQTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPES  230 (328)
Q Consensus       154 Lk~aG~~~~-~~~let-~~~~~~~~~~~~-~~~~~l~~~~~a~~~G~~~~sg~l~G~gEt~eeri~~l~~lr~l~~~~~~  230 (328)
                      ||+||++++ .-..|. +++.++.+||++ +.++|+++++.||++|++++|||||||+||++||++||..||++|+.+.+
T Consensus       157 Lk~AGL~slpGggAEIl~d~VR~~I~p~K~~~~~Wl~i~~~AH~lGi~ttaTmmyGhvEt~e~rv~HL~~lR~lQd~tgG  236 (353)
T PRK08444        157 MLEYGVDSMPGGGAEIFDEEVRKKICKGKVSSERWLEIHKYWHKKGKQSNATMLFGHIENREHRIDHMLRLRDLQDKTGG  236 (353)
T ss_pred             HHHHCCCCCCCCCCHHCCHHHHHHHCCCCCCHHHHHHHHHHHHHCCCCCCEEEECCCCCCHHHHHHHHHHHHHHCCCCCC
T ss_conf             99819875789872003777897618998999999999999998299664146778879999999999999983655798


Q ss_pred             EECCCEEE----CCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCEEEEHHHHHCHHHHHHHHHHCCC---EEEECCEEE
Q ss_conf             20541120----48741244568798999999999999686872142311565165689999980998---899778665
Q gi|254780485|r  231 IPINLLIP----IPGSKFEENKKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGAN---SIFVGDTLL  303 (328)
Q Consensus       231 v~~~~~~p----~~gt~l~~~~~~~~~e~lr~iAi~RL~lP~~~i~i~~~~~~~~~~~~~~~L~~GaN---~~~~g~~~~  303 (328)
                      |.  .|+|    .++|+|+..+.+++.|+||++|||||||+| +.+||++|+++|.++.|++|.+|||   |||++|+++
T Consensus       237 F~--~FIPl~f~~~~t~l~~~~~~t~~e~Lr~~AisRl~Ldn-i~~IqasWv~~G~~~aq~aL~~GanDlggT~~eE~i~  313 (353)
T PRK08444        237 FN--AFIPLVYQRENNYLKVEKFPSSQEILKTIAISRILLDN-IPHIKAYWATLTLNLALVAQEFGANDLDGTIEKESIQ  313 (353)
T ss_pred             EE--EEEECCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHCC-CCCCEEEEEECCHHHHHHHHHCCCCCCCCCCCCCCEE
T ss_conf             35--89765657899857778999989999999999998638-7861544562378999999966996775555545244


Q ss_pred             CCCC------CCHHHHHHHHHHCCCCCCCC
Q ss_conf             1588------89899999999829853247
Q gi|254780485|r  304 TAKN------PSYNKDTILFNRLGLIPDLS  327 (328)
Q Consensus       304 t~~g------~~~~~~~~~i~~~G~~P~~~  327 (328)
                      .++|      .+.++++.||+++|++|+.+
T Consensus       314 ~~aGa~~~~~~~~~~l~~~I~~aG~~P~eR  343 (353)
T PRK08444        314 SAAGAKSAHGLSKEDFIFLIKDSGFIPVER  343 (353)
T ss_pred             CCCCCCCCCCCCHHHHHHHHHHCCCCEEEE
T ss_conf             212589988899999999999859975521


No 4  
>TIGR00433 bioB biotin synthase; InterPro: IPR002684   Biotin synthase 2.8.1.6 from EC works with flavodoxin, S-adenosylmethionine, and possibly cysteine to catalyze the last step of the biotin biosynthetic pathway. The reaction consists of the introduction of a sulphur atom into dethiobiotin, thus requiring activation of C-H bonds . Biotin (vitamin H) is a prosthetic group in enzymes catalysing carboxylation and transcarboxylation reactions .    Biotin synthase from Escherichia coli is a homodimer of 76 kDa, with each polypeptide chain carrying an oxygen-sensitive (4Fe-4S) cluster, probably ligated by three cysteines of a CXXXCXXC box conserved among all known BioB sequences and a fourth still not identified ligand. BioB displays a pyridoxal phosphate-dependent cysteine desulphurase activity, which allows mobilization of the sulphur atom from free cysteine .  ; GO: 0004076 biotin synthase activity, 0009102 biotin biosynthetic process.
Probab=100.00  E-value=0  Score=499.67  Aligned_cols=296  Identities=50%  Similarity=0.913  Sum_probs=275.0

Q ss_pred             HHCCC---HHHHHHHHHHHHHHHCCCCEEEEEEEEEECCCCCCCCCCCCCCCCCCC----------CCCCCCCCCCHH--
Q ss_conf             97399---189999999998886289856999864530786834232124335477----------756410006857--
Q gi|254780485|r   27 IYNMP---FNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQSVHNK----------SKLKASKLINVD--   91 (328)
Q Consensus        27 L~~~~---~~el~~~Aa~~~r~~~~g~~V~~~~~in~~TN~C~~~C~fCaf~~~~~----------~~~~~~~~~~~E--   91 (328)
                      ||+.|   ..+|++.|..++|+.|.|+.|.+|.++|++|+.|++||.||+||.+++          +...-+++...+  
T Consensus         1 l~~~p~E~~l~Ll~~A~~~~r~~~~~~~v~Lc~i~N~KSG~C~EDC~YCsQSs~~~CniPiYPlk~~~~~~~~~~~~~De   80 (350)
T TIGR00433         1 LYETPDEDLLDLLYEAFQIHRKHFNPRKVQLCTIMNIKSGGCPEDCGYCSQSSRSKCNIPIYPLKDTGLPIERLKKVDDE   80 (350)
T ss_pred             CCCCCCHHHHHHHHHHHHHHHHHHCCCEEEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHH
T ss_conf             98887513799999999999873374802342110122185766776788555266886224566741789988767654


Q ss_pred             ------------HHHHHHHHHHHCCC---------EEEEEECCCCCCCCCC------HHHHHHHHHHHCC--CCCCEEEE
Q ss_conf             ------------99999999996498---------3899730368887442------8999998876213--68832410
Q gi|254780485|r   92 ------------QVLKEAKNAKENGA---------TRYCMGAAWREPKERD------LSIIVDMIKGVKS--LGLETCMT  142 (328)
Q Consensus        92 ------------ei~~~a~~~~~~G~---------~~~~l~~~~~~~~~~~------~~~~~e~i~~i~~--~~~~i~~~  142 (328)
                                  +|+++|+.+...|.         .+||||++|++|..++      .+++.++.+.+++  .++++|++
T Consensus        81 Cskisssier~k~~l~eA~~a~~~G~PnrGfPlWv~rFClvasGR~~~~~~~~dref~~~v~~~~~~~~~ee~GL~~C~~  160 (350)
T TIGR00433        81 CSKISSSIEREKEILEEARAAKAAGAPNRGFPLWVTRFCLVASGRGPKDRESKDREFIEIVEAVVKIVEEEELGLKTCAT  160 (350)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCEEECCEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCHHHHC
T ss_conf             32222111111378999999997087888853035014655417888877742202889999999997520037122320


Q ss_pred             CCCCCHHHHHHHHCCCCCEEEEECC-CCHHHHHCCCCCCCHHHHHHHHHHHHHCCCCCCCEEEECCCCCHHHHHHHHHHH
Q ss_conf             2569999999874157606975134-377773205888898999999999998798557707866898999999999999
Q gi|254780485|r  143 LGMLSFEQAQILSKAGLDYYNHNID-TSERFYPHVTTTHTFEDRLQTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTL  221 (328)
Q Consensus       143 ~g~~~~~~~~~Lk~aG~~~~~~~le-t~~~~~~~~~~~~~~~~~l~~~~~a~~~G~~~~sg~l~G~gEt~eeri~~l~~l  221 (328)
                      +|.++.++++.||+||+|.|+||+| |++++|++++++|||+||++|++.|+++||++|||.|||||||++||++.+..|
T Consensus       161 LG~l~~eqa~~LKdAGld~YNHNl~~TS~~~y~~I~sThty~DR~~T~~~~k~aGl~~CsGGI~GlgEt~~DrI~l~~~L  240 (350)
T TIGR00433       161 LGLLDPEQAKQLKDAGLDRYNHNLDETSQEYYSKIISTHTYDDRVDTVKNAKEAGLKVCSGGILGLGETWEDRIGLALAL  240 (350)
T ss_pred             CCCCCHHHHHHHHHCCCCCCCCCHHHHHHHHCCCCEECCCHHHHHHHHHHHHHCCCCCCCCCEECCCCCHHHHHHHHHHH
T ss_conf             37768899998886388611167367878766873432307767999999997388724462345898889999999997


Q ss_pred             HHCCCCCCEEECCCEEECCCCC----CCC--CCCCCHHHHHHHHHHHHHHCCCCCCEEEEHHHHHCHHHHH---HHHHHC
Q ss_conf             7408888602054112048741----244--5687989999999999996868721423115651656899---999809
Q gi|254780485|r  222 ANLSTPPESIPINLLIPIPGSK----FEE--NKKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQA---LCFFSG  292 (328)
Q Consensus       222 r~l~~~~~~v~~~~~~p~~gt~----l~~--~~~~~~~e~lr~iAi~RL~lP~~~i~i~~~~~~~~~~~~~---~~L~~G  292 (328)
                      ++|...+++||+|+|+|++|||    +++  ...+++.|.||+||++|++||+..|++++||+....+.++   +.+++|
T Consensus       241 ~~L~p~peSvPiN~L~~~~GTP~~E~L~~~~~~~L~~~~~Lk~iA~ari~mP~~~iRlagGR~~~m~e~~~kea~~~~ag  320 (350)
T TIGR00433       241 ANLSPEPESVPINFLVKIEGTPAYEKLADGEVKKLSADDALKTIALARIIMPKAEIRLAGGREVNMKELQQKEAMCFMAG  320 (350)
T ss_pred             HCCCCCCCEECCCCEECCCCCCCHHHHCCCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCEEEECCCCCHHHHHHHHHH
T ss_conf             52776787011132026888853443158886733889999999998865431100100251450476754899999984


Q ss_pred             CCEEEECCEEECCCCCCHHHHHHHHHHCCC
Q ss_conf             988997786651588898999999998298
Q gi|254780485|r  293 ANSIFVGDTLLTAKNPSYNKDTILFNRLGL  322 (328)
Q Consensus       293 aN~~~~g~~~~t~~g~~~~~~~~~i~~~G~  322 (328)
                      +||||+|+|+||++....++|.+|+.++||
T Consensus       321 ~Nsif~G~yLtT~g~~~eD~D~~~l~~lgL  350 (350)
T TIGR00433       321 ANSIFVGDYLTTTGQPPEDEDKKLLAKLGL  350 (350)
T ss_pred             HHHHEECCCCCCCCCCCCHHHHHHHHHCCC
T ss_conf             212304640024865886178999986179


No 5  
>PRK08508 biotin synthase; Provisional
Probab=100.00  E-value=0  Score=491.61  Aligned_cols=274  Identities=40%  Similarity=0.653  Sum_probs=262.5

Q ss_pred             CEEEEEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCCCCHHHHHHHH
Q ss_conf             85699986453078683423212433547775641000685799999999996498389973036888744289999988
Q gi|254780485|r   50 NHIQLSKLLNIKTGGCPENCGYCNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMI  129 (328)
Q Consensus        50 ~~V~~~~~in~~TN~C~~~C~fCaf~~~~~~~~~~~~~~~~Eei~~~a~~~~~~G~~~~~l~~~~~~~~~~~~~~~~e~i  129 (328)
                      ++|.+|+++|++||.|++||+||+||+++++++++|.+++.|+|++.|+.+++.|+.++++|++|+.+..++++++++++
T Consensus         2 ~~v~lcsi~n~KSG~C~edC~yCaQs~~~~t~i~~Y~l~~~eeIl~~A~~a~~~G~~rf~lv~sg~~~~~~~~e~v~~~v   81 (279)
T PRK08508          2 QEIFLCAISNISSGNCKEDCKYCTQSAHYKADIKRYKRKEIEQIVQEAKMARANGALGFCLVTAGRGLDDKKLEYVAKAA   81 (279)
T ss_pred             CEEEEEEEEECCCCCCCCCCCCCCCCCCCCCCCCEECCCCHHHHHHHHHHHHHCCCCEEEEEEECCCCCHHHHHHHHHHH
T ss_conf             64799888734137999878644481767999861078999999999999997599768999823688754499999999


Q ss_pred             HHHCCC--CCCEEEECCCCCHHHHHHHHCCCCCEEEEECCCCHHHHHCCCCCCCHHHHHHHHHHHHHCCCCCCCEEEECC
Q ss_conf             762136--883241025699999998741576069751343777732058888989999999999987985577078668
Q gi|254780485|r  130 KGVKSL--GLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSGIKVCCGGILGL  207 (328)
Q Consensus       130 ~~i~~~--~~~i~~~~g~~~~~~~~~Lk~aG~~~~~~~let~~~~~~~~~~~~~~~~~l~~~~~a~~~G~~~~sg~l~G~  207 (328)
                      +.||+.  ++.+++|+|.++++++++||+||+++|++|+||++++|+++|++|+|++|+++++.++++|+.+|||+|+|+
T Consensus        82 ~~Ik~~~~~l~~c~slG~l~~e~~~~LkeAGvdrY~hNlETs~~~y~~I~tThty~dRl~tl~~~k~aGl~vCsGgIiGl  161 (279)
T PRK08508         82 KAVKKEVPGLHLIACNGMASVEQLKELKKAGIFSYNHNLETSKEFFPKICTTHSWEERFQTCLNAKEAGLGLCSGGIFGL  161 (279)
T ss_pred             HHHHHCCCCEEEEEECCCCCHHHHHHHHHCCCCEECCCCCCCHHHHCCCCCCCCHHHHHHHHHHHHHCCCEEECCCEEEC
T ss_conf             99863379935761178579999999998397123076676768757658998889999999999981994867854478


Q ss_pred             CCCHHHHHHHHHHHHHCCCCCCEEECCCEEECCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCEEEEHHHHHCHHHHHH
Q ss_conf             98999999999999740888860205411204874124456879899999999999968687214231156516568999
Q gi|254780485|r  208 GEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQAL  287 (328)
Q Consensus       208 gEt~eeri~~l~~lr~l~~~~~~v~~~~~~p~~gt~l~~~~~~~~~e~lr~iAi~RL~lP~~~i~i~~~~~~~~~~~~~~  287 (328)
                      |||++||+++++.||+|+  +++||+|+|+|+|||||+ .+++++.|.||+||++||++|++.|++++||+.+.+++|.+
T Consensus       162 GEt~edrve~a~~L~eL~--~dsVPIN~liPi~GTPLe-~~~l~~~e~lr~iAl~RlilP~a~Ir~agGRe~~l~~~q~~  238 (279)
T PRK08508        162 GESWEDRISMLKSLASLS--PHSTPINFFIPNPALPLD-TPTLSADEALEIVRLAKEALPNARLMVAGGREVVFGERQYE  238 (279)
T ss_pred             CCCHHHHHHHHHHHHHCC--CCEECCCCCCCCCCCCCC-CCCCCHHHHHHHHHHHHHHCCCCEEEECCCHHHHCHHHHHH
T ss_conf             999899999999998389--987515676589999888-89999999999999999978987656246524455636999


Q ss_pred             HHHHCCCEEEECCEEECCCCCCHHHHHHHHHHCCCCCCCC
Q ss_conf             9980998899778665158889899999999829853247
Q gi|254780485|r  288 CFFSGANSIFVGDTLLTAKNPSYNKDTILFNRLGLIPDLS  327 (328)
Q Consensus       288 ~L~~GaN~~~~g~~~~t~~g~~~~~~~~~i~~~G~~P~~~  327 (328)
                      +|.+|||++|+|+|+ |+.|+++++|.+||+++||+.+.+
T Consensus       239 ~~~aGaN~i~~G~yL-Tt~G~~~~~D~~mi~~lG~~v~~~  277 (279)
T PRK08508        239 IFEAGANAIVIGDYL-TTKGEAPKKDIEKLKSLGFEFASS  277 (279)
T ss_pred             HHHHCCCEEEECCCC-CCCCCCHHHHHHHHHHCCCEEECC
T ss_conf             998468468886652-789978679999999869934124


No 6  
>PRK07094 biotin synthase; Provisional
Probab=100.00  E-value=0  Score=476.92  Aligned_cols=300  Identities=23%  Similarity=0.379  Sum_probs=264.4

Q ss_pred             CCHHHHHHHHCCCHH---HHHHHHHHHHHHHCCCCEEEEEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHH
Q ss_conf             899999999739918---99999999988862898569998645307868342321243354777564100068579999
Q gi|254780485|r   19 WTSKEVFQIYNMPFN---DLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQSVHNKSKLKASKLINVDQVLK   95 (328)
Q Consensus        19 ls~eea~~L~~~~~~---el~~~Aa~~~r~~~~g~~V~~~~~in~~TN~C~~~C~fCaf~~~~~~~~~~~~~~~~Eei~~   95 (328)
                      ||++|+++|++..+.   +.++.+|+..|++++||.|+++++||+ ||+|++||+||+|+++++ ..++| .++.|||++
T Consensus         1 Lt~eE~l~LL~~~d~~~l~~L~~~A~~iR~~~~G~~V~l~~iIn~-Sn~C~edC~yC~~~~~n~-~~~rY-~Ls~eeI~~   77 (323)
T PRK07094          1 LSRDEILELLSNDDEEELKYLFKAADEVRKKYVGDEVHLRGLIEF-SNYCRRNCLYCGLRRSNK-NIKRY-RLSPEEILE   77 (323)
T ss_pred             CCHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHCCCEEEEEEEEEE-CCCCCCCCCCCCCCCCCC-CCCCC-CCCHHHHHH
T ss_conf             988999998615998999999999999999977996899987984-689999993478766789-97743-799999999


Q ss_pred             HHHHHHHCCCEEEEEECCCCCCCCCCHHHHHHHHHHHCC-CCCCEEEECCCCCHHHHHHHHCCCCCEEEEECCCC-HHHH
Q ss_conf             999999649838997303688874428999998876213-68832410256999999987415760697513437-7773
Q gi|254780485|r   96 EAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKS-LGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTS-ERFY  173 (328)
Q Consensus        96 ~a~~~~~~G~~~~~l~~~~~~~~~~~~~~~~e~i~~i~~-~~~~i~~~~g~~~~~~~~~Lk~aG~~~~~~~let~-~~~~  173 (328)
                      .|+++++.|++++++++|. ++ ..+.++++++++.||+ .++.+++|+|.++.++|++||+||+++|++++||+ +++|
T Consensus        78 ~A~~a~~~G~~~~~lqsG~-~~-~~~~e~~~~ii~~Ik~~~~l~i~lSlG~l~~e~~~~Lk~AG~dry~~nlETs~~~~y  155 (323)
T PRK07094         78 CAKKAYELGYGTIVLQSGE-DP-YYTDEKIADIIKEIKKELDVAITLSLGERSYEEYKAWKEAGADRYLLRHETADRELY  155 (323)
T ss_pred             HHHHHHHCCCCEEEEECCC-CC-CCCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHCCCCEEECCCCCCCHHHH
T ss_conf             9999998699889996489-98-866999999999986059945997578799999999998597744124565698986


Q ss_pred             HCCCCCCCHHHHHHHHHHHHHCCCCCCCEEEECC-CCCHHHHHHHHHHHHHCCCCCCEEECCCEEECCCCCCCCCCCCCH
Q ss_conf             2058888989999999999987985577078668-989999999999997408888602054112048741244568798
Q gi|254780485|r  174 PHVTTTHTFEDRLQTLENVRKSGIKVCCGGILGL-GEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDP  252 (328)
Q Consensus       174 ~~~~~~~~~~~~l~~~~~a~~~G~~~~sg~l~G~-gEt~eeri~~l~~lr~l~~~~~~v~~~~~~p~~gt~l~~~~~~~~  252 (328)
                      +++||+++|++|++++++||++|+++|||+|||+ |||++||++|++.||+||.  ++||+++|+|+|||||++.+++++
T Consensus       156 ~~i~p~~t~~~Rl~~l~~~k~~G~~v~sG~iiGlpGET~edr~~~l~~LreL~~--~~v~i~~fiP~~gTPl~~~~~~~~  233 (323)
T PRK07094        156 EKLHPGMSFENRIQCLKDLKELGYEVGSGFMVGLPGQTLEDLADDILFLKELDL--DMIGIGPFIPHPDTPLADEKGGSL  233 (323)
T ss_pred             CCCCCCCCHHHHHHHHHHHHHCCCCCCCEEEECCCCCCHHHHHHHHHHHHHCCC--CEECCCCCCCCCCCCCCCCCCCCH
T ss_conf             775899998999999999998398104302779899999999999999983799--886772551799999889999799


Q ss_pred             HHHHHHHHHHHHHCCCCCCEEEEHHHHHCHHHHHHHHHHCCCEEEEC--------CEEECCC----CCC----HHHHHHH
Q ss_conf             99999999999968687214231156516568999998099889977--------8665158----889----8999999
Q gi|254780485|r  253 IEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVG--------DTLLTAK----NPS----YNKDTIL  316 (328)
Q Consensus       253 ~e~lr~iAi~RL~lP~~~i~i~~~~~~~~~~~~~~~L~~GaN~~~~g--------~~~~t~~----g~~----~~~~~~~  316 (328)
                      ++.||++|++||++|++.|+.+++|.++++++++++|.+|||.+|-.        .|.+--+    +.+    .+...++
T Consensus       234 ~~~lr~iAl~Rli~P~a~Ipattal~~l~~~g~~~~l~aGANvvmp~~tp~~~r~~y~ly~~k~~~~~~~~~~~~~~~~~  313 (323)
T PRK07094        234 ELTLKVLALARLLLPDANIPATTALGTLNPDGREKGLKAGANVVMPNLTPTEYRKLYQLYPGKICTGEEAAECRECIEAR  313 (323)
T ss_pred             HHHHHHHHHHHHHCCCCCCCCCCCHHHCCHHHHHHHHHCCCCEECCCCCCHHHCCCCCCCCCCCCCCCCHHHHHHHHHHH
T ss_conf             99999999999978766574446532249889999987688664788994676257526799876887899999999999


Q ss_pred             HHHCCCCCC
Q ss_conf             998298532
Q gi|254780485|r  317 FNRLGLIPD  325 (328)
Q Consensus       317 i~~~G~~P~  325 (328)
                      |+++|+++.
T Consensus       314 ~~~~g~~~~  322 (323)
T PRK07094        314 IESIGRTVG  322 (323)
T ss_pred             HHHCCCCCC
T ss_conf             997286468


No 7  
>PRK05927 hypothetical protein; Provisional
Probab=100.00  E-value=0  Score=480.42  Aligned_cols=310  Identities=15%  Similarity=0.164  Sum_probs=263.6

Q ss_pred             CCCCCCCCHHHHHHHHCC-CHHHHHHHHHHHHHHHCCCCEEEEEEEEEEC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCH
Q ss_conf             023447899999999739-9189999999998886289856999864530-78683423212433547775641000685
Q gi|254780485|r   13 TKKPKVWTSKEVFQIYNM-PFNDLLFWSHTVHRKNFEPNHIQLSKLLNIK-TGGCPENCGYCNQSVHNKSKLKASKLINV   90 (328)
Q Consensus        13 ~~~~e~ls~eea~~L~~~-~~~el~~~Aa~~~r~~~~g~~V~~~~~in~~-TN~C~~~C~fCaf~~~~~~~~~~~~~~~~   90 (328)
                      +..+||||.+|++.||+. |+.+|+..|+.+|+++++||.|+|..++|+| ||+|+..|+||||++.++.  +..+.++.
T Consensus         1 ~~~~~Rls~~e~~~L~~~~dl~~l~~~A~~~R~~~~~g~~Vtyv~n~~iN~TNvC~~~C~FCaF~r~~~~--~~ay~ls~   78 (350)
T PRK05927          1 MNLPKRISFQEGLELFLSSPLEELQERADSLRKQRYPQNTVTYVLDANPNYTNICKIDCTFCAFYRKPRS--SDAYLLSF   78 (350)
T ss_pred             CCCCCCCCHHHHHHHHHCCCHHHHHHHHHHHHHHHCCCCEEEEEEECCCCCCHHHHCCCCCCCCCCCCCC--CCCCCCCH
T ss_conf             9703469999999986179999999999999997559986999620487741256576934774258999--87532799


Q ss_pred             HHHHHHHHHHHHCCCEEEEEECCCCCCCCCCHHHHHHHHHHHCCCCCCEEEEC-------------CCCCHHHHHHHHCC
Q ss_conf             79999999999649838997303688874428999998876213688324102-------------56999999987415
Q gi|254780485|r   91 DQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLGLETCMTL-------------GMLSFEQAQILSKA  157 (328)
Q Consensus        91 Eei~~~a~~~~~~G~~~~~l~~~~~~~~~~~~~~~~e~i~~i~~~~~~i~~~~-------------g~~~~~~~~~Lk~a  157 (328)
                      |||+++++++.+.|++++|+|+|.++  ..+++||.++++.+|+..+.++++.             |...++.+++|++|
T Consensus        79 eei~~~~~e~~~~G~tEv~i~GG~~P--~l~~eyy~~l~r~ik~~~P~i~ihafs~~Ei~~~a~~~g~s~~e~L~~Lk~A  156 (350)
T PRK05927         79 DEFRSLMQRYVSSGVKTVLLQGGVHP--QLGIDYLEELVRITVQEFPSLHPHFFSAVEIAHAAQVSGISTEQALQRLWDA  156 (350)
T ss_pred             HHHHHHHHHHHHCCCCEEEEECCCCC--CCCHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHCCCCHHHHHHHHHHC
T ss_conf             99999999998669838998268899--9986999999999997488866566999999999988599999999999973


Q ss_pred             CCCEE-EEECCC-CHHHHHCCCC-CCCHHHHHHHHHHHHHCCCCCCCEEEECCCCCHHHHHHHHHHHHHCCCCCCEEE-C
Q ss_conf             76069-751343-7777320588-889899999999999879855770786689899999999999974088886020-5
Q gi|254780485|r  158 GLDYY-NHNIDT-SERFYPHVTT-THTFEDRLQTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIP-I  233 (328)
Q Consensus       158 G~~~~-~~~let-~~~~~~~~~~-~~~~~~~l~~~~~a~~~G~~~~sg~l~G~gEt~eeri~~l~~lr~l~~~~~~v~-~  233 (328)
                      |++++ .-.-|. +++...++|| |.+.++|+++++.||++|+++++||||||+||++||++||..||+||+.|.+|. +
T Consensus       157 GL~slPGgGAEIl~d~VR~~I~p~K~s~~~Wl~i~~~AH~lGi~ttaTmlyGhiEt~e~ri~HL~~lR~lQdeTgGF~~F  236 (350)
T PRK05927        157 GQRTIPGGGAEILSERVRKIISPKKMGPDGWINFHKLAHRLGFRSTATMMFGHVENPEDILLHLQTLRDAQDENPGFYSF  236 (350)
T ss_pred             CCCCCCCCCCCCCCHHHHHHCCCCCCCHHHHHHHHHHHHHCCCCCCCEEECCCCCCHHHHHHHHHHHHHHHHHHCCEEEE
T ss_conf             76768998750168777751488888999999999999985997520246368799999999999999987650987999


Q ss_pred             CCEEE-CCCCCCCCC--CCCCHHHHHHHHHHHHHHCCCCCCEEEEHHHHHCHHHHHHHHHHCCC---EEEECCEEECCCC
Q ss_conf             41120-487412445--68798999999999999686872142311565165689999980998---8997786651588
Q gi|254780485|r  234 NLLIP-IPGSKFEEN--KKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGAN---SIFVGDTLLTAKN  307 (328)
Q Consensus       234 ~~~~p-~~gt~l~~~--~~~~~~e~lr~iAi~RL~lP~~~i~i~~~~~~~~~~~~~~~L~~GaN---~~~~g~~~~t~~g  307 (328)
                      -+|.+ ..+|+|...  ...+++++||++|+|||||+|. .+||++|+++|.++.|++|.+|||   |||++|++..++|
T Consensus       237 Ipl~F~p~nt~l~~~~~~~~~~~~~Lr~~AvaRl~Ldn~-~hIqa~Wv~~G~~~aq~aL~~GanDlgGT~~eE~I~~aaG  315 (350)
T PRK05927        237 IPWSYKPGNTALGRRVPQQASPELYYRILALARIFLDNF-DHIAASWFGEGKEEGAKGLHYGADDFGGTILDESVHKCTG  315 (350)
T ss_pred             EECCCCCCCCHHHHCCCCCCCHHHHHHHHHHHHHHCCCC-CCEEECEEECCHHHHHHHHHCCCCCCCCCCEEEEEECCCC
T ss_conf             946765488746542788998457599999999970698-8637240525799999999669976765530004643228


Q ss_pred             C----CHHHHHHHHHHCCCCCCCC
Q ss_conf             8----9899999999829853247
Q gi|254780485|r  308 P----SYNKDTILFNRLGLIPDLS  327 (328)
Q Consensus       308 ~----~~~~~~~~i~~~G~~P~~~  327 (328)
                      .    +.++++++|+++|++|+.+
T Consensus       316 ~~~~~~~~el~~~I~~aG~~P~eR  339 (350)
T PRK05927        316 WDLQSSEEEICAMIRSEGFIPVER  339 (350)
T ss_pred             CCCCCCHHHHHHHHHHCCCCCCCC
T ss_conf             998999999999999859973012


No 8  
>PRK07360 FO synthase subunit 2; Reviewed
Probab=100.00  E-value=0  Score=473.26  Aligned_cols=323  Identities=16%  Similarity=0.253  Sum_probs=268.7

Q ss_pred             CCHHHHHHHHHHCCCCCCCCHHHHHHHHCCCH----HHHHHHHHHHHHHHCCCCEEEEEEEEEEC-CCCCCCCCCCCCCC
Q ss_conf             98557321342002344789999999973991----89999999998886289856999864530-78683423212433
Q gi|254780485|r    1 MSRSTVVPEENPTKKPKVWTSKEVFQIYNMPF----NDLLFWSHTVHRKNFEPNHIQLSKLLNIK-TGGCPENCGYCNQS   75 (328)
Q Consensus         1 ~~~~~~~~~~~~~~~~e~ls~eea~~L~~~~~----~el~~~Aa~~~r~~~~g~~V~~~~~in~~-TN~C~~~C~fCaf~   75 (328)
                      |+...+-.+.+|+.+++|||++|++.||+..+    .+|+..|+++ |++++|+.|+|+.++||| ||+|+.+|+||+|+
T Consensus         2 ~~~~~~~~Il~Kv~~GerLs~eeal~L~~~~d~~~l~~L~~~A~~v-R~~~~Gd~Vtfv~n~~In~TNiC~~~C~fCaF~   80 (375)
T PRK07360          2 MTDQIPEDILERAFKGKDLSKEDALELLEDTEPRNIFEILELADRL-RAEQVGDTVTYVVNRNINFTNICEGHCGFCAFR   80 (375)
T ss_pred             CCCCCHHHHHHHHHCCCCCCHHHHHHHHHCCCHHHHHHHHHHHHHH-HHHHCCCEEEEEEEECCCHHHHHHCCCCCCCCC
T ss_conf             8751299999999769999999999998469857899999999999-998669969998252665617987089827340


Q ss_pred             CCCCCCCCCCCCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCC---CCHHHHHHHHHHHCCCCCCEEEEC---------
Q ss_conf             54777564100068579999999999649838997303688874---428999998876213688324102---------
Q gi|254780485|r   76 VHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKE---RDLSIIVDMIKGVKSLGLETCMTL---------  143 (328)
Q Consensus        76 ~~~~~~~~~~~~~~~Eei~~~a~~~~~~G~~~~~l~~~~~~~~~---~~~~~~~e~i~~i~~~~~~i~~~~---------  143 (328)
                      +.++.  ...+.+++|||++.++++.+.|++++++|+|.++...   ..++||.++++.+++..+.++++.         
T Consensus        81 r~p~~--~~ay~ls~eEi~~~~~~a~~~G~tEv~~~gG~~P~l~~~~~~~~~y~~~~~~ik~~~p~i~i~a~s~~Ei~~~  158 (375)
T PRK07360         81 RDKGD--PGAFWLDIEEILEKAAEAVKAGATEVCIQGGLHPAADLNGSSLDFYLEILKAIKAEFPGIHLHAFSPQEVQFA  158 (375)
T ss_pred             CCCCC--CCCEECCHHHHHHHHHHHHHCCCEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCEEEECCHHHHHHH
T ss_conf             78899--7660278999999999998658808997688783445464518999999999998689855640899999998


Q ss_pred             ----CCCCHHHHHHHHCCCCCEE-EEECCC-CHHHHHCCCCCC-CHHHHHHHHHHHHHCCCCCCCEEEECCCCCHHHHHH
Q ss_conf             ----5699999998741576069-751343-777732058888-989999999999987985577078668989999999
Q gi|254780485|r  144 ----GMLSFEQAQILSKAGLDYY-NHNIDT-SERFYPHVTTTH-TFEDRLQTLENVRKSGIKVCCGGILGLGEMIDDRID  216 (328)
Q Consensus       144 ----g~~~~~~~~~Lk~aG~~~~-~~~let-~~~~~~~~~~~~-~~~~~l~~~~~a~~~G~~~~sg~l~G~gEt~eeri~  216 (328)
                          |...++.+.+|++||++++ ....|. +++.++.+||++ +.++|+++++.||++|+++|||||||||||++||++
T Consensus       159 a~~~g~~~~e~l~~LkeAGl~s~pG~gaEil~~~vr~~i~P~K~~~~~wl~v~~~Ah~lGi~ttatmL~Gh~Et~eerv~  238 (375)
T PRK07360        159 AREDGLSYEEVLKALKDAGLDSMPGTAAEILDDEVRRIICPEKITTAEWIEIVKTAHKLGLPTTSTMMYGHIETPEHRID  238 (375)
T ss_pred             HHHCCCCHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHCCCCCCCCHHHHHHHHHHHHHCCCCCCEEEECCCCCCHHHHHH
T ss_conf             86649988999999997698758887621034556646598988999999999999982997010026189899999999


Q ss_pred             HHHHHHHCCCCCCEEE-C--CCEEECCCCCCCCC----CCCCHHHHHHHHHHHHHHCCCCCCEEEEHHHHHCHHHHHHHH
Q ss_conf             9999974088886020-5--41120487412445----687989999999999996868721423115651656899999
Q gi|254780485|r  217 MLLTLANLSTPPESIP-I--NLLIPIPGSKFEEN----KKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCF  289 (328)
Q Consensus       217 ~l~~lr~l~~~~~~v~-~--~~~~p~~gt~l~~~----~~~~~~e~lr~iAi~RL~lP~~~i~i~~~~~~~~~~~~~~~L  289 (328)
                      ||..||+||+.+.+|. +  .+|.| .+||+...    .+++..|+||++|+|||||||...+||++|+++|++..|++|
T Consensus       239 hL~~iR~lqd~tggf~efIp~~F~~-~nt~l~~~~~~~~~~~~~e~lk~~AvaRl~Ldn~i~~Iqa~Wv~~g~~~~q~aL  317 (375)
T PRK07360        239 HLSILREIQKETGGITEFIPLPFVH-ENAPLYERGRVKRGAPGLEDLKLYAVSRIFLGNWIKNIQPSWVKLGLKLAQEAL  317 (375)
T ss_pred             HHHHHHHHHHHCCCEEEEEECCCCC-CCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCCEECCCCCCCHHHHHHHH
T ss_conf             9999998887449846997114358-998500015678888669899999999998338887657777544899999999


Q ss_pred             HHCCC---EEEECCEEECCCC------CCHHHHHHHHHHCCCCCCCC
Q ss_conf             80998---8997786651588------89899999999829853247
Q gi|254780485|r  290 FSGAN---SIFVGDTLLTAKN------PSYNKDTILFNRLGLIPDLS  327 (328)
Q Consensus       290 ~~GaN---~~~~g~~~~t~~g------~~~~~~~~~i~~~G~~P~~~  327 (328)
                      .+|||   |+|++|+++.++|      .+.++++++|+++||+|+.+
T Consensus       318 ~~GanD~ggt~~ee~i~~~aG~~~~~~~~~~~l~~~i~~aG~~p~eR  364 (375)
T PRK07360        318 NCGANDLGGTLMEEHITKMAGASGGTCMSVEELENAIKSIGRIPKQR  364 (375)
T ss_pred             HCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHCCCCCHHC
T ss_conf             66997676656667500122689988899999999999849983111


No 9  
>PRK08445 hypothetical protein; Provisional
Probab=100.00  E-value=0  Score=472.41  Aligned_cols=306  Identities=14%  Similarity=0.190  Sum_probs=259.0

Q ss_pred             CCCCHHHHHHHHC-CCHHHHHHHHHHHHHHHCCCCEEEEEEEEEEC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHH
Q ss_conf             4789999999973-99189999999998886289856999864530-786834232124335477756410006857999
Q gi|254780485|r   17 KVWTSKEVFQIYN-MPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIK-TGGCPENCGYCNQSVHNKSKLKASKLINVDQVL   94 (328)
Q Consensus        17 e~ls~eea~~L~~-~~~~el~~~Aa~~~r~~~~g~~V~~~~~in~~-TN~C~~~C~fCaf~~~~~~~~~~~~~~~~Eei~   94 (328)
                      ||||.+|++.||+ .|+.+|+..|+.+|++.++++.|+|+.++|+| ||+|+.+|+||||++.++.  +..+.++.|+|.
T Consensus         2 eRls~~e~~~L~~~~dl~~L~~~A~~~R~~~~g~~vvtfv~nrniN~TNiC~~~C~FCaF~r~~~~--~~aY~ls~eei~   79 (348)
T PRK08445          2 KRLNKEEALDLIKNAPLKELGQMALARKQELHPEKITTFIVDRNINYTNICWVDCKFCAFYRHLKE--EDAYILSFEEID   79 (348)
T ss_pred             CCCCHHHHHHHHHCCCHHHHHHHHHHHHHHHCCCCEEEEEECCCCCHHHHHHCCCCCCCCCCCCCC--CCCCCCCHHHHH
T ss_conf             879999999986489999999999999999759935999701687552686548977757479999--876227999999


Q ss_pred             HHHHHHHHCCCEEEEEECCCCCCCCCCHHHHHHHHHHHCCCCCCEEEECC-------------CCCHHHHHHHHCCCCCE
Q ss_conf             99999996498389973036888744289999988762136883241025-------------69999999874157606
Q gi|254780485|r   95 KEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLGLETCMTLG-------------MLSFEQAQILSKAGLDY  161 (328)
Q Consensus        95 ~~a~~~~~~G~~~~~l~~~~~~~~~~~~~~~~e~i~~i~~~~~~i~~~~g-------------~~~~~~~~~Lk~aG~~~  161 (328)
                      ++++++.+.|++++|+|+|.++  ..+++||.++++.+|+..|.++++.+             ...++.+++||+||+++
T Consensus        80 ~~~~~a~~~g~tEv~i~GG~~P--~l~~~yY~~l~r~ik~~~P~i~ihaft~~EI~~~a~~~~~s~~EvL~~Lk~AGL~s  157 (348)
T PRK08445         80 QKIEELLAIGGTQILFQGGVHP--KLKIEWYENLVSHIAQKYPTITIHGFSAVEIDYIAKISKISLKEVLERLQAKGLSS  157 (348)
T ss_pred             HHHHHHHHCCCEEEEEECCCCC--CCCHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHCCCHHHHHHHHHHHCCCC
T ss_conf             9999998649818998279899--99777999999999975775424279999999999981989999999999819887


Q ss_pred             E-EEECCC-CHHHHHCCCCC-CCHHHHHHHHHHHHHCCCCCCCEEEECCCCCHHHHHHHHHHHHHCCCCCCEEECC-CEE
Q ss_conf             9-751343-77773205888-8989999999999987985577078668989999999999997408888602054-112
Q gi|254780485|r  162 Y-NHNIDT-SERFYPHVTTT-HTFEDRLQTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPIN-LLI  237 (328)
Q Consensus       162 ~-~~~let-~~~~~~~~~~~-~~~~~~l~~~~~a~~~G~~~~sg~l~G~gEt~eeri~~l~~lr~l~~~~~~v~~~-~~~  237 (328)
                      + .-..|. +++...++||+ .+.++|+++++.||++|++++|||||||+||++||++||.+||+||+.+++|..+ ++.
T Consensus       158 lPGggAEIl~d~VR~~I~p~K~s~~~Wlei~~~AH~lGi~ttaTMlyGhiEt~e~rv~HL~~lR~lQdeTgGF~~FIpl~  237 (348)
T PRK08445        158 IPGAGAEILSDRVRDIIAPKKLSSDRWLEVHRQAHKIGMKSTATMMFGTVENDEEIIEHWEHIRDLQDETGGFRAFILWS  237 (348)
T ss_pred             CCCCCHHHCCHHHHHHHCCCCCCHHHHHHHHHHHHHCCCCCCCEEECCCCCCHHHHHHHHHHHHHHHHHCCCEEEEEECC
T ss_conf             88866263488999874888899999999999999869964121362677999999999999999998619978998543


Q ss_pred             -ECCCCCCCC----CCCCCHHHHHHHHHHHHHHCCCCCCEEEEHHHHHCHHHHHHHHHHCCC---EEEECCEEECCCCC-
Q ss_conf             -048741244----568798999999999999686872142311565165689999980998---89977866515888-
Q gi|254780485|r  238 -PIPGSKFEE----NKKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGAN---SIFVGDTLLTAKNP-  308 (328)
Q Consensus       238 -p~~gt~l~~----~~~~~~~e~lr~iAi~RL~lP~~~i~i~~~~~~~~~~~~~~~L~~GaN---~~~~g~~~~t~~g~-  308 (328)
                       .+.+|++..    ...+++.|+||++|||||||+| +.+||++|+++|.++.|++|.+|||   |||++|+++.++|. 
T Consensus       238 F~p~nt~l~~~~~~~~~~~~~e~Lk~~AvsRL~Ldn-i~~Iqa~Wv~~G~~~aq~aL~~GanD~gGT~~eE~I~~aAGa~  316 (348)
T PRK08445        238 FQPDNTPLKEEHPEIKKQSSNRYLRLLAVSRLFLDN-FKNIQSSWVTQGSYIGQLALLFGANDLGSTMMEENVVKAAGAS  316 (348)
T ss_pred             CCCCCCHHHCCCCCCCCCCHHHHHHHHHHHHHHHCC-CCCEEEEEEECCHHHHHHHHHCCCCCCCCCCCCCEEHHHCCCC
T ss_conf             106997020037877899879999999999998648-8760621020578999999956997776551010112510899


Q ss_pred             ---CHHHHHHHHHHCCCCCCCC
Q ss_conf             ---9899999999829853247
Q gi|254780485|r  309 ---SYNKDTILFNRLGLIPDLS  327 (328)
Q Consensus       309 ---~~~~~~~~i~~~G~~P~~~  327 (328)
                         +.+++++||+++|++|+.+
T Consensus       317 ~~~~~~~l~~lI~~aG~~P~eR  338 (348)
T PRK08445        317 FRMNQAEMIELIKDIGEVPAKR  338 (348)
T ss_pred             CCCCHHHHHHHHHHCCCCEEEE
T ss_conf             8899999999999859986320


No 10 
>PRK05926 hypothetical protein; Provisional
Probab=100.00  E-value=0  Score=469.91  Aligned_cols=317  Identities=16%  Similarity=0.168  Sum_probs=262.4

Q ss_pred             HHHHHHHHHCCCCCCCCHHHHHHHH---C-CCHHHHHHHHHHHHHHHCCCCEEEEEEEEEEC-CCCCCCCCCCCCCCCCC
Q ss_conf             5732134200234478999999997---3-99189999999998886289856999864530-78683423212433547
Q gi|254780485|r    4 STVVPEENPTKKPKVWTSKEVFQIY---N-MPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIK-TGGCPENCGYCNQSVHN   78 (328)
Q Consensus         4 ~~~~~~~~~~~~~e~ls~eea~~L~---~-~~~~el~~~Aa~~~r~~~~g~~V~~~~~in~~-TN~C~~~C~fCaf~~~~   78 (328)
                      ..+-++.+|+.+++|||.+|+++||   + .++.+|+..|+.+|++ .+|+.|+|+.++|+| ||+|+.+|+||||++..
T Consensus        14 ~~l~~IleKv~~G~RLs~~dg~~L~~l~~~~dl~~lg~~Ad~~R~~-~~Gd~Vtfv~nr~INyTNvC~~~C~FCaF~r~~   92 (371)
T PRK05926         14 SWLKTLFDKYLSGARLSEEDALQLLLLTDKEDQRALWSFADQVRKN-RVGDTVYYSSTLYLYPTNFCDFNCTFCSFYAKP   92 (371)
T ss_pred             HHHHHHHHHHHCCCCCCHHHHHHHHHCCCCCHHHHHHHHHHHHHHH-HCCCEEEEEEECCCCCCHHHHCCCCCCCCCCCC
T ss_conf             6899999999779999999999998348752599999999999997-569978996245865211342679247763689


Q ss_pred             CCCCCCCCCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCCCCHHHHHHHHHHHCCCCCCEEEEC-------------CC
Q ss_conf             77564100068579999999999649838997303688874428999998876213688324102-------------56
Q gi|254780485|r   79 KSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLGLETCMTL-------------GM  145 (328)
Q Consensus        79 ~~~~~~~~~~~~Eei~~~a~~~~~~G~~~~~l~~~~~~~~~~~~~~~~e~i~~i~~~~~~i~~~~-------------g~  145 (328)
                      +  .+..|.++.||+++++++ .+.|++++|+|+|.+  +..+++||.++++.+|+..|.++++.             |.
T Consensus        93 ~--~~~aY~ls~eei~~~v~e-~~~g~tEv~i~GG~h--P~l~~~yY~~l~~~ik~~~P~v~ihaft~~EI~~~a~~~~~  167 (371)
T PRK05926         93 G--DPKGWFYTPDQLIQSIQE-IKSPITETHIVAGCF--PSCNLAYYEELFSKIKENFPDIHIKALTAIEYAYLSKLDNL  167 (371)
T ss_pred             C--CCCCCCCCHHHHHHHHHH-HHCCCCEEEEECCCC--CCCCHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHCCC
T ss_conf             9--976523899999999999-875996899717889--89986999999999997589874144889999999998099


Q ss_pred             CCHHHHHHHHCCCCCEE-EEECCC-CHHHHHCCCC-CCCHHHHHHHHHHHHHCCCCCCCEEEECCCCCHHHHHHHHHHHH
Q ss_conf             99999998741576069-751343-7777320588-88989999999999987985577078668989999999999997
Q gi|254780485|r  146 LSFEQAQILSKAGLDYY-NHNIDT-SERFYPHVTT-THTFEDRLQTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLA  222 (328)
Q Consensus       146 ~~~~~~~~Lk~aG~~~~-~~~let-~~~~~~~~~~-~~~~~~~l~~~~~a~~~G~~~~sg~l~G~gEt~eeri~~l~~lr  222 (328)
                      ..++.+++||+||++++ .-.-|. +++...++|| |.+.++|+++++.||++|++++|||||||+||++||++||.+||
T Consensus       168 s~~EvL~~Lk~AGL~SlPGgGAEIl~d~VR~~I~p~K~~~~~Wlei~~~AH~lGi~t~ATMmyGHiEt~~~rv~HL~~lR  247 (371)
T PRK05926        168 PVREVLQTLKIAGLDSIPGGGAEILVDEIRETLAPGRLSSQDFLEIHKTAHSLGIPSNATMLCYHRETPEDIVTHMSKLR  247 (371)
T ss_pred             CHHHHHHHHHHHCCCCCCCCCHHHCCHHHHHHHCCCCCCHHHHHHHHHHHHHCCCCCCEEEECCCCCCHHHHHHHHHHHH
T ss_conf             99999999998387778887324347789997588989899999999999986997520465246699999999999999


Q ss_pred             HCCCCCCEEE-CCCEE-ECCCCCCCCC----CCCCHHHHHHHHHHHHHHCCCCCCEEEEHHHHHCHHHHHHHHHHCCC--
Q ss_conf             4088886020-54112-0487412445----68798999999999999686872142311565165689999980998--
Q gi|254780485|r  223 NLSTPPESIP-INLLI-PIPGSKFEEN----KKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGAN--  294 (328)
Q Consensus       223 ~l~~~~~~v~-~~~~~-p~~gt~l~~~----~~~~~~e~lr~iAi~RL~lP~~~i~i~~~~~~~~~~~~~~~L~~GaN--  294 (328)
                      +||+.|.+|. +-+|. ...+|+|...    ...+..+.+|++|||||||+| +.+||+||+++|.+++|++|.+|||  
T Consensus       248 ~lQdeTgGF~~FIpl~F~p~nt~l~~~~~~~~~~~~~~~lk~iAvsRL~Ldn-i~hIqasWv~~G~~~aq~aL~~GAnDl  326 (371)
T PRK05926        248 DLQDETLGFKNFILLKFASENNALGKRLRKMGQRHSIPPASIIAVARLFLDN-FSNIKALWNYLGIEVALHLLSCGANDL  326 (371)
T ss_pred             HHHHHCCCCEEEEECCCCCCCCCHHHHCCCCCCCCCHHHHHHHHHHHHHCCC-CCCEEEEHHHCCHHHHHHHHHCCCCCC
T ss_conf             9887529942997244247788220202688887740678999999997069-876785000025999999995699767


Q ss_pred             -EEEECCEEECCCC------CCHHHHHHHHHHCCCCCCCC
Q ss_conf             -8997786651588------89899999999829853247
Q gi|254780485|r  295 -SIFVGDTLLTAKN------PSYNKDTILFNRLGLIPDLS  327 (328)
Q Consensus       295 -~~~~g~~~~t~~g------~~~~~~~~~i~~~G~~P~~~  327 (328)
                       |||++|+++.++|      .+.++++++|+++|++|+.+
T Consensus       327 gGT~~eE~I~~aAGa~~~~~~~~~el~~lI~~aGr~P~~R  366 (371)
T PRK05926        327 SSTHMGEKVFQMASSKEPIKMDIEGMAALITQQGRIPCLT  366 (371)
T ss_pred             CCCCCCCEEEHHHCCCCCCCCCHHHHHHHHHHCCCCCCCC
T ss_conf             6553133464310279988789999999999849955605


No 11 
>PRK09234 fbiC FO synthase; Reviewed
Probab=100.00  E-value=0  Score=457.89  Aligned_cols=315  Identities=15%  Similarity=0.156  Sum_probs=256.4

Q ss_pred             HHHHCCCCCCCCHHHHHHHHCCCHH--HHHHHHHHHHHHHCCCCEEEEEEEEEEC-CCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             3420023447899999999739918--9999999998886289856999864530-786834232124335477756410
Q gi|254780485|r    9 EENPTKKPKVWTSKEVFQIYNMPFN--DLLFWSHTVHRKNFEPNHIQLSKLLNIK-TGGCPENCGYCNQSVHNKSKLKAS   85 (328)
Q Consensus         9 ~~~~~~~~e~ls~eea~~L~~~~~~--el~~~Aa~~~r~~~~g~~V~~~~~in~~-TN~C~~~C~fCaf~~~~~~~~~~~   85 (328)
                      .......++.||.+|++.||++...  +.+..+|+..|++.+|+.|||..|.||| ||+|..+|+||||++....  ...
T Consensus       481 l~~~~~~~~~L~e~ei~~Lf~Arg~d~~~v~~~AD~lR~~~~GD~VTyVvNRNINyTNVC~~~C~FCAF~r~~~~--~~a  558 (846)
T PRK09234        481 LRAAERDPAGLTDDEALALFTADGPALEAVCALADELRRDVVGDDVTYVVNRNINFTNICYTGCRFCAFAQRKGD--ADA  558 (846)
T ss_pred             HHHHHHCCCCCCHHHHHHHHHCCCHHHHHHHHHHHHHHHHHCCCEEEEEEECCCCHHHHHHCCCCCCCCCCCCCC--CCC
T ss_conf             999750766689899999985678669999999999999871884799840676388775517973514478899--876


Q ss_pred             CCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCCCCHHHHHHHHHHHCCCCCCEEEEC-------------CCCCHHHHH
Q ss_conf             0068579999999999649838997303688874428999998876213688324102-------------569999999
Q gi|254780485|r   86 KLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLGLETCMTL-------------GMLSFEQAQ  152 (328)
Q Consensus        86 ~~~~~Eei~~~a~~~~~~G~~~~~l~~~~~~~~~~~~~~~~e~i~~i~~~~~~i~~~~-------------g~~~~~~~~  152 (328)
                      |.++.|||.++++++.+.|++++|+|+|.+  +..+++||+++++.+|+..+.+|++.             |...++.+.
T Consensus       559 Y~ls~eeI~~r~~EA~~~GaTEV~iqGGih--P~l~~~~Y~di~r~iK~~~P~ihihAFSp~EI~~~A~~~g~s~~E~L~  636 (846)
T PRK09234        559 YSLSLDEVADRAWEAWVAGATEVCMQGGID--PELPGTGYADLVRAVKARVPSMHVHAFSPMEIANGATRSGLSIREWLT  636 (846)
T ss_pred             EECCHHHHHHHHHHHHHCCCEEEEECCCCC--CCCCHHHHHHHHHHHHHHCCCCEEECCCHHHHHHHHHHCCCCHHHHHH
T ss_conf             118999999999999976987998347879--899878999999999986898704508999999999982999999999


Q ss_pred             HHHCCCCCEE-EEECCC-CHHHHHCCCC-CCCHHHHHHHHHHHHHCCCCCCCEEEECCCCCHHHHHHHHHHHHHCCCCCC
Q ss_conf             8741576069-751343-7777320588-889899999999999879855770786689899999999999974088886
Q gi|254780485|r  153 ILSKAGLDYY-NHNIDT-SERFYPHVTT-THTFEDRLQTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPE  229 (328)
Q Consensus       153 ~Lk~aG~~~~-~~~let-~~~~~~~~~~-~~~~~~~l~~~~~a~~~G~~~~sg~l~G~gEt~eeri~~l~~lr~l~~~~~  229 (328)
                      +||+||++++ .-.-|. +++....+|| |.+.++|+++|+.||++|+++++||||||+|+.+||++||.+||+||+.|.
T Consensus       637 ~LkeAGL~SlPGggAEIL~d~VR~~Icp~K~~~~~Wlev~~~AH~lGl~TtATMmyGHvEt~e~rv~HL~~lR~lQdeTG  716 (846)
T PRK09234        637 ALREAGLDTIPGTAAEILDDEVRWVLTKGKLPTAEWIEVVTTAHEVGLRSSSTMMYGHVDTPRHWVAHLRVLRDIQDRTG  716 (846)
T ss_pred             HHHHCCCCCCCCCCCHHCCHHHHHHHCCCCCCHHHHHHHHHHHHHCCCCCCCEEECCCCCCHHHHHHHHHHHHHHHHHHC
T ss_conf             99980977799974132587999976888888999999999999859975212435677999999999999999998759


Q ss_pred             EEECC-CEE-ECCCCCCC----CCCCCCHHHHHHHHHHHHHHCCCCCCEEEEHHHHHCHHHHHHHHHHCCC---EEEECC
Q ss_conf             02054-112-04874124----4568798999999999999686872142311565165689999980998---899778
Q gi|254780485|r  230 SIPIN-LLI-PIPGSKFE----ENKKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGAN---SIFVGD  300 (328)
Q Consensus       230 ~v~~~-~~~-p~~gt~l~----~~~~~~~~e~lr~iAi~RL~lP~~~i~i~~~~~~~~~~~~~~~L~~GaN---~~~~g~  300 (328)
                      +|.-+ +|. .+.+||+.    ..+.++..|+++++||+||||-+.+.+||+||+++|.++.|++|.+|||   |||++|
T Consensus       717 GFteFIPL~F~~~~tpl~~~g~~r~gpT~~e~l~~~AvsRL~L~dnI~nIQasWVklG~~~aq~aL~~GaNDlGGTlmeE  796 (846)
T PRK09234        717 GFTEFVPLPFVHQSAPLYLAGAARPGPTHRDNRAVHALARILLHGRIDNIQTSWVKLGVEGTRVMLRGGANDLGGTLMEE  796 (846)
T ss_pred             CEEEEEECCCCCCCCCHHHCCCCCCCCCHHHHHHHHHHHHHHHHCCCCCEECCCHHCCHHHHHHHHHCCCCCCCCCCEEE
T ss_conf             95599746756788803322688789988999999999999722688672615001679999999965997775561111


Q ss_pred             EEECCCC------CCHHHHHHHHHHCCCCCCCC
Q ss_conf             6651588------89899999999829853247
Q gi|254780485|r  301 TLLTAKN------PSYNKDTILFNRLGLIPDLS  327 (328)
Q Consensus       301 ~~~t~~g------~~~~~~~~~i~~~G~~P~~~  327 (328)
                      +++.++|      .++++++++|+++|++|+.+
T Consensus       797 ~I~~aAGa~~g~~~t~~el~~lI~~aGr~P~qR  829 (846)
T PRK09234        797 TISRMAGSEHGSAKTVAELEAIAEGAGRPARQR  829 (846)
T ss_pred             EEECCCCCCCCCCCCHHHHHHHHHHCCCCCCCC
T ss_conf             331112689887799999999999859983025


No 12 
>TIGR00423 TIGR00423 conserved hypothetical protein TIGR00423; InterPro: IPR005244    This entry describes a family of conserved hypothetical proteins with no known function. .
Probab=100.00  E-value=0  Score=461.85  Aligned_cols=272  Identities=19%  Similarity=0.333  Sum_probs=229.4

Q ss_pred             EEEEEEEEEC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCCCCH-----HHH
Q ss_conf             6999864530-7868342321243354777564100068579999999999649838997303688874428-----999
Q gi|254780485|r   52 IQLSKLLNIK-TGGCPENCGYCNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDL-----SII  125 (328)
Q Consensus        52 V~~~~~in~~-TN~C~~~C~fCaf~~~~~~~~~~~~~~~~Eei~~~a~~~~~~G~~~~~l~~~~~~~~~~~~-----~~~  125 (328)
                      |||..|.||| ||+|..+|+||||+++.+.  +..|+||.|||+++++++.+.|++++|||+|.+|.  .++     +||
T Consensus         1 VtfvVNRNINfTNIC~~~C~FCAF~~~~k~--~~~Y~Ls~eEI~~Kv~ea~~~G~tE~~iQGGlnP~--~~~nGssl~yy   76 (331)
T TIGR00423         1 VTFVVNRNINFTNICVGKCKFCAFRRREKD--KDAYVLSLEEILRKVKEAVAKGATEICIQGGLNPQ--LDINGSSLEYY   76 (331)
T ss_pred             CEEECCCCCCCCHHHHHCCCCCCCCCCCCC--CCCCCCCHHHHHHHHHHHHHCCCEEEEEECCCCCC--CCCCCCHHHHH
T ss_conf             935316656753002324796331134689--88814077999999999997198278852342788--76454149999


Q ss_pred             HHHHHHHCCCCC---CEEEEC-------------CCCC-HHHHHHHHCCCCCEE-EEECCC-CHHHHHCCCC-CCCHHHH
Q ss_conf             998876213688---324102-------------5699-999998741576069-751343-7777320588-8898999
Q gi|254780485|r  126 VDMIKGVKSLGL---ETCMTL-------------GMLS-FEQAQILSKAGLDYY-NHNIDT-SERFYPHVTT-THTFEDR  185 (328)
Q Consensus       126 ~e~i~~i~~~~~---~i~~~~-------------g~~~-~~~~~~Lk~aG~~~~-~~~let-~~~~~~~~~~-~~~~~~~  185 (328)
                      +++++.||...+   .||++.             +..- +|.+++||++|++++ .-.-|. +.+.++++|| |.+.++|
T Consensus        77 ~~l~~~Ik~~~pPyG~~hiHafSp~Ev~f~A~~~~~~~e~EvL~~LK~aGL~SmPGtgAEILdD~vRr~IcP~K~~s~eW  156 (331)
T TIGR00423        77 EELFRAIKQEFPPYGDVHIHAFSPMEVYFLAKNEGLSIEKEVLKRLKKAGLDSMPGTGAEILDDSVRRKICPNKLSSDEW  156 (331)
T ss_pred             HHHHHHHHHCCCCCCCEEEECCCHHHHHHHHHHCCCCHHHHHHHHHHHHCCCCCCCCCEEECCHHHHHHHCCCCCCHHHH
T ss_conf             99999997417896524761468689999998618978899999988850356777622653033587547798872789


Q ss_pred             HHHHHHHHHCCCCCCCEEEECCCCCHHHHHHHHHHHHHC------CCCCCEEE--CCCEEECCCCC--CCC--CCCCCHH
Q ss_conf             999999998798557707866898999999999999740------88886020--54112048741--244--5687989
Q gi|254780485|r  186 LQTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANL------STPPESIP--INLLIPIPGSK--FEE--NKKVDPI  253 (328)
Q Consensus       186 l~~~~~a~~~G~~~~sg~l~G~gEt~eeri~~l~~lr~l------~~~~~~v~--~~~~~p~~gt~--l~~--~~~~~~~  253 (328)
                      |++|+.||++|++|||||||||+|+++|||+||.+||++      |..|.+|.  +|.....++||  +..  .+.+|+.
T Consensus       157 lev~~~AH~~GiptTATMMfGHve~~~h~v~HL~rir~iQ~~~~~QekTGGFteFIPL~F~~~n~P~~~~~~~~~~~s~~  236 (331)
T TIGR00423       157 LEVIKTAHRLGIPTTATMMFGHVEEPEHRVEHLLRIRKIQSTSLVQEKTGGFTEFIPLPFQPENAPIYLEGEVRKGASGI  236 (331)
T ss_pred             HHHHHHHHHCCCCCCCHHCCCCCCCHHHHHHHHHHHHHHCCCCHHHHHHCCEEEECCCCCCCCCCCCCCCCCCCCCCCHH
T ss_conf             99999998666962101123552767889999999987517002335227732101467788877711140023788868


Q ss_pred             HHHHHHHHHHHHCC-CCCCEEEEHHHHHCHHHHHHHHHHCCC---EEEECCEEECCCCC------CHHHHHHHHHHCCCC
Q ss_conf             99999999999686-872142311565165689999980998---89977866515888------989999999982985
Q gi|254780485|r  254 EHVRIISVARILMP-KSRLRLAAGRAMMSDELQALCFFSGAN---SIFVGDTLLTAKNP------SYNKDTILFNRLGLI  323 (328)
Q Consensus       254 e~lr~iAi~RL~lP-~~~i~i~~~~~~~~~~~~~~~L~~GaN---~~~~g~~~~t~~g~------~~~~~~~~i~~~G~~  323 (328)
                      ++||++|||||+|. +.+-+||+||+++|.++.|+||.+|||   |||++|++++++|+      ++++++++|+++|+.
T Consensus       237 ~~Lk~~AiSRI~L~gk~I~NIqASWV~lG~~~a~vAL~~GANDlGGTl~EE~i~~aAGA~~~~~~~~E~l~~~ik~~G~~  316 (331)
T TIGR00423       237 DDLKVIAISRILLNGKNIKNIQASWVKLGLKLAQVALEFGANDLGGTLMEENISKAAGAKTGVGLEVEELIELIKDAGRV  316 (331)
T ss_pred             HHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCCCEEEEEECCCCCCCCCCCCCCHHHHHHHHHHHCCC
T ss_conf             99999999998828841223250688854789999998177436875786532110278888867889999999984885


Q ss_pred             CCCC
Q ss_conf             3247
Q gi|254780485|r  324 PDLS  327 (328)
Q Consensus       324 P~~~  327 (328)
                      |+.+
T Consensus       317 ~~~R  320 (331)
T TIGR00423       317 PAQR  320 (331)
T ss_pred             CCCC
T ss_conf             3101


No 13 
>TIGR03551 F420_cofH 7,8-didemethyl-8-hydroxy-5-deazariboflavin synthase, CofH subunit. This enzyme, together with CofG, complete the biosynthesis of 7,8-didemethyl-8-hydroxy-5-deazariboflavin synthase, the chromophore of coenzyme F420. The chromophore is also used in cyanobacteria DNA photolyases.
Probab=100.00  E-value=0  Score=453.76  Aligned_cols=303  Identities=17%  Similarity=0.273  Sum_probs=255.3

Q ss_pred             CCHHHHHHHHCC--CHHHHHHHHHHHHHHHCCCCEEEEEEEEEEC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHH
Q ss_conf             899999999739--9189999999998886289856999864530-7868342321243354777564100068579999
Q gi|254780485|r   19 WTSKEVFQIYNM--PFNDLLFWSHTVHRKNFEPNHIQLSKLLNIK-TGGCPENCGYCNQSVHNKSKLKASKLINVDQVLK   95 (328)
Q Consensus        19 ls~eea~~L~~~--~~~el~~~Aa~~~r~~~~g~~V~~~~~in~~-TN~C~~~C~fCaf~~~~~~~~~~~~~~~~Eei~~   95 (328)
                      ||++||+.||+.  |+.+|+..|+.+|+ +.+|++|+|+.++|+| ||+|+++|+||+|++.++ . ...+.+++|||++
T Consensus         1 ls~eeal~L~~~~~dl~~L~~~A~~vR~-~~~G~~Vtf~~n~~In~TNiC~~~C~fCaF~r~p~-~-~~ay~lt~eei~~   77 (343)
T TIGR03551         1 ITKEEALELFEARGNLFELFRLADELRR-DIVGDTVTYVVNRNINFTNVCYGGCGFCAFRKRKG-D-ADAYLLSLEEIAE   77 (343)
T ss_pred             CCHHHHHHHHHCCCCHHHHHHHHHHHHH-HHCCCEEEEECCCCCCHHHHHHCCCCCCCCCCCCC-C-CCCCCCCHHHHHH
T ss_conf             9889999997159999999999999999-87799489965006255268747897677866899-9-8660079999999


Q ss_pred             HHHHHHHCCCEEEEEECCCCCCCCCCHHHHHHHHHHHCCCCCCEEEE-------------CCCCCHHHHHHHHCCCCCEE
Q ss_conf             99999964983899730368887442899999887621368832410-------------25699999998741576069
Q gi|254780485|r   96 EAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLGLETCMT-------------LGMLSFEQAQILSKAGLDYY  162 (328)
Q Consensus        96 ~a~~~~~~G~~~~~l~~~~~~~~~~~~~~~~e~i~~i~~~~~~i~~~-------------~g~~~~~~~~~Lk~aG~~~~  162 (328)
                      .++++.+.|++++++++|.+  +...++||.++++.+|+..+.++++             .|.+.++.+++|++||++++
T Consensus        78 ~~~~a~~~G~~Ei~~~gG~~--Pel~~~~y~e~~r~ik~~~p~~~i~a~s~~Ei~~~a~~~g~~~~e~l~~Lk~AGl~s~  155 (343)
T TIGR03551        78 RAAEAWKAGATEVCIQGGIH--PDLDGDFYLDILRAVKEEVPGMHIHAFSPMEVYYGARNSGLSVEEALKRLKEAGLDSM  155 (343)
T ss_pred             HHHHHHHCCCCEEEEECCCC--CCCCHHHHHHHHHHHHHHCCCCEEEECCHHHHHHHHHHCCCCHHHHHHHHHHCCCCCC
T ss_conf             99999976996899825868--7888889999999998748830102278999999998659999999999997587767


Q ss_pred             E-EECCC-CHHHHHCCCCC-CCHHHHHHHHHHHHHCCCCCCCEEEECCCCCHHHHHHHHHHHHHCCCCCCEEE-C--CCE
Q ss_conf             7-51343-77773205888-89899999999999879855770786689899999999999974088886020-5--411
Q gi|254780485|r  163 N-HNIDT-SERFYPHVTTT-HTFEDRLQTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIP-I--NLL  236 (328)
Q Consensus       163 ~-~~let-~~~~~~~~~~~-~~~~~~l~~~~~a~~~G~~~~sg~l~G~gEt~eeri~~l~~lr~l~~~~~~v~-~--~~~  236 (328)
                      . ...|. +++.++.+||+ .+.++|+++++.||++|+++|||||||||||++||++||..||++|+.+.+|. +  .+|
T Consensus       156 pg~~aEil~~~vr~~i~P~K~~~~~wl~~~~~Ah~lGi~ttatml~G~gEt~eerv~hL~~lR~lqd~tggf~~fIp~~f  235 (343)
T TIGR03551       156 PGTAAEILDDEVRKVICPDKLSTAEWIEIIKTAHKLGIPTTATIMYGHVETPEHWVDHLLILREIQEETGGFTEFVPLPF  235 (343)
T ss_pred             CCCCHHHCCHHHHHCCCCCCCCHHHHHHHHHHHHHCCCCCCCCEEECCCCCHHHHHHHHHHHHHHHHHCCCEEEEEECCC
T ss_conf             88651321401241469698999999999999998599720223427889999999999999986201388269981365


Q ss_pred             EECCCCCCCC----CCCCCHHHHHHHHHHHHHHCCCCCCEEEEHHHHHCHHHHHHHHHHCCC---EEEECCEEECCCC--
Q ss_conf             2048741244----568798999999999999686872142311565165689999980998---8997786651588--
Q gi|254780485|r  237 IPIPGSKFEE----NKKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGAN---SIFVGDTLLTAKN--  307 (328)
Q Consensus       237 ~p~~gt~l~~----~~~~~~~e~lr~iAi~RL~lP~~~i~i~~~~~~~~~~~~~~~L~~GaN---~~~~g~~~~t~~g--  307 (328)
                      . .++||+..    .+.+++.|+||++|+|||+||+.+.+||++|+++|++..|++|.+|||   |||++|+++.++|  
T Consensus       236 ~-p~~t~l~~~~~~~~~~~~~e~l~~iAvaRl~l~~~i~~Iqa~w~~lg~~~~q~~L~~GanD~gGt~~~e~i~~~ag~~  314 (343)
T TIGR03551       236 V-HYNAPLYLKGMARPGPTGREDLKVHAIARILLHGLIDNIQASWVKLGKKLAQVALRCGANDLGGTLMEESISRAAGAS  314 (343)
T ss_pred             C-CCCCCHHHHCCCCCCCCHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCCCCCCHHHCCC
T ss_conf             6-678804441566789857999999999999704776542226625598999999957984676666777563621579


Q ss_pred             ----CCHHHHHHHHHHCCCCCCCC
Q ss_conf             ----89899999999829853247
Q gi|254780485|r  308 ----PSYNKDTILFNRLGLIPDLS  327 (328)
Q Consensus       308 ----~~~~~~~~~i~~~G~~P~~~  327 (328)
                          .+.++..++|+++|++|+.+
T Consensus       315 ~~~~~~~~~l~~~i~~aG~~p~eR  338 (343)
T TIGR03551       315 HGEYLSPEELEAIIEDAGRIPKQR  338 (343)
T ss_pred             CCCCCCHHHHHHHHHHCCCCCCCC
T ss_conf             988899999999999859980125


No 14 
>COG1060 ThiH Thiamine biosynthesis enzyme ThiH and related uncharacterized enzymes [Coenzyme metabolism / General function prediction only]
Probab=100.00  E-value=0  Score=419.07  Aligned_cols=321  Identities=19%  Similarity=0.200  Sum_probs=267.4

Q ss_pred             CHHHHHHHHHHCCCCCCCCHHHHHHHHCCC-HHHHHHHHHHHHHHHCCCCEEEEEEEEEEC-CCCCCCCCCCCCCCCCCC
Q ss_conf             855732134200234478999999997399-189999999998886289856999864530-786834232124335477
Q gi|254780485|r    2 SRSTVVPEENPTKKPKVWTSKEVFQIYNMP-FNDLLFWSHTVHRKNFEPNHIQLSKLLNIK-TGGCPENCGYCNQSVHNK   79 (328)
Q Consensus         2 ~~~~~~~~~~~~~~~e~ls~eea~~L~~~~-~~el~~~Aa~~~r~~~~g~~V~~~~~in~~-TN~C~~~C~fCaf~~~~~   79 (328)
                      .+. +-+..+++..+++||.+|++.||+.. ..+|...|+..++++..|+.|+|..++|+| ||+|.++|.||+|+++++
T Consensus         5 ~~~-~~~~~e~a~~~~~l~~~d~~~Ll~~~~~~~l~~~A~~~r~~~~~~~~vtyv~n~~in~TN~C~~~C~fCaF~~~~~   83 (370)
T COG1060           5 ARD-VDEIVEKALNGERLTREDALALLSPADLEELEELADKARRRKRVGDGVTYVVNRNINYTNICVNDCTFCAFYRKPG   83 (370)
T ss_pred             HHH-HHHHHHHHHCCCCCCHHHHHHHHCCCCHHHHHHHHHHHHHHHCCCCCEEEEEEECCCCCHHHCCCCCCCCCCCCCC
T ss_conf             667-8999998752577898999988545868999999999887423688579997525785323317997262345788


Q ss_pred             CCCCCCCCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCCCCHHHHHHHHHHHCCCCCCEEEEC-------------CCC
Q ss_conf             7564100068579999999999649838997303688874428999998876213688324102-------------569
Q gi|254780485|r   80 SKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLGLETCMTL-------------GML  146 (328)
Q Consensus        80 ~~~~~~~~~~~Eei~~~a~~~~~~G~~~~~l~~~~~~~~~~~~~~~~e~i~~i~~~~~~i~~~~-------------g~~  146 (328)
                      .  ++.+++++|||.++++++++.|++++++|+|.++  ...++||.++++.||+..+.+|++.             +..
T Consensus        84 ~--~~~y~Ls~eeI~~~~~~~~~~G~~Evli~gG~~p--~~~~~y~~~~~~~ik~~~p~~~i~a~s~~ei~~~~~~~~~s  159 (370)
T COG1060          84 D--PKAYTLSPEEILEEVREAVKRGITEVLIVGGEHP--ELSLEYYEELFRTIKEEFPDLHIHALSAGEILFLAREGGLS  159 (370)
T ss_pred             C--CCCCCCCHHHHHHHHHHHHHCCCEEEEEECCCCC--CCCHHHHHHHHHHHHHHCCCHHHCCCCHHHHHHHHHCCCCC
T ss_conf             8--6553169999999999998759869998057687--74367999999999885730343016788867987436888


Q ss_pred             CHHHHHHHHCCCCCEEEEECCC-C-HHHHHC-CCCCCCHHHHHHHHHHHHHCCCCCCCEEEECCCCCHHHHHHHHHHHHH
Q ss_conf             9999998741576069751343-7-777320-588889899999999999879855770786689899999999999974
Q gi|254780485|r  147 SFEQAQILSKAGLDYYNHNIDT-S-ERFYPH-VTTTHTFEDRLQTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLAN  223 (328)
Q Consensus       147 ~~~~~~~Lk~aG~~~~~~~let-~-~~~~~~-~~~~~~~~~~l~~~~~a~~~G~~~~sg~l~G~gEt~eeri~~l~~lr~  223 (328)
                      .+|.|++||+||+|.+-....+ . ++.... .++|.++++||++++.||++||++++||||||+|+++||++||.+||+
T Consensus       160 ~~E~l~~Lk~aGldsmpg~~aeil~e~vr~~~~p~K~~~~~wle~~~~Ah~lGI~~tatml~Gh~E~~ed~~~hl~~ir~  239 (370)
T COG1060         160 YEEVLKRLKEAGLDSMPGGGAEILSEEVRKIHCPPKKSPEEWLEIHERAHRLGIPTTATMLLGHVETREDRIDHLEHIRD  239 (370)
T ss_pred             HHHHHHHHHHCCCCCCCCCCEEECHHHHHHHHCCCCCCHHHHHHHHHHHHHCCCCCCCEEEEEECCCHHHHHHHHHHHHH
T ss_conf             99999999976987674754114167799863798899999999999999769984203478732888999999999999


Q ss_pred             CCCCCCE---EECCCEEECCCC-CCCCCCCCCHHHHHHHHHHHHHHCCCCCCEEEEHHHHHCHHHHHHHHHHCCC---EE
Q ss_conf             0888860---205411204874-1244568798999999999999686872142311565165689999980998---89
Q gi|254780485|r  224 LSTPPES---IPINLLIPIPGS-KFEENKKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGAN---SI  296 (328)
Q Consensus       224 l~~~~~~---v~~~~~~p~~gt-~l~~~~~~~~~e~lr~iAi~RL~lP~~~i~i~~~~~~~~~~~~~~~L~~GaN---~~  296 (328)
                      ||+.+.+   |...+|.|.+++ ++...+.+++.++++++|+|||+|++..-+++++|.+.|....+.+|.+|||   |+
T Consensus       240 lQ~~~gg~~~fI~~~f~p~~~~~~~~~~~~~~~~~~l~~iAiaRi~l~~~i~~~~a~w~~~g~~~~~~~l~~GanD~ggt  319 (370)
T COG1060         240 LQDETGGFQEFIPLRFRPENGPLPAEVVPEASLEQDLKAIALARIFLDNNISNIQASWLRDGVILAQAALLSGANDLGGT  319 (370)
T ss_pred             HHHHHCCCEEEECCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCHHHHHHHHHHCCCCCCCC
T ss_conf             99985895799805545788876666789899899999999999970676542417441036699999998286167677


Q ss_pred             EECCEEECCCC------CCHHHHHHHHHHCCCCCCCC
Q ss_conf             97786651588------89899999999829853247
Q gi|254780485|r  297 FVGDTLLTAKN------PSYNKDTILFNRLGLIPDLS  327 (328)
Q Consensus       297 ~~g~~~~t~~g------~~~~~~~~~i~~~G~~P~~~  327 (328)
                      +.+|++....|      ++++++.++|+++|++|+++
T Consensus       320 ~~~E~v~~~a~~~~~~~~~~eel~~~i~~aG~~p~~R  356 (370)
T COG1060         320 GYEEKVNPAAGAFSGDWRSVEELAALIKEAGRIPVER  356 (370)
T ss_pred             CCCCCCCCCCCCCCCCCCCHHHHHHHHHHCCCCEEEE
T ss_conf             7553436555555678999999999999849970221


No 15 
>KOG2900 consensus
Probab=100.00  E-value=0  Score=416.84  Aligned_cols=310  Identities=51%  Similarity=0.874  Sum_probs=298.3

Q ss_pred             CCCHHHHHHHHCCCHHHHHHHHHHHHHHHCCCCEEEEEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHH
Q ss_conf             78999999997399189999999998886289856999864530786834232124335477756410006857999999
Q gi|254780485|r   18 VWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQSVHNKSKLKASKLINVDQVLKEA   97 (328)
Q Consensus        18 ~ls~eea~~L~~~~~~el~~~Aa~~~r~~~~g~~V~~~~~in~~TN~C~~~C~fCaf~~~~~~~~~~~~~~~~Eei~~~a   97 (328)
                      .||++|+..+|+.|+.||.+.|+.+.|+-+...+|..|..++|+|+.|.++|+||+||.++.++.+..+++..|+++++|
T Consensus        47 ~Wtr~eik~iYdtPLldL~f~aa~~HRk~Hdp~kVQqCTLlsIKtGGCsEDCkYCaQSSRy~TGvKA~klmk~DeVi~~A  126 (380)
T KOG2900          47 SWTRSEIKEIYDTPLLDLTFAAALQHRKWHDPTKVQQCTLLSIKTGGCSEDCKYCAQSSRYDTGVKAEKLMKVDEVIKEA  126 (380)
T ss_pred             CCCHHHHHHHHCCHHHHHHHHHHHHHHHHCCCCCEEEEEEEEEECCCCCCCCCHHHHHCCCCCCHHHHHHHHHHHHHHHH
T ss_conf             44499999873455899999999877630782130145788750588651221101003465440278774099999999


Q ss_pred             HHHHHCCCEEEEEECCCCCCCC--CCHHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHCCCCCEEEEECCCCHHHHHC
Q ss_conf             9999649838997303688874--42899999887621368832410256999999987415760697513437777320
Q gi|254780485|r   98 KNAKENGATRYCMGAAWREPKE--RDLSIIVDMIKGVKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPH  175 (328)
Q Consensus        98 ~~~~~~G~~~~~l~~~~~~~~~--~~~~~~~e~i~~i~~~~~~i~~~~g~~~~~~~~~Lk~aG~~~~~~~let~~~~~~~  175 (328)
                      ++++..|-++||++..|++...  ..+..++|+|+.++..++++|+.+|.+++++.+.||+||+..|++|+||++++|++
T Consensus       127 k~AK~~GSTRFCmGaAWRD~~GRk~~fk~IlE~ikevr~MgmEvCvTLGMv~~qQAkeLKdAGLTAYNHNlDTSREyYsk  206 (380)
T KOG2900         127 KEAKRNGSTRFCMGAAWRDMKGRKSAFKRILEMIKEVRDMGMEVCVTLGMVDQQQAKELKDAGLTAYNHNLDTSREYYSK  206 (380)
T ss_pred             HHHHHCCCCEEECCHHHHHHCCCHHHHHHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHCCCEECCCCCCCHHHHHCC
T ss_conf             99886388614311565531141458999999999987288100443144138889988854643003676424666400


Q ss_pred             CCCCCCHHHHHHHHHHHHHCCCCCCCEEEECCCCCHHHHHHHHHHHHHCCCCCCEEECCCEEECCCCCCCC--CCCCCHH
Q ss_conf             58888989999999999987985577078668989999999999997408888602054112048741244--5687989
Q gi|254780485|r  176 VTTTHTFEDRLQTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEE--NKKVDPI  253 (328)
Q Consensus       176 ~~~~~~~~~~l~~~~~a~~~G~~~~sg~l~G~gEt~eeri~~l~~lr~l~~~~~~v~~~~~~p~~gt~l~~--~~~~~~~  253 (328)
                      +.++.+|++||++++..+++|+++|+|.|+|+||..+||+..+..|..+..+|++||+|.+++++|||+++  ..+...+
T Consensus       207 vItTRtYDdRL~Ti~nvr~aGikvCsGGIlGLGE~e~DriGlihtLatmp~HPESvPiN~LvaikGTP~~d~~~k~l~i~  286 (380)
T KOG2900         207 VITTRTYDDRLQTIKNVREAGIKVCSGGILGLGESEDDRIGLIHTLATMPPHPESVPINRLVAIKGTPMADEKSKKLQID  286 (380)
T ss_pred             CCEECCHHHHHHHHHHHHHHCCEECCCCCCCCCCCCCCEEEEEEEECCCCCCCCCCCCCEEEECCCCCCCHHHCCCCCHH
T ss_conf             12302267788888889872633314653204665556034443101489997666511477438864203213666388


Q ss_pred             HHHHHHHHHHHHCCCCCCEEEEHHHHHCHHHHHHHHHHCCCEEEECCEEECCCCCCHHHHHHHHHHCCCCCCCC
Q ss_conf             99999999999686872142311565165689999980998899778665158889899999999829853247
Q gi|254780485|r  254 EHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTILFNRLGLIPDLS  327 (328)
Q Consensus       254 e~lr~iAi~RL~lP~~~i~i~~~~~~~~~~~~~~~L~~GaN~~~~g~~~~t~~g~~~~~~~~~i~~~G~~P~~~  327 (328)
                      |+||+||.+||+||++.|++++||.++...-|-+++.+|||+|++|++++|+.+.+.++|..|....|++|-.+
T Consensus       287 e~lR~IaTARIvMPKaiiRlaAGR~t~sesEQalcFmAGaNsiFTGeKmLTTp~n~wD~D~~mf~~wGL~pm~~  360 (380)
T KOG2900         287 EILRTIATARIVMPKAIIRLAAGRYTMSESEQALCFMAGANSIFTGEKMLTTPCNGWDEDKAMFAKWGLQPMEA  360 (380)
T ss_pred             HHHHHHHHHHEECHHHHHHHHCCCCCCCHHHHHHHHHHCCCCCEECHHHHCCCCCCCCHHHHHHHHCCCCCCCC
T ss_conf             99998756331153889988515550031588899980775112041343477788444789999808876764


No 16 
>TIGR03550 F420_cofG 7,8-didemethyl-8-hydroxy-5-deazariboflavin synthase, CofG subunit. This model represents either a subunit or a domain, depending on whether or not the genes are fused, of a bifunctional protein that completes the synthesis of 7,8-didemethyl-8-hydroxy-5-deazariboflavin, or FO. FO is the chromophore of coenzyme F(420), involved in methanogenesis in methanogenic archaea but found in certain other lineages as well. The chromophore also occurs as a cofactor in DNA photolyases in Cyanobacteria.
Probab=100.00  E-value=0  Score=383.21  Aligned_cols=266  Identities=20%  Similarity=0.284  Sum_probs=213.7

Q ss_pred             EEEEEEEEC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCCCCHHHHHHHHHH
Q ss_conf             999864530-7868342321243354777564100068579999999999649838997303688874428999998876
Q gi|254780485|r   53 QLSKLLNIK-TGGCPENCGYCNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKG  131 (328)
Q Consensus        53 ~~~~~in~~-TN~C~~~C~fCaf~~~~~~~~~~~~~~~~Eei~~~a~~~~~~G~~~~~l~~~~~~~~~~~~~~~~e~i~~  131 (328)
                      ||+.|+|+| ||+|+.+|+||||++.++.  ...++++.|||++.++++.+.|++++|+|+|.++.  ..++++.+.++.
T Consensus         1 Ty~~N~~In~TNiC~~~C~FCaF~r~~~~--~~ay~ls~eei~~~~~ea~~~G~tEv~i~gG~~P~--~~~~~~~~~l~~   76 (322)
T TIGR03550         1 TYSRNVFIPLTRLCRNRCGYCTFRRPPGE--LEAALLSPEEVLEILRKGAAAGCTEALFTFGEKPE--ERYPEAREWLAE   76 (322)
T ss_pred             CCCCCCCCCCCCCHHCCCCCCCCCCCCCC--CCCCCCCHHHHHHHHHHHHHCCCEEEEECCCCCHH--HHHHHHHHHHHH
T ss_conf             99872156887203176967885168999--88774799999999999997798799964886800--349999999998


Q ss_pred             H-----------------CCCCCCEEEECCCCCHHHHHHHHC--CCCCEEEEECCC-CHH----HHHCCCCCCCHHHHHH
Q ss_conf             2-----------------136883241025699999998741--576069751343-777----7320588889899999
Q gi|254780485|r  132 V-----------------KSLGLETCMTLGMLSFEQAQILSK--AGLDYYNHNIDT-SER----FYPHVTTTHTFEDRLQ  187 (328)
Q Consensus       132 i-----------------~~~~~~i~~~~g~~~~~~~~~Lk~--aG~~~~~~~let-~~~----~~~~~~~~~~~~~~l~  187 (328)
                      +                 .+.+...+++.|.++.+++++|++  +|++.   .+|+ ++.    ....+||++.+++||+
T Consensus        77 ~~~~~~~~~~~~~~~~~~~~~~~~p~~~~g~~t~eel~~Lk~~~aglg~---~~e~~ae~l~~~vr~~~~P~K~~~~~l~  153 (322)
T TIGR03550        77 MGYDSTLEYLRELCELALEETGLLPHTNPGVMSRDELARLKPVNASMGL---MLETTSERLCKGEAHYGSPGKDPAVRLE  153 (322)
T ss_pred             HCCCHHHHHHHHHHHHHHHHHCCCCCCCCCCCCHHHHHHHHHCCCCHHH---HHHHHHHHHCCCCCCCCCCCCCHHHHHH
T ss_conf             4886178999999999998633565447676889999987631862666---7888887532223567799988799999


Q ss_pred             HHHHHHHCCCCCCCEEEECCCCCHHHHHHHHHHHHHCCCCCCEE---ECCCEEECCCCCCCCCCCCCHHHHHHHHHHHHH
Q ss_conf             99999987985577078668989999999999997408888602---054112048741244568798999999999999
Q gi|254780485|r  188 TLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESI---PINLLIPIPGSKFEENKKVDPIEHVRIISVARI  264 (328)
Q Consensus       188 ~~~~a~~~G~~~~sg~l~G~gEt~eeri~~l~~lr~l~~~~~~v---~~~~~~p~~gt~l~~~~~~~~~e~lr~iAi~RL  264 (328)
                      +++.||++|+++++||||||+||.+||++||..||+||+.|++|   ...+|.|.++|++...+.++..|+||++|+|||
T Consensus       154 i~~~Ah~lGi~ttaTml~GhiEt~eeri~HL~~lR~lQdetggf~efIp~~F~p~~~~~~~~~~~~s~~e~Lr~iAvaRl  233 (322)
T TIGR03550       154 TIEDAGRLKIPFTTGILIGIGETREERAESLLAIRELHERYGHIQEVIVQNFRAKPGTPMENHPEPSLEEMLRTVAVARL  233 (322)
T ss_pred             HHHHHHHCCCCEEEEEEEECCCCHHHHHHHHHHHHHHHHHCCCEEEEEECCCCCCCCCCCCCCCCCCHHHHHHHHHHHHH
T ss_conf             99999985996151234204699999999999999878652965799626766899864556999899999999999999


Q ss_pred             HCCCCCCEEEEHHHHHCHHHHHHHHHHCCC---EE--EECCEEECCC-CCCHHHHHHHHHHCCCCCCCC
Q ss_conf             686872142311565165689999980998---89--9778665158-889899999999829853247
Q gi|254780485|r  265 LMPKSRLRLAAGRAMMSDELQALCFFSGAN---SI--FVGDTLLTAK-NPSYNKDTILFNRLGLIPDLS  327 (328)
Q Consensus       265 ~lP~~~i~i~~~~~~~~~~~~~~~L~~GaN---~~--~~g~~~~t~~-g~~~~~~~~~i~~~G~~P~~~  327 (328)
                      +|||. ++||++ +++|.+..|++|.+|||   ||  ++.+++...+ -++++++.++|+++||+|+.+
T Consensus       234 ~Ldn~-~~Iqa~-~~lg~~~~q~aL~~GanDlGG~~~~~~~~v~~~~~~~~~~el~~~i~~aG~~p~eR  300 (322)
T TIGR03550       234 ILPPD-ISIQVP-PNLNREDYRLLLDAGIDDWGGVSPVTPDHVNPEAPWPEIDELARATEEAGFTLKER  300 (322)
T ss_pred             HCCCC-CEEEEC-CCCCHHHHHHHHHCCCCCCCCCCCCCHHHCCCCCCCCCHHHHHHHHHHCCCCCCCC
T ss_conf             75999-728608-85675899999967997788877142754488899999999999999849986652


No 17 
>PRK06245 cofG FO synthase subunit 1; Reviewed
Probab=100.00  E-value=0  Score=366.60  Aligned_cols=272  Identities=22%  Similarity=0.300  Sum_probs=221.3

Q ss_pred             HCCCCEEEEEEEEEEC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCCCCHHH
Q ss_conf             6289856999864530-786834232124335477756410006857999999999964983899730368887442899
Q gi|254780485|r   46 NFEPNHIQLSKLLNIK-TGGCPENCGYCNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSI  124 (328)
Q Consensus        46 ~~~g~~V~~~~~in~~-TN~C~~~C~fCaf~~~~~~~~~~~~~~~~Eei~~~a~~~~~~G~~~~~l~~~~~~~~~~~~~~  124 (328)
                      ..+|+.|||+.++|+| ||+|+++|+||+|++..+   . .++++.|||++.++++++.|++++|+++|.+++.  .+++
T Consensus         2 ~~~G~~VTy~~n~~In~TNiC~~~C~fCaF~~~~~---~-a~~ls~eev~~~~~ea~~~G~tEvl~~gG~~P~~--~~~~   75 (336)
T PRK06245          2 VNMSKIVTYSRNVFIPLTYECRNRCGYCTFRPDPG---E-ASLLSPEEVREILERGQDAGCTEALFTFGEVPDE--SEEI   75 (336)
T ss_pred             CCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCC---C-CCCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCC--CHHH
T ss_conf             98898789818626167754026882586746887---5-6877999999999999976983999805788663--6899


Q ss_pred             HH---------------HHHHHHCCCCCCEEEECCCCCHHHHHHHHCCCCCEEEEECCC-CHHHHHCC---CCCCCHHHH
Q ss_conf             99---------------988762136883241025699999998741576069751343-77773205---888898999
Q gi|254780485|r  125 IV---------------DMIKGVKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDT-SERFYPHV---TTTHTFEDR  185 (328)
Q Consensus       125 ~~---------------e~i~~i~~~~~~i~~~~g~~~~~~~~~Lk~aG~~~~~~~let-~~~~~~~~---~~~~~~~~~  185 (328)
                      +.               ++.+...+.+...|.++|.++.+++++||+.++ +....+|+ ++.+...+   +|++..++|
T Consensus        76 ~~~l~~~~~~~~~~~~~~~~~~~le~gllph~n~G~ls~~el~~Lk~v~a-smG~mlE~~se~l~~~~h~~~P~K~~~~r  154 (336)
T PRK06245         76 REQLAEPGYSSWLEYLYDLCELALETGLLPHTNAGILSRAEMEALKPVNA-SMGLMLEQTSPRLLETVHRHSPGKDPELR  154 (336)
T ss_pred             HHHHHHHCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCHHHHHHHHCCCC-CCCCCCHHHHHHHHHHHCCCCCCCCHHHH
T ss_conf             99999707550778899985888763655223667678999998753597-66757123568988763044898788999


Q ss_pred             HHHHHHHHHCCCCCCCEEEECCCCCHHHHHHHHHHHHHCCCCCCEE---ECCCEEECCCCCCCCCCCCCHHHHHHHHHHH
Q ss_conf             9999999987985577078668989999999999997408888602---0541120487412445687989999999999
Q gi|254780485|r  186 LQTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESI---PINLLIPIPGSKFEENKKVDPIEHVRIISVA  262 (328)
Q Consensus       186 l~~~~~a~~~G~~~~sg~l~G~gEt~eeri~~l~~lr~l~~~~~~v---~~~~~~p~~gt~l~~~~~~~~~e~lr~iAi~  262 (328)
                      |+++++||++|+++|+|||||||||++||++||..||+||+.+++|   .+.+|.|.++|+|.+.+.++..|++|++|+|
T Consensus       155 L~~ie~Ah~lgIptTatmL~G~gET~eeRi~hL~~IR~lq~~tGgfqefI~~~F~p~~~t~m~~~~~~~~~e~l~~iAvA  234 (336)
T PRK06245        155 LETIEWAGELKIPFTTGLLIGIGETWEDRIESLEAIAELHERYGHIQEVIIQNFRPKPGIPMENHPEPSPEEMPRVVALA  234 (336)
T ss_pred             HHHHHHHHHCCCCCEEEEEEECCCCHHHHHHHHHHHHHHHHHCCCEEEEEECCCCCCCCCCCCCCCCCCHHHHHHHHHHH
T ss_conf             99999999839972202452066999999999999999886349757995068778987533469997999999999999


Q ss_pred             HHHCCCCCCEEEEHHHHHCHHHHHHHHHHCCC---EEE--ECCEEE-CCCCCCHHHHHHHHHHCCCCCCC
Q ss_conf             99686872142311565165689999980998---899--778665-15888989999999982985324
Q gi|254780485|r  263 RILMPKSRLRLAAGRAMMSDELQALCFFSGAN---SIF--VGDTLL-TAKNPSYNKDTILFNRLGLIPDL  326 (328)
Q Consensus       263 RL~lP~~~i~i~~~~~~~~~~~~~~~L~~GaN---~~~--~g~~~~-t~~g~~~~~~~~~i~~~G~~P~~  326 (328)
                      ||+||+. |+||++ ++++++..|++|.+|||   ||.  +-+++- ...=+..++..+.++++|+..+-
T Consensus       235 RiiL~~~-i~IQap-pnL~~~~~~~~L~~GanDlGGisp~t~d~vnpe~~wp~~~~l~~~~~~~g~~l~~  302 (336)
T PRK06245        235 RLILPPD-ISIQVP-PNLVDDTGLLFLEAGADDLGGISPVTKDEVNPEYPWPDIDELKEILEEAGWQLKE  302 (336)
T ss_pred             HHHCCCC-CEEEEC-CCCCCHHHHHHHHCCCCCCCCCCCCCCCEECCCCCCCCHHHHHHHHHHCCCCCCC
T ss_conf             9966998-579769-8678557899986787667887757666018899998999999999975996564


No 18 
>PRK06267 hypothetical protein; Provisional
Probab=100.00  E-value=0  Score=358.25  Aligned_cols=253  Identities=19%  Similarity=0.249  Sum_probs=215.6

Q ss_pred             CHHHHHHHHHHHHHHHCCCCEEEEEEEEEECCCCCC--CCCCCCCCCCCCCCC-CCCCCCCCHHHHHHHHHHHHHCCCEE
Q ss_conf             918999999999888628985699986453078683--423212433547775-64100068579999999999649838
Q gi|254780485|r   31 PFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCP--ENCGYCNQSVHNKSK-LKASKLINVDQVLKEAKNAKENGATR  107 (328)
Q Consensus        31 ~~~el~~~Aa~~~r~~~~g~~V~~~~~in~~TN~C~--~~C~fCaf~~~~~~~-~~~~~~~~~Eei~~~a~~~~~~G~~~  107 (328)
                      +.+|++-+|..++++ ++||.|++.+.|.+ ||+|.  ++|.||+||++++.. ....+.+++|+|++.|+.+++.|.+.
T Consensus         5 ~~~~~~~kAnki~~K-~~Gd~V~LrglIef-sN~C~~~~dC~YCg~sa~~~k~k~p~ryR~s~EeIl~~A~~~~~~G~kt   82 (324)
T PRK06267          5 EILENSIKAFKLTEK-HHGNIVSLERALFL-GWYCNLGDPCKFCFMSTQKDKIKDPLKARRRPESILAEAIIMKRIGWKL   82 (324)
T ss_pred             HHHHHHHHHHHHHHH-HCCCEEEEEEEEEE-CCCCCCCCCCCCCCCCCCCCCCCCHHHHHCCHHHHHHHHHHHHHHCCCE
T ss_conf             999999999999998-35985889788888-2535899998768777777777646655289999999999999839997


Q ss_pred             EEEECCCCCCCCCCHHHHHHHHHHHCCC-CCCEEEECCCCCHHHHHHHHCCCCCEEEEECCC-CHHHHHCCCCCCCHHHH
Q ss_conf             9973036888744289999988762136-883241025699999998741576069751343-77773205888898999
Q gi|254780485|r  108 YCMGAAWREPKERDLSIIVDMIKGVKSL-GLETCMTLGMLSFEQAQILSKAGLDYYNHNIDT-SERFYPHVTTTHTFEDR  185 (328)
Q Consensus       108 ~~l~~~~~~~~~~~~~~~~e~i~~i~~~-~~~i~~~~g~~~~~~~~~Lk~aG~~~~~~~let-~~~~~~~~~~~~~~~~~  185 (328)
                      +++|+|. +..   .+++.++++.|++. +..+++|+|..+++++..++++|++.+   +|| .+++|+++||++++++|
T Consensus        83 ~vLqsGe-dyt---~eel~~ii~~IK~i~~~avtLSlG~~s~e~~~~~~~aG~~~~---lETan~~ly~~i~p~~s~e~R  155 (324)
T PRK06267         83 EFISGGY-GYT---TEEINDIIEMISYIQGSKQYLNVGIIDFENLNLNEIEGVVGA---VETVNPKLHEELCPGKPLDKI  155 (324)
T ss_pred             EEEECCC-CCC---HHHHHHHHHHHHHHCCCCEEEECCCCCHHHHHHHHHCCHHHH---HHCCCHHHHCCCCCCCCHHHH
T ss_conf             9980487-799---899999999998601871697158787999977766370142---414798887027999988999


Q ss_pred             HHHHHHHHHCCCCCCCEEEECCCCCHHHHHHHHHHHHHCCCCCCEEECCCEEECCCCCCCCCCCCCHHHHHHHHHHHHHH
Q ss_conf             99999999879855770786689899999999999974088886020541120487412445687989999999999996
Q gi|254780485|r  186 LQTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEHVRIISVARIL  265 (328)
Q Consensus       186 l~~~~~a~~~G~~~~sg~l~G~gEt~eeri~~l~~lr~l~~~~~~v~~~~~~p~~gt~l~~~~~~~~~e~lr~iAi~RL~  265 (328)
                      +++++.++++|+++|+|+|+|+|||.+|++++++.|++|+.  ++||+++|+|+|||||++.|++++.|++|+||+.||+
T Consensus       156 i~~l~~lk~~G~e~gsG~ivGlGET~ed~~~~~~~lkel~~--d~I~I~~f~P~~gTP~en~p~~t~~e~lk~iA~~RL~  233 (324)
T PRK06267        156 KEMLKKAKDLGLKTGITIILGLGETEDDIELLLNLIEELNL--DRITFYSLNPQKETIFEGKPSPTTLEYMNWVSSVRLN  233 (324)
T ss_pred             HHHHHHHHHCCCCEEEEEEEECCCCHHHHHHHHHHHHHCCC--CEEEECCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHH
T ss_conf             99999999839832004687379889999999999997699--9763258458999988999998999999999999996


Q ss_pred             CCCCCCEEEEHHHHHCHHHHHHHHHHCCCEE
Q ss_conf             8687214231156516568999998099889
Q gi|254780485|r  266 MPKSRLRLAAGRAMMSDELQALCFFSGANSI  296 (328)
Q Consensus       266 lP~~~i~i~~~~~~~~~~~~~~~L~~GaN~~  296 (328)
                      +|++.|+.++ |.. +.+.-...|+||||++
T Consensus       234 ~Pki~I~~~t-~~~-~~~ni~~ll~aGan~i  262 (324)
T PRK06267        234 FPKIKIITGT-WVD-KLTNIGPLVMAGSNVI  262 (324)
T ss_pred             CCCCCCCCCC-CCC-CCCCCCHHHHCCCCCC
T ss_conf             8871253576-535-7110018776477630


No 19 
>PRK09240 thiH thiamine biosynthesis protein ThiH; Reviewed
Probab=100.00  E-value=0  Score=351.06  Aligned_cols=309  Identities=20%  Similarity=0.286  Sum_probs=264.8

Q ss_pred             HHHHCCCCCCCCHHHHHHHHCCC---HHHHHH-HHHHHHHHHCCCCEEEEEEEEEECCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             34200234478999999997399---189999-99999888628985699986453078683423212433547775641
Q gi|254780485|r    9 EENPTKKPKVWTSKEVFQIYNMP---FNDLLF-WSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQSVHNKSKLKA   84 (328)
Q Consensus         9 ~~~~~~~~e~ls~eea~~L~~~~---~~el~~-~Aa~~~r~~~~g~~V~~~~~in~~TN~C~~~C~fCaf~~~~~~~~~~   84 (328)
                      +.++...-++||.+|.+.|++-.   .+|.++ .|+++ +++++||+|.++.++++ ||+|.|+|.||+|++.|+  +.+
T Consensus        26 dV~~aL~k~~l~~~d~~~LLsp~a~~~lE~ma~~A~~l-t~~~fG~~I~LfaPLYl-SN~C~N~C~YCGf~~~N~--i~R  101 (371)
T PRK09240         26 DVERALNKDKLDLEDLMALLSPAAEPYLEEMAQRAQAL-TRQRFGNTISLYTPLYL-SNLCANDCTYCGFSMSNK--IKR  101 (371)
T ss_pred             HHHHHHHCCCCCHHHHHHHCCCCCHHHHHHHHHHHHHH-HHHHCCCEEEEEECHHH-HCCCCCCCEECCCCCCCC--CCC
T ss_conf             99999715799989999886974788999999999999-99873985899850440-222177887589867787--630


Q ss_pred             CCCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCCCCHHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHCCCCCEEEE
Q ss_conf             00068579999999999649838997303688874428999998876213688324102569999999874157606975
Q gi|254780485|r   85 SKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLGLETCMTLGMLSFEQAQILSKAGLDYYNH  164 (328)
Q Consensus        85 ~~~~~~Eei~~~a~~~~~~G~~~~~l~~~~~~~~~~~~~~~~e~i~~i~~~~~~i~~~~g~~~~~~~~~Lk~aG~~~~~~  164 (328)
                      + .++.|||.++++.+.++|++++.+++|. ++...+++|+.++++.+++.+..|.+++++++.++|++|+++|+|+|.+
T Consensus       102 ~-~Ls~eEI~~E~~ai~~~G~k~ILLvtGE-~~~~~~~~Yi~~~v~~ik~~f~~v~iev~Pl~~eeY~~L~~aG~d~~~v  179 (371)
T PRK09240        102 K-TLDEEEIEREMAAIKKLGFEHILLVTGE-HEAKVGVDYIRRALPLAREYFSSVAIEVQPLSEEEYAELVELGLDGVTV  179 (371)
T ss_pred             C-CCCHHHHHHHHHHHHHCCCCEEEEECCC-CCCCCCHHHHHHHHHHHHHHCCCEEEEECCCCHHHHHHHHHCCCCEEEE
T ss_conf             0-2899999999999997695238854057-8776988999999999997567407995259989999999859986999


Q ss_pred             ECCC-CHHHHHCCC---CCCCHHHHHHHHHHHHHCCC-CCCCEEEECCCCCHHHHHHHHHHHHHCCCC----CCEEECCC
Q ss_conf             1343-777732058---88898999999999998798-557707866898999999999999740888----86020541
Q gi|254780485|r  165 NIDT-SERFYPHVT---TTHTFEDRLQTLENVRKSGI-KVCCGGILGLGEMIDDRIDMLLTLANLSTP----PESIPINL  235 (328)
Q Consensus       165 ~let-~~~~~~~~~---~~~~~~~~l~~~~~a~~~G~-~~~sg~l~G~gEt~eeri~~l~~lr~l~~~----~~~v~~~~  235 (328)
                      ++|| .++.|+++|   +|.+|++||+++++|.++|+ .++.|.|+|+.++..|.+..+.|+..||.+    +.+|++|+
T Consensus       180 yQETY~~~~Y~~lHp~G~K~dy~~RL~a~eRa~~aGi~~vgiGaLlGL~dwr~e~~~~~~Ha~~L~~~y~~~~~siS~PR  259 (371)
T PRK09240        180 YQETYNPATYAKHHLRGPKQDFFYRLETPERAARAGIRKIGLGALLGLSDWRTDALMTALHLRYLQRKYWRARYSISFPR  259 (371)
T ss_pred             EEHHCCHHHHHHHCCCCCCCCCHHHCCCHHHHHHCCCCEECEEEEECCCHHHHHHHHHHHHHHHHHHHCCCCCEEEECCC
T ss_conf             60325999999858899854525452378889875997036110226546899999999999999987799875763575


Q ss_pred             EEECCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCEEEEHHHHHCHHHHHHHHHHCCCEEEECCE--------------
Q ss_conf             120487412445687989999999999996868721423115651656899999809988997786--------------
Q gi|254780485|r  236 LIPIPGSKFEENKKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDT--------------  301 (328)
Q Consensus       236 ~~p~~gt~l~~~~~~~~~e~lr~iAi~RL~lP~~~i~i~~~~~~~~~~~~~~~L~~GaN~~~~g~~--------------  301 (328)
                      +.|..|. +.+..+.++.+++|+||+.||++|++.|.+|+ ||  .++++...+..|+..+.+|..              
T Consensus       260 lrP~~g~-~~p~~~vsD~~l~q~i~a~Rl~~P~~gi~lST-RE--~~~~Rd~li~lGvT~mSAgs~T~~GGy~~~~~~~~  335 (371)
T PRK09240        260 LRPCTGG-FEPKSIVSDRQLVQLICAFRLFLPDVEISLST-RE--SPEFRDNLIPLGITKMSAGSSTQPGGYADPEKELE  335 (371)
T ss_pred             CCCCCCC-CCCCCCCCHHHHHHHHHHHHHHCCCCCCEEEC-CC--CHHHHHHHHHHCCEEECCCCCCCCCCCCCCCCCCC
T ss_conf             3368899-88986578899999999999866555616864-78--98999888852560255555468877789998866


Q ss_pred             -EECCCCCCHHHHHHHHHHCCCCCCCC
Q ss_conf             -65158889899999999829853247
Q gi|254780485|r  302 -LLTAKNPSYNKDTILFNRLGLIPDLS  327 (328)
Q Consensus       302 -~~t~~g~~~~~~~~~i~~~G~~P~~~  327 (328)
                       +..++.+|++|+.++|++.|+.|++.
T Consensus       336 QF~i~D~Rs~~Ev~~~l~~~Gy~Pv~k  362 (371)
T PRK09240        336 QFEISDDRSVEEVAAALRAQGLQPVWK  362 (371)
T ss_pred             CCCCCCCCCHHHHHHHHHHCCCEECCC
T ss_conf             653799989999999999879910316


No 20 
>TIGR02351 thiH thiazole biosynthesis protein ThiH; InterPro: IPR012726    Members of this protein family are the ThiH proteins involved in thiamine biosynthesis. They are homologues of the BioB protein of biotin biosynthesis. Genes encoding these proteins are generally found in operons with other thiamin biosynthesis genes. ; GO: 0005506 iron ion binding, 0051539 4 iron 4 sulfur cluster binding, 0009228 thiamin biosynthetic process.
Probab=100.00  E-value=0  Score=355.36  Aligned_cols=309  Identities=24%  Similarity=0.313  Sum_probs=272.2

Q ss_pred             HHHCCCCCCCCHHHHHHHHC---CCHH-HHHHHHHHHHHHHCCCCEEEEEEEEEECCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             42002344789999999973---9918-9999999998886289856999864530786834232124335477756410
Q gi|254780485|r   10 ENPTKKPKVWTSKEVFQIYN---MPFN-DLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQSVHNKSKLKAS   85 (328)
Q Consensus        10 ~~~~~~~e~ls~eea~~L~~---~~~~-el~~~Aa~~~r~~~~g~~V~~~~~in~~TN~C~~~C~fCaf~~~~~~~~~~~   85 (328)
                      .+-+.++|.++.+|+++|++   .|.+ ++...|+.+.+++| ||.|.++.++++ ||+|.|.|.||||+.+||  +.+ 
T Consensus        28 eraL~~~e~~~~~D~~aLlSPaA~~YLE~mA~~a~~lt~~rF-G~ti~Lf~PLYl-SN~C~N~C~YCGF~~~NK--IkR-  102 (378)
T TIGR02351        28 ERALNKREHLSLEDFLALLSPAAEPYLEEMAQKAKKLTRKRF-GNTISLFTPLYL-SNYCSNKCVYCGFSMSNK--IKR-  102 (378)
T ss_pred             HHHHCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHC-CCCCEEHHHHHH-HHCCCCCCCCCCCCCCCC--HHH-
T ss_conf             997245767898888631143010689999999998738763-781000133456-541487521046578673--020-


Q ss_pred             CCCCHHHHHHHHHHHHHCC-CEEEEEECCCCCCCCCCHHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHCCCCCEEEE
Q ss_conf             0068579999999999649-838997303688874428999998876213688324102569999999874157606975
Q gi|254780485|r   86 KLINVDQVLKEAKNAKENG-ATRYCMGAAWREPKERDLSIIVDMIKGVKSLGLETCMTLGMLSFEQAQILSKAGLDYYNH  164 (328)
Q Consensus        86 ~~~~~Eei~~~a~~~~~~G-~~~~~l~~~~~~~~~~~~~~~~e~i~~i~~~~~~i~~~~g~~~~~~~~~Lk~aG~~~~~~  164 (328)
                      ..|+.|||.++.+++.+.| +.+++|++|.++. ...++|+.++++.+|+.+..|.+.+.|+++|+|++|+++|+|.+.+
T Consensus       103 ~~Ln~~Ei~~E~~aI~k~gPf~~iLlvtGE~e~-~~g~~Yi~~~~~l~k~~F~~l~iEv~Pl~~eeYk~L~~~Gld~V~V  181 (378)
T TIGR02351       103 KKLNEEEIEREIEAIKKSGPFKEILLVTGESEK-AAGVEYIEEAIKLAKEYFSSLAIEVQPLTEEEYKKLKEAGLDGVTV  181 (378)
T ss_pred             CCCCHHHHHHHHHHHHHCCCCHHEEEECCCCCC-CCCHHHHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHCCCCEEEE
T ss_conf             048888999999998620770130011157775-5883789999999875278544887307704568897708881588


Q ss_pred             ECCC-CHHHHHCCCC---CCCHHHHHHHHHHHHHCCC-CCCCEEEECCCC-CHHHHHHHHHHHHHCCCCC----CEEECC
Q ss_conf             1343-7777320588---8898999999999998798-557707866898-9999999999997408888----602054
Q gi|254780485|r  165 NIDT-SERFYPHVTT---THTFEDRLQTLENVRKSGI-KVCCGGILGLGE-MIDDRIDMLLTLANLSTPP----ESIPIN  234 (328)
Q Consensus       165 ~let-~~~~~~~~~~---~~~~~~~l~~~~~a~~~G~-~~~sg~l~G~gE-t~eeri~~l~~lr~l~~~~----~~v~~~  234 (328)
                      ++|| .+..|+++|+   |.+|.+||++.+++-++|| +++-|+|+|+-| ++-|-+-...|++-||.++    -|+++|
T Consensus       182 yQETYn~~~Y~~~H~~G~K~~F~yRl~tpeR~a~AG~~kIg~GaLlGL~dnwR~Da~~~a~H~~YL~~~Yw~~~~SiS~P  261 (378)
T TIGR02351       182 YQETYNEKKYKKHHLAGKKKDFRYRLETPERIAKAGMRKIGIGALLGLEDNWRTDAFFTAYHLRYLQKKYWKTKYSISVP  261 (378)
T ss_pred             EEECCCHHHCCCCCCCCCCCCCCCCCCCHHHHHHCCCCEEHHHHHHHCCCCHHHHHHHHHHHHHHHHHHCCCCCEEECCC
T ss_conf             76516742154437666877644105604678661874021253430122422899999999999986368330303254


Q ss_pred             CEEECCCC----CCCCCC-CCCHHHHHHHHHHHHHHCCCCCCEEEEHHHHHCHHHHHHHHHHCCCEEEE------CCEE-
Q ss_conf             11204874----124456-87989999999999996868721423115651656899999809988997------7866-
Q gi|254780485|r  235 LLIPIPGS----KFEENK-KVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFV------GDTL-  302 (328)
Q Consensus       235 ~~~p~~gt----~l~~~~-~~~~~e~lr~iAi~RL~lP~~~i~i~~~~~~~~~~~~~~~L~~GaN~~~~------g~~~-  302 (328)
                      +++|..|.    -++... .+++.+.+++++++||++|++.|.||| ||  ++++|...+.-|++.+.+      |+|- 
T Consensus       262 RLRP~~n~aPasG~~p~~~~~~d~~LvQ~~cAyRLF~p~~~IslST-RE--~~~FRDn~~pLGiT~~SAGssT~pGGy~e  338 (378)
T TIGR02351       262 RLRPCTNDAPASGLKPKVKIVTDRELVQLICAYRLFDPDVEISLST-RE--SKKFRDNVIPLGITKMSAGSSTEPGGYSE  338 (378)
T ss_pred             CCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCC-CC--CHHHHHHHHHHHHCCCCCCCCCCCCCCCC
T ss_conf             3367668976467856665257678899999998734104744020-25--65456643366322011220158866203


Q ss_pred             -ECCC---------CCCHHHHHHHHHHCCCCCCCC
Q ss_conf             -5158---------889899999999829853247
Q gi|254780485|r  303 -LTAK---------NPSYNKDTILFNRLGLIPDLS  327 (328)
Q Consensus       303 -~t~~---------g~~~~~~~~~i~~~G~~P~~~  327 (328)
                       ++..         .+|+.|+.++||+.|+.|++.
T Consensus       339 C~~~~~leQFeI~D~Rsv~Ev~~~lr~~G~~PVwk  373 (378)
T TIGR02351       339 CSEKKGLEQFEISDERSVAEVEEDLRKKGLQPVWK  373 (378)
T ss_pred             CCCCCCCCCCCCCCCCCHHHHHHHHHHCCCCCCCC
T ss_conf             78888875101246788889999998628896000


No 21 
>PRK09613 thiH thiamine biosynthesis protein ThiH; Reviewed
Probab=100.00  E-value=0  Score=343.48  Aligned_cols=317  Identities=22%  Similarity=0.329  Sum_probs=271.0

Q ss_pred             HHHHHHHHHHCCCCCCCCHHHHHHHHCCCHHHH---HHHHHHHHHHHCCCCEEEEEEEEEECCCCCCCCCCCCCCCCCCC
Q ss_conf             557321342002344789999999973991899---99999998886289856999864530786834232124335477
Q gi|254780485|r    3 RSTVVPEENPTKKPKVWTSKEVFQIYNMPFNDL---LFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQSVHNK   79 (328)
Q Consensus         3 ~~~~~~~~~~~~~~e~ls~eea~~L~~~~~~el---~~~Aa~~~r~~~~g~~V~~~~~in~~TN~C~~~C~fCaf~~~~~   79 (328)
                      +..|-.+-.|...-++||.+|+..|++.+++++   ++.+|...+++++||++.++.++++ ||.|+|+|.||+|+++|+
T Consensus        30 ~~~v~~il~Ka~~~~gL~~~e~A~LL~~~d~e~~eem~~~A~~ik~~~yGnrIvLFAPLYl-SN~C~N~C~YCGF~~~Nk  108 (471)
T PRK09613         30 KEEIREIIEKALEKEGLSPEETAVLLNVEDEELLEEIFKAAREIKEKIYGNRIVLFAPLYI-SNYCVNNCVYCGFRRSNK  108 (471)
T ss_pred             HHHHHHHHHHHHHCCCCCHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHCCCEEEEEECHHH-HCCCCCCCEECCCCCCCC
T ss_conf             8999999999986289999999999558998999999999999999861875899854112-033367875378747787


Q ss_pred             CCCCCCCCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCCCCHHHHHHHHHHHCCCCCC------EEEECCCCCHHHHHH
Q ss_conf             75641000685799999999996498389973036888744289999988762136883------241025699999998
Q gi|254780485|r   80 SKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLGLE------TCMTLGMLSFEQAQI  153 (328)
Q Consensus        80 ~~~~~~~~~~~Eei~~~a~~~~~~G~~~~~l~~~~~~~~~~~~~~~~e~i~~i~~~~~~------i~~~~g~~~~~~~~~  153 (328)
                      . +.+ ..|+.|||.++++.+.++|.+++.+++|. .|...+++|+.++++.++.....      |.+++.+++.++|++
T Consensus       109 ~-i~R-k~Lt~eEi~~E~~al~~~G~krilLvtGE-~p~~~~~~Yi~~~i~~iy~~~~~~g~IrrvnVei~Pl~~eeY~~  185 (471)
T PRK09613        109 E-LKR-KKLTQEEIREEVKALESMGHKRLALVAGE-HPVNCDIDYILESIKTIYSTKNGNGEIRRVNVNIAPTTVENYKK  185 (471)
T ss_pred             C-CCC-CCCCHHHHHHHHHHHHHCCCCEEEEEECC-CCCCCCHHHHHHHHHHHHHHCCCCCCEEEEEEEECCCCHHHHHH
T ss_conf             7-763-37899999999999997697318987146-88879889999999999875246785336889944798699999


Q ss_pred             HHCCCCCEEEEECCC-CHHHHHCCC---CCCCHHHHHHHHHHHHHCCC-CCCCEEEECCCCCHHHHHHHHHHHHHCCC--
Q ss_conf             741576069751343-777732058---88898999999999998798-55770786689899999999999974088--
Q gi|254780485|r  154 LSKAGLDYYNHNIDT-SERFYPHVT---TTHTFEDRLQTLENVRKSGI-KVCCGGILGLGEMIDDRIDMLLTLANLST--  226 (328)
Q Consensus       154 Lk~aG~~~~~~~let-~~~~~~~~~---~~~~~~~~l~~~~~a~~~G~-~~~sg~l~G~gEt~eeri~~l~~lr~l~~--  226 (328)
                      |+++|++.|.+++|| .++.|++.|   ||.+|++|++++++|.++|+ .++.|.|+|+.++..|.+..+.|...|+.  
T Consensus       186 L~~aGigt~~vfQETYh~~tY~~~Hp~GpK~dy~~RL~a~dRA~~AGi~dVGiGaLlGL~dwr~e~~~l~~Ha~~Le~~y  265 (471)
T PRK09613        186 LKEAGIGTYQLFQETYHKPTYEKMHPAGPKSNYDWRLTAMDRAMEAGIDDVGIGVLFGLYDYRFEVLGLLMHAEHLEERF  265 (471)
T ss_pred             HHHCCCCEEEEEEEECCHHHHHHHCCCCCCCCCHHHCCCHHHHHHCCCCEECCHHEECCCHHHHHHHHHHHHHHHHHHHC
T ss_conf             99869996999863078878998587898656333415788898759971360020265368999999999999999975


Q ss_pred             --CCCEEECCCEEECCCCCCCC--CCCCCHHHHHHHHHHHHHHCCCCCCEEEEHHHHHCHHHHHHHHHHCCCEEEECCE-
Q ss_conf             --88602054112048741244--5687989999999999996868721423115651656899999809988997786-
Q gi|254780485|r  227 --PPESIPINLLIPIPGSKFEE--NKKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDT-  301 (328)
Q Consensus       227 --~~~~v~~~~~~p~~gt~l~~--~~~~~~~e~lr~iAi~RL~lP~~~i~i~~~~~~~~~~~~~~~L~~GaN~~~~g~~-  301 (328)
                        .+++|++|++.|..|+++..  ..+.++.++.|+||+.||++|++.|.+|+ ||  .++++...+..|+..+.+|.. 
T Consensus       266 g~g~hTIS~PRlrPa~g~~~~~~pp~~VsD~~f~qiiaa~RL~vP~tGiilST-RE--~~~~Rd~li~lGVsqmSAGS~T  342 (471)
T PRK09613        266 GVGPHTISVPRLEPALGSDLSENPPYLVSDEDFKKIVAILRLAVPYTGMILST-RE--SAELRDEVLELGVSQISAGSRT  342 (471)
T ss_pred             CCCCEEEECCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCEEEC-CC--CHHHHHHHHHHCCEEECCCCCC
T ss_conf             99985663675436899976678998679899999999999856545736853-79--9889998885346123345536


Q ss_pred             -----EE------------CCCCCCHHHHHHHHHHCCCCCCC
Q ss_conf             -----65------------15888989999999982985324
Q gi|254780485|r  302 -----LL------------TAKNPSYNKDTILFNRLGLIPDL  326 (328)
Q Consensus       302 -----~~------------t~~g~~~~~~~~~i~~~G~~P~~  326 (328)
                           --            -.+.++++|.+..+-+.|++|-|
T Consensus       343 ~vGGY~~~~~~~~~~~QF~i~D~Rs~dEvi~~l~~~gyiPSf  384 (471)
T PRK09613        343 GVGGYSESEQEEEEKAQFELGDHRSLDEVIRELCEMGYIPSF  384 (471)
T ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHCCCCCCC
T ss_conf             887667655677667886678998999999999977997730


No 22 
>PRK09234 fbiC FO synthase; Reviewed
Probab=100.00  E-value=1.4e-38  Score=278.21  Aligned_cols=309  Identities=17%  Similarity=0.252  Sum_probs=245.2

Q ss_pred             HHHCCCCCCCCHHHHHHHHCC---CHHHHHHHHHHHHHHHCC----CCEEEEEEEEEEC-CCCCCCCCCCCCCCCCCCCC
Q ss_conf             420023447899999999739---918999999999888628----9856999864530-78683423212433547775
Q gi|254780485|r   10 ENPTKKPKVWTSKEVFQIYNM---PFNDLLFWSHTVHRKNFE----PNHIQLSKLLNIK-TGGCPENCGYCNQSVHNKSK   81 (328)
Q Consensus        10 ~~~~~~~e~ls~eea~~L~~~---~~~el~~~Aa~~~r~~~~----g~~V~~~~~in~~-TN~C~~~C~fCaf~~~~~~~   81 (328)
                      -.-...+..|+.+|+..|+.+   ++.+|+..|+.+|..-+.    ++.|||++++.|+ ||.|.+.|.||+|.+.++..
T Consensus        22 l~r~~~~~~~~~~~~~~l~~~~~~~~~~l~~~a~~~rd~~~~~~g~~~viTyS~kVFiPLT~lCrd~C~YCtF~~~p~~~  101 (846)
T PRK09234         22 LRRARDGVALDVDEAAVLLTARGDDLADLCASAARVRDAGLGAAGRPGVVTYSRKVFIPLTRLCRDRCHYCTFATVPGKL  101 (846)
T ss_pred             HHHHHCCCCCCHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHCCCCCEEEECCCCCCCCCHHHHCCCCCCCCCCCCCCC
T ss_conf             99865378778899999997234449999999998874033324898737657864314306876368877643688655


Q ss_pred             CCCCCCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCC--------------CCCHHHHHHHHHHHC-CCCCCEEEECCCC
Q ss_conf             6410006857999999999964983899730368887--------------442899999887621-3688324102569
Q gi|254780485|r   82 LKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPK--------------ERDLSIIVDMIKGVK-SLGLETCMTLGML  146 (328)
Q Consensus        82 ~~~~~~~~~Eei~~~a~~~~~~G~~~~~l~~~~~~~~--------------~~~~~~~~e~i~~i~-~~~~~i~~~~g~~  146 (328)
                      ..  .+++.|||++.++.....|+++.++..|..+..              ...++|+.++.+.+- +.++..|+|+|.+
T Consensus       102 ~~--~~l~~deV~~ia~~g~~~GC~EALftlGd~PE~r~~~a~~~L~~~G~~st~~Yl~~~~~~vl~etgLLPH~N~G~l  179 (846)
T PRK09234        102 RA--AYLSPDEVLDIARAGAAAGCKEALFTLGDRPEDRWPEAREWLDERGYDSTLDYVRAMAIRVLEETGLLPHLNPGVM  179 (846)
T ss_pred             CC--CCCCHHHHHHHHHHHHHCCCCEEHHCCCCCHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHCCCCCCCCCCCC
T ss_conf             67--7789999999999999869956131468886774899999999719845999999999999986598887898889


Q ss_pred             CHHHHHHHHCCCCCEEEEECCC-CHHHH------HCCCCCCCHHHHHHHHHHHHHCCCCCCCEEEECCCCCHHHHHHHHH
Q ss_conf             9999998741576069751343-77773------2058888989999999999987985577078668989999999999
Q gi|254780485|r  147 SFEQAQILSKAGLDYYNHNIDT-SERFY------PHVTTTHTFEDRLQTLENVRKSGIKVCCGGILGLGEMIDDRIDMLL  219 (328)
Q Consensus       147 ~~~~~~~Lk~aG~~~~~~~let-~~~~~------~~~~~~~~~~~~l~~~~~a~~~G~~~~sg~l~G~gEt~eeri~~l~  219 (328)
                      +.+++++||...+.+-. -||| +++++      +..+|.+.++.||++++.|.+++++.|+|+++|+|||++||++.|+
T Consensus       180 s~~el~~Lk~v~~SmGl-MLEs~s~rL~~~~g~~H~~sP~K~P~~Rl~tl~~AG~l~iPfTTGiLiGIGEt~~er~~sL~  258 (846)
T PRK09234        180 SWSELARLKPVAPSMGM-MLETTSRRLFETKGGAHYGSPDKDPAVRLRVLEDAGRLSVPFTTGILIGIGETLAERAESLF  258 (846)
T ss_pred             CHHHHHHHHCCCCCCEE-EECCCCHHHCCCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCEEEEEEECCCCCHHHHHHHHH
T ss_conf             99999985236875204-51103464424789888899998989999999985404797321113257799999999999


Q ss_pred             HHHHCCCCC---CEEECCCEEECCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCEEEEHHHHH-CHHHHHHHHHHCCC-
Q ss_conf             997408888---6020541120487412445687989999999999996868721423115651-65689999980998-
Q gi|254780485|r  220 TLANLSTPP---ESIPINLLIPIPGSKFEENKKVDPIEHVRIISVARILMPKSRLRLAAGRAMM-SDELQALCFFSGAN-  294 (328)
Q Consensus       220 ~lr~l~~~~---~~v~~~~~~p~~gt~l~~~~~~~~~e~lr~iAi~RL~lP~~~i~i~~~~~~~-~~~~~~~~L~~GaN-  294 (328)
                      .|++++..+   +.|.+++|.|.+||+|.+.+.++.+|++++||++|++||. .|+||.. ..+ .+..-...|.+|+| 
T Consensus       259 ai~~~h~~yghIQEVIiQNF~~K~~t~m~~~~~~~~~e~~~~ia~aR~il~~-~i~iQ~P-PNL~~~~~~~~ll~aGi~D  336 (846)
T PRK09234        259 AIRKSHREYGHIQEVIVQNFRAKPDTAMAGAPDAGLEDLLATIAVARLVLGP-KMRIQAP-PNLVSRDECAALLGAGIDD  336 (846)
T ss_pred             HHHHHHHHCCCCCEEEECCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCC-CCEEECC-CCCCCHHHHHHHHHCCCCC
T ss_conf             9999999739965798368889989868679997999999999999997399-8568559-9889867899999758745


Q ss_pred             --EE--EECCEEE-CCCCCCHHHHHHHHHHCCCC
Q ss_conf             --89--9778665-15888989999999982985
Q gi|254780485|r  295 --SI--FVGDTLL-TAKNPSYNKDTILFNRLGLI  323 (328)
Q Consensus       295 --~~--~~g~~~~-t~~g~~~~~~~~~i~~~G~~  323 (328)
                        ||  ++-+++- ...=+..++..+...++|+.
T Consensus       337 wGGISPvT~D~VNPE~pWP~l~~L~~~~~~~G~~  370 (846)
T PRK09234        337 WGGVSPLTPDHVNPERPWPALDELAAVTAEAGFT  370 (846)
T ss_pred             CCCCCCCCCCCCCCCCCCCCHHHHHHHHHHCCCC
T ss_conf             5687888777789889998999999999965973


No 23 
>PRK05481 lipoyl synthase; Provisional
Probab=99.83  E-value=7.4e-19  Score=146.05  Aligned_cols=186  Identities=20%  Similarity=0.350  Sum_probs=146.9

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCEEEEEECCCCCC-CCCCHHHHHHHHHHHCCCCCCEE
Q ss_conf             78683423212433547775641000685799999999996498389973036888-74428999998876213688324
Q gi|254780485|r   62 TGGCPENCGYCNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREP-KERDLSIIVDMIKGVKSLGLETC  140 (328)
Q Consensus        62 TN~C~~~C~fCaf~~~~~~~~~~~~~~~~Eei~~~a~~~~~~G~~~~~l~~~~~~~-~~~~~~~~~e~i~~i~~~~~~i~  140 (328)
                      -++|+.+|.||+-....    +.  .++++|....|+.+..+|.++++|.+..+++ ++.-...+.+.|+.|++..+.+.
T Consensus        59 G~~CTR~C~FC~V~tG~----P~--~~D~~EP~~vA~av~~m~Lk~vViTSV~RDDL~DgGA~hfa~~I~~Ir~~~P~~~  132 (289)
T PRK05481         59 GDICTRRCPFCDVATGR----PL--PLDPDEPERVAEAVARMGLKYVVITSVDRDDLPDGGAQHFAETIRAIRELSPGTT  132 (289)
T ss_pred             CCCCCCCCCCCCCCCCC----CC--CCCCHHHHHHHHHHHHHCCCEEEEEEECCCCCCCCCHHHHHHHHHHHHHHCCCCE
T ss_conf             78765788774078899----89--8870307999999998289769996341666656554999999999985599977


Q ss_pred             EECCC---C-CHH-HHHHHHCCCCCEEEEECCCCHHHHHCCCCCCCHHHHHHHHHHHHHC--CCCCCCEEEECCCCCHHH
Q ss_conf             10256---9-999-9998741576069751343777732058888989999999999987--985577078668989999
Q gi|254780485|r  141 MTLGM---L-SFE-QAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKS--GIKVCCGGILGLGEMIDD  213 (328)
Q Consensus       141 ~~~g~---~-~~~-~~~~Lk~aG~~~~~~~let~~~~~~~~~~~~~~~~~l~~~~~a~~~--G~~~~sg~l~G~gEt~ee  213 (328)
                      +.+-.   . ..+ .++.+.+++.+-++||+||.|++|+.++|..+|++-|++++.|++.  |+.+-||+|+|+|||.+|
T Consensus       133 iEvLiPDF~G~~~~~l~~v~~a~PdV~nHNiETV~rL~~~VRp~a~Y~rSL~vL~~~k~~~p~~~TKSgiMvGLGEt~eE  212 (289)
T PRK05481        133 IEVLIPDFRGRKDAALEIVVAAPPDVFNHNLETVPRLYKRVRPGADYERSLELLKRAKELDPGIPTKSGLMVGLGETDEE  212 (289)
T ss_pred             EEECCCCCCCCHHHHHHHHHHCCHHHHHCCHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHCCCCCEEEEEEEECCCCHHH
T ss_conf             99707211469999999998567177643513104436233882338999999999997489982413567755788999


Q ss_pred             HHHHHHHHHHCCCCCCEEECC-CEEECCCCCCCCCCCCCHHHHH
Q ss_conf             999999997408888602054-1120487412445687989999
Q gi|254780485|r  214 RIDMLLTLANLSTPPESIPIN-LLIPIPGSKFEENKKVDPIEHV  256 (328)
Q Consensus       214 ri~~l~~lr~l~~~~~~v~~~-~~~p~~gt~l~~~~~~~~~e~l  256 (328)
                      +++.|..||+.+.  +.+.+. .+.|-+. -+.-..-.+|+++-
T Consensus       213 v~~~~~DL~~~gv--dilTiGQYL~Ps~~-hlpV~ryv~P~eF~  253 (289)
T PRK05481        213 VLEVMDDLRAHGV--DILTIGQYLQPSRK-HLPVERYVTPEEFD  253 (289)
T ss_pred             HHHHHHHHHHCCC--CEEEECCCCCCCCC-CCCCEECCCHHHHH
T ss_conf             9999999998199--89983403588866-68843356989999


No 24 
>COG0320 LipA Lipoate synthase [Coenzyme metabolism]
Probab=99.83  E-value=8.6e-19  Score=145.61  Aligned_cols=188  Identities=23%  Similarity=0.402  Sum_probs=150.0

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCEEEEEECCCCCC-CCCCHHHHHHHHHHHCCCCCCEE
Q ss_conf             78683423212433547775641000685799999999996498389973036888-74428999998876213688324
Q gi|254780485|r   62 TGGCPENCGYCNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREP-KERDLSIIVDMIKGVKSLGLETC  140 (328)
Q Consensus        62 TN~C~~~C~fCaf~~~~~~~~~~~~~~~~Eei~~~a~~~~~~G~~~~~l~~~~~~~-~~~~~~~~~e~i~~i~~~~~~i~  140 (328)
                      -.+|+..|.||......    +  ..++++|..+.|+..+.+|.++++|.+..+++ .+.-...+.+.|++|++..+.+.
T Consensus        77 G~~CTR~C~FC~V~~g~----P--~~lD~~EP~rvAeaV~~mgLkyVViTsVdRDDL~DGGA~hfa~~i~~Ir~~~P~t~  150 (306)
T COG0320          77 GDICTRRCRFCDVKTGR----P--NPLDPDEPERVAEAVKDMGLKYVVITSVDRDDLPDGGAQHFAECIRAIRELNPQTT  150 (306)
T ss_pred             CCHHCCCCCCCCCCCCC----C--CCCCCCHHHHHHHHHHHHCCCEEEEEEECCCCCCCCCHHHHHHHHHHHHHHCCCCE
T ss_conf             51322678853147899----9--99997427899999998389869997531566656456899999999996399964


Q ss_pred             EEC----CCCCHHHHHHHHCCCCCEEEEECCCCHHHHHCCCCCCCHHHHHHHHHHHHHCC--CCCCCEEEECCCCCHHHH
Q ss_conf             102----56999999987415760697513437777320588889899999999999879--855770786689899999
Q gi|254780485|r  141 MTL----GMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSG--IKVCCGGILGLGEMIDDR  214 (328)
Q Consensus       141 ~~~----g~~~~~~~~~Lk~aG~~~~~~~let~~~~~~~~~~~~~~~~~l~~~~~a~~~G--~~~~sg~l~G~gEt~eer  214 (328)
                      +.+    +--.+..+..+.+++.|-++||+||.|++|+.++++.+|++-|++++.+++.+  +.|-||+|+|+|||.+|+
T Consensus       151 iEvL~PDF~G~~~al~~v~~~~pdV~nHNvETVprL~~~VRp~A~Y~~SL~~L~~~k~~~P~i~TKSgiMlGLGEt~~Ev  230 (306)
T COG0320         151 IEVLTPDFRGNDDALEIVADAGPDVFNHNVETVPRLYPRVRPGATYERSLSLLERAKELGPDIPTKSGLMVGLGETDEEV  230 (306)
T ss_pred             EEEECCCCCCCHHHHHHHHHCCCCHHHCCCCCCHHCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCEEEECCCCHHHH
T ss_conf             89838654678999999983696110045200001142568987688899999999985898631121355057768999


Q ss_pred             HHHHHHHHHCCCCCCEEECC-CEEECCCCCCCCCCCCCHHHHHHH
Q ss_conf             99999997408888602054-112048741244568798999999
Q gi|254780485|r  215 IDMLLTLANLSTPPESIPIN-LLIPIPGSKFEENKKVDPIEHVRI  258 (328)
Q Consensus       215 i~~l~~lr~l~~~~~~v~~~-~~~p~~gt~l~~~~~~~~~e~lr~  258 (328)
                      ++.|..||+.+.  +.+.+. .+.|-.. -+.-..-.+|+|+..+
T Consensus       231 ~e~m~DLr~~gv--dilTiGQYlqPS~~-HlpV~ryv~PeeF~~~  272 (306)
T COG0320         231 IEVMDDLRSAGV--DILTIGQYLQPSRK-HLPVQRYVTPEEFDEL  272 (306)
T ss_pred             HHHHHHHHHCCC--CEEEECCCCCCCCC-CCCCEECCCHHHHHHH
T ss_conf             999999998599--89973001477624-5883321188999999


No 25 
>cd01335 Radical_SAM Radical SAM superfamily. Enzymes of this family generate radicals by combining a 4Fe-4S cluster and S-adenosylmethionine (SAM) in close proximity. They are characterized by a conserved CxxxCxxC motif, which coordinates the conserved iron-sulfur cluster. Mechanistically, they share the transfer of a single electron from the iron-sulfur cluster to SAM, which leads to its reductive cleavage to methionine and a 5'-deoxyadenosyl radical, which, in turn, abstracts a hydrogen from the appropriately positioned carbon atom. Depending on the enzyme, SAM is consumed during this process or it is restored and reused. Radical SAM enzymes catalyze steps in metabolism, DNA repair, the biosynthesis of vitamins and coenzymes, and the biosynthesis of many antibiotics. Examples are biotin synthase (BioB), lipoyl synthase (LipA), pyruvate formate-lyase (PFL), coproporphyrinogen oxidase (HemN), lysine 2,3-aminomutase (LAM), anaerobic ribonucleotide reductase (ARR), and  MoaA, an enzyme o
Probab=99.83  E-value=1.5e-18  Score=144.08  Aligned_cols=198  Identities=22%  Similarity=0.408  Sum_probs=146.5

Q ss_pred             EEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCCCCH-HHHHHHHHHHCCCC
Q ss_conf             45307868342321243354777564100068579999999999649838997303688874428-99999887621368
Q gi|254780485|r   58 LNIKTGGCPENCGYCNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDL-SIIVDMIKGVKSLG  136 (328)
Q Consensus        58 in~~TN~C~~~C~fCaf~~~~~~~~~~~~~~~~Eei~~~a~~~~~~G~~~~~l~~~~~~~~~~~~-~~~~e~i~~i~~~~  136 (328)
                      +++ |+.|+.+|.||.+...+...  .......+++.+.++.....|...+.+.++ .+....++ +.+..+.+......
T Consensus         1 i~~-srGC~~~C~fC~~~~~~~~~--~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g-~~~~~~~~~~~l~~~~~~~~~~~   76 (204)
T cd01335           1 LEL-TRGCNLNCGFCSNPASKGRG--PESPPEIEEILDIVLEAKERGVEVVILTGG-EPLLYPELAELLRRLKKELPGFE   76 (204)
T ss_pred             CCC-CCCCCCCCCCCCCCCCCCCC--CCCCCCHHHHHHHHHHHHHCCCEEEEEECC-CCCCCCCCCHHHHHHHHCCCCCE
T ss_conf             921-63738569879987547987--566788999999999998759869997246-76666532101354553068717


Q ss_pred             CCEEEECCCCCHHHHHHHHCCCCCEEEEECCC-CHHHHHCCC-CCCCHHHHHHHHHHHHHCCCCCCCEEEECC-CCCHHH
Q ss_conf             83241025699999998741576069751343-777732058-888989999999999987985577078668-989999
Q gi|254780485|r  137 LETCMTLGMLSFEQAQILSKAGLDYYNHNIDT-SERFYPHVT-TTHTFEDRLQTLENVRKSGIKVCCGGILGL-GEMIDD  213 (328)
Q Consensus       137 ~~i~~~~g~~~~~~~~~Lk~aG~~~~~~~let-~~~~~~~~~-~~~~~~~~l~~~~~a~~~G~~~~sg~l~G~-gEt~ee  213 (328)
                      ..+..+...++++.++.|+++|...+.+.+|+ +++.+..+. +.++++++++.++.+++.|+.+++++|+|+ +||.++
T Consensus        77 i~~~t~~~~~~~~~l~~l~~~g~~~~~i~les~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~i~G~p~et~~~  156 (204)
T cd01335          77 ISIETNGTLLTEELLKELKELGLDGVGVSLDSGDEEVADKIRGSGESFKERLEALKELREAGLGLSTTLLVGLGDEDEED  156 (204)
T ss_pred             EEEEECCCCCCHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHCCCCCHHHHHHHHHHHHHCCCEEEEEEEECCCCCCHHH
T ss_conf             99983365476999877540375422224356899999998488997599999999998679989999998279999999


Q ss_pred             HHHHHHHHHHCCCCCCEEECCCEEECCCCCCCCCCCC-CHHHHHHHHH
Q ss_conf             9999999974088886020541120487412445687-9899999999
Q gi|254780485|r  214 RIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKV-DPIEHVRIIS  260 (328)
Q Consensus       214 ri~~l~~lr~l~~~~~~v~~~~~~p~~gt~l~~~~~~-~~~e~lr~iA  260 (328)
                      ..+.+..+.++.. +..+.+++|.|.+|||++...+. +..+++++++
T Consensus       157 ~~~~~~~~~~~~~-~~~~~~~~~~p~~gt~~~~~~~~~~~~~~~~~~~  203 (204)
T cd01335         157 DLEELELLAEFRS-PDRVSLFRLLPEEGTPLELAAPVVPAEKLLRLIA  203 (204)
T ss_pred             HHHHHHHHHHHCC-CCEEEEEEEECCCCCCHHHCCCCCCHHHHHHHHH
T ss_conf             9999999985189-9889898766228980333879799999999861


No 26 
>smart00729 Elp3 Elongator protein 3, MiaB family, Radical SAM. This superfamily contains MoaA, NifB, PqqE, coproporphyrinogen III oxidase, biotin synthase and MiaB families, and includes a representative in the eukaryotic elongator subunit, Elp-3. Some members of the family are methyltransferases.
Probab=99.82  E-value=1.1e-18  Score=144.93  Aligned_cols=186  Identities=26%  Similarity=0.425  Sum_probs=140.9

Q ss_pred             EEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCEEE-----EEECCCCCCC-CCCHHHHHHHHH
Q ss_conf             6453078683423212433547775641000685799999999996498389-----9730368887-442899999887
Q gi|254780485|r   57 LLNIKTGGCPENCGYCNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRY-----CMGAAWREPK-ERDLSIIVDMIK  130 (328)
Q Consensus        57 ~in~~TN~C~~~C~fCaf~~~~~~~~~~~~~~~~Eei~~~a~~~~~~G~~~~-----~l~~~~~~~~-~~~~~~~~e~i~  130 (328)
                      .+.. |..|+.+|.||+++....    .+...+.+.+.++++...+.|...+     .+..+..... ...+..+++.++
T Consensus         4 ~~~~-sRGC~~~C~fC~~~~~~~----~~~~~~~~~i~~ei~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~   78 (216)
T smart00729        4 LYII-TRGCPRRCTFCSFPSARG----KLRSRYLEALVREIELLAEKGEKEILVGTVFIGGGTPTLLSPEQLEELLEAIR   78 (216)
T ss_pred             EEEE-ECCCCCCCCCCCCCCCCC----CCCCCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCCCHHHHHHHHHHHH
T ss_conf             9999-878198484298175889----64575999999999999970897653001100246898889999999999999


Q ss_pred             HHCCC----CCCEEEECCCCCHHHHHHHHCCCCCEEEEECCC-CHHHHHCCCCCCCHHHHHHHHHHHHHCC-CCCCCEEE
Q ss_conf             62136----883241025699999998741576069751343-7777320588889899999999999879-85577078
Q gi|254780485|r  131 GVKSL----GLETCMTLGMLSFEQAQILSKAGLDYYNHNIDT-SERFYPHVTTTHTFEDRLQTLENVRKSG-IKVCCGGI  204 (328)
Q Consensus       131 ~i~~~----~~~i~~~~g~~~~~~~~~Lk~aG~~~~~~~let-~~~~~~~~~~~~~~~~~l~~~~~a~~~G-~~~~sg~l  204 (328)
                      .....    ...+.+++..++++.++.|+++|++.+.+++|| +++..+.+.+++++++.++.++.+++.| +.+++++|
T Consensus        79 ~~~~~~~~~~~~~~~~~~~~~~e~l~~l~~~g~~~v~~giEs~~~~~l~~i~k~~~~~~~~~~i~~~~~~g~~~~~~~~i  158 (216)
T smart00729       79 EILGLADDVEITIETRPGTLTEELLEALKEAGVNRVSLGVQSGSDEVLKAINRGHTVEDVLEAVEKLREAGPIKVSTDLI  158 (216)
T ss_pred             HHCCCCCCEEEEEECCCCCCCHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHCCCCCHHHHHHHHHHHHHHCCCEEEEEEE
T ss_conf             85143562699997060215899999999849986666735507899987179999999999999999858936877578


Q ss_pred             ECC-CCCHHHHHHHHHHHHHCCCCCCEEECCCEEECCCCCCCCCCC
Q ss_conf             668-989999999999997408888602054112048741244568
Q gi|254780485|r  205 LGL-GEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKK  249 (328)
Q Consensus       205 ~G~-gEt~eeri~~l~~lr~l~~~~~~v~~~~~~p~~gt~l~~~~~  249 (328)
                      +|+ +||.++..+.+..+.+++.  +.+.+++|.|.|||||.....
T Consensus       159 ~GlP~et~e~~~~t~~~~~~~~~--~~i~~~~~~p~pgT~~~~~~~  202 (216)
T smart00729      159 VGLPGETEEDFEETLKLLKELGP--DRVSIFPLSPRPGTPLAKLYK  202 (216)
T ss_pred             ECCCCCCHHHHHHHHHHHHHCCC--CEEEEECCEECCCCHHHHCCC
T ss_conf             67999999999999999994691--989987487569984665016


No 27 
>PRK12928 lipoyl synthase; Provisional
Probab=99.82  E-value=2.2e-18  Score=142.92  Aligned_cols=190  Identities=20%  Similarity=0.307  Sum_probs=148.3

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCEEEEEECCCCCC-CCCCHHHHHHHHHHHCCCCCCEE
Q ss_conf             78683423212433547775641000685799999999996498389973036888-74428999998876213688324
Q gi|254780485|r   62 TGGCPENCGYCNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREP-KERDLSIIVDMIKGVKSLGLETC  140 (328)
Q Consensus        62 TN~C~~~C~fCaf~~~~~~~~~~~~~~~~Eei~~~a~~~~~~G~~~~~l~~~~~~~-~~~~~~~~~e~i~~i~~~~~~i~  140 (328)
                      -++|+.+|.||+-....    +  ..++.+|-.+.|+.+..+|.++++|.+..+++ ++.-...+.+.|+.|++..+.+.
T Consensus        67 Gd~CTR~C~FC~V~tg~----P--~~lD~~EP~rvA~av~~m~LkyvVITSV~RDDL~DgGA~hfa~~I~~Ir~~~P~~~  140 (290)
T PRK12928         67 GSICTRRCAFCQVAKGR----P--MPLDPDEPERVAEAVAALGLRYVVLTSVARDDLPDGGAAHFVATIAAIRARNPGTG  140 (290)
T ss_pred             CCCCCCCCCCCCCCCCC----C--CCCCHHHHHHHHHHHHHHCCCEEEEEEECCCCCCCCCHHHHHHHHHHHHHHCCCCE
T ss_conf             78635489851553799----8--98980347999999998389768984123678866452999999999984599867


Q ss_pred             EECCCC----CHH-HHHHHHCCCCCEEEEECCCCHHHHHCCCCCCCHHHHHHHHHHHHHC--CCCCCCEEEECCCCCHHH
Q ss_conf             102569----999-9998741576069751343777732058888989999999999987--985577078668989999
Q gi|254780485|r  141 MTLGML----SFE-QAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKS--GIKVCCGGILGLGEMIDD  213 (328)
Q Consensus       141 ~~~g~~----~~~-~~~~Lk~aG~~~~~~~let~~~~~~~~~~~~~~~~~l~~~~~a~~~--G~~~~sg~l~G~gEt~ee  213 (328)
                      +.+-..    ..+ .+..+.+++.+-++||+||.|++|+.++|..+|++-|++++.|++.  |+.+-||+|+|+|||.+|
T Consensus       141 iEvLiPDF~G~~~~al~~v~~a~pdV~nHNiETV~rL~~~VRp~A~Y~rSL~vL~~ak~~~~~i~TKSgiMvGLGEt~eE  220 (290)
T PRK12928        141 IEVLTPDFWGGVARALATVLAAKPDCFNHNLETVPRLQKAVRRGADYQRSLDLLARAKELAPGIPTKSGLMLGLGETEDE  220 (290)
T ss_pred             EEEECHHHCCCHHHHHHHHHHCCCHHHHCCCCCCHHHCCCCCCCCHHHHHHHHHHHHHHHCCCCEEEEEEEEECCCCHHH
T ss_conf             99707111368789999998468546545501204317124885508999999999997388852413458860588999


Q ss_pred             HHHHHHHHHHCCCCCCEEECC-CEEECCCCCCCCCCCCCHHHH--HHHHH
Q ss_conf             999999997408888602054-112048741244568798999--99999
Q gi|254780485|r  214 RIDMLLTLANLSTPPESIPIN-LLIPIPGSKFEENKKVDPIEH--VRIIS  260 (328)
Q Consensus       214 ri~~l~~lr~l~~~~~~v~~~-~~~p~~gt~l~~~~~~~~~e~--lr~iA  260 (328)
                      +++.|..||+.+.  +.+.+. .+.|-+. -+.-..-.+|+++  ++-+|
T Consensus       221 v~~~~~DLr~~gv--dilTiGQYL~Ps~~-h~pV~ryv~P~eF~~~~~~a  267 (290)
T PRK12928        221 VIETLRDLRAVDC--DRLTIGQYLRPSLA-HLPVQRYWTPEEFEALGQIA  267 (290)
T ss_pred             HHHHHHHHHHCCC--CEEEECCCCCCCCC-CCCCEECCCHHHHHHHHHHH
T ss_conf             9999999998199--89982402588866-68833356989999999999


No 28 
>pfam06968 BATS Biotin and Thiamin Synthesis associated domain. Biotin synthase (BioB), EC:2.8.1.6, catalyses the last step of the biotin biosynthetic pathway. The reaction consists in the introduction of a sulphur atom into dethiobiotin. BioB functions as a homodimer. Thiamin synthesis if a complex process involving at least six gene products (ThiFSGH, ThiI and ThiJ). Two of the proteins required for the biosynthesis of the thiazole moiety of thiamine (vitamin B(1)) are ThiG and ThiH (this family) and form a heterodimer. Both of these reactions are thought of involve the binding of co-factors, and both function as dimers. This domain therefore may be involved in co-factor binding or dimerization (Finn, RD personal observation).
Probab=99.81  E-value=1.1e-19  Score=151.47  Aligned_cols=93  Identities=41%  Similarity=0.695  Sum_probs=87.7

Q ss_pred             ECCCEEECCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCEEEEHHHHHCHHHHHHHHHHCCCEEEECCEEECCCCCCHH
Q ss_conf             05411204874124456879899999999999968687214231156516568999998099889977866515888989
Q gi|254780485|r  232 PINLLIPIPGSKFEENKKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYN  311 (328)
Q Consensus       232 ~~~~~~p~~gt~l~~~~~~~~~e~lr~iAi~RL~lP~~~i~i~~~~~~~~~~~~~~~L~~GaN~~~~g~~~~t~~g~~~~  311 (328)
                      |+|+++|++|||+++.++++++|.+|+||++||++|++.|+++++|+....+.+.+++.+||||+++|+|++|++.++++
T Consensus         1 piN~L~P~~Gtpl~~~~~l~~~e~l~~ia~~Rl~~P~~~irla~gre~~l~d~~~~~~~sgans~~~G~yltt~g~r~~~   80 (93)
T pfam06968         1 PINFLRPIEGTPLEDQPPLSDEEALKTIAAFRLLLPDAGIRLSGGREALLRDLQGLAFMSGANSTFVGGYLTTSGNRSPD   80 (93)
T ss_pred             CCCEECCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHCCCEEEECCCEECCCCCCHH
T ss_conf             95130258999888999999999999999999986995289727962122515999998305304787835428999889


Q ss_pred             HHHHHHHHCCCCC
Q ss_conf             9999999829853
Q gi|254780485|r  312 KDTILFNRLGLIP  324 (328)
Q Consensus       312 ~~~~~i~~~G~~P  324 (328)
                      +|++||+++||+|
T Consensus        81 ~d~~mi~~~G~~p   93 (93)
T pfam06968        81 EDIAMLKDLGLEP   93 (93)
T ss_pred             HHHHHHHHCCCCC
T ss_conf             9999999859999


No 29 
>TIGR03471 HpnJ hopanoid biosynthesis associated radical SAM protein HpnJ. One of the well-described hopanoid intermediates is bacteriohopanetetrol. In the conversion from hopene several reactions must occur in the side chain for which a radical mechanism might be reasonable. These include the four (presumably anaerobic) hydroxylations and a methyl shift.
Probab=99.80  E-value=1.4e-17  Score=137.38  Aligned_cols=178  Identities=20%  Similarity=0.322  Sum_probs=141.6

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHC--CCEEEEEECCCCCCCCCCHHHHHHHHHHHCCCCCCE
Q ss_conf             786834232124335477756410006857999999999964--983899730368887442899999887621368832
Q gi|254780485|r   62 TGGCPENCGYCNQSVHNKSKLKASKLINVDQVLKEAKNAKEN--GATRYCMGAAWREPKERDLSIIVDMIKGVKSLGLET  139 (328)
Q Consensus        62 TN~C~~~C~fCaf~~~~~~~~~~~~~~~~Eei~~~a~~~~~~--G~~~~~l~~~~~~~~~~~~~~~~e~i~~i~~~~~~i  139 (328)
                      |-.|+.+|.||......  ....++..|+|.|+++.+.+.+.  |++++.+.-..   ...+-.+..++++.+++.++..
T Consensus       203 SRGCP~~C~FC~~p~~~--~Gr~~R~RSpe~VvdEIe~l~~~y~gv~~~~f~DD~---Ft~~~~r~~eic~~i~~l~i~W  277 (472)
T TIGR03471       203 GRGCPSKCTFCLWPQTV--GGHRYRTRSAESVIEEVKYALENFPEVREFFFDDDT---FTDDKPRAEEIARKLGPLGVTW  277 (472)
T ss_pred             CCCCCCCCCCCCCCCCC--CCCCCCCCCHHHHHHHHHHHHHHCCCCCEEEEECCC---CCCCHHHHHHHHHHHHHCCCEE
T ss_conf             79988779687882102--688662159999999999999866897589994776---6789999999999998769827


Q ss_pred             EEEC-CCCCHHHHHHHHCCCCCEEEEECCC-CHHHHHCCCCCCCHHHHHHHHHHHHHCCCCCCCEEEECC-CCCHHHHHH
Q ss_conf             4102-5699999998741576069751343-777732058888989999999999987985577078668-989999999
Q gi|254780485|r  140 CMTL-GMLSFEQAQILSKAGLDYYNHNIDT-SERFYPHVTTTHTFEDRLQTLENVRKSGIKVCCGGILGL-GEMIDDRID  216 (328)
Q Consensus       140 ~~~~-g~~~~~~~~~Lk~aG~~~~~~~let-~~~~~~~~~~~~~~~~~l~~~~~a~~~G~~~~sg~l~G~-gEt~eeri~  216 (328)
                      .++. ..++++.++.|++||...+.+++|+ +++..+.+.++.+.++-.++++.+|++||.+.+.+|+|+ |||.|+.-+
T Consensus       278 ~~~~Rv~~d~E~l~~mk~AGc~~v~~GiESgsq~iL~~i~K~~t~e~~~~av~~~k~~GI~v~~~FIiG~PgET~Eti~~  357 (472)
T TIGR03471       278 SCNARANVDYETLKVMKENGLRLLLVGYESGDQQILKNIKKGLTVEIARRFTRDCHKLGIKVHGTFILGLPGETRETIRK  357 (472)
T ss_pred             EEEEECCCCHHHHHHHHHHCCEEEEEECCCCCHHHHHHHCCCCCHHHHHHHHHHHHHCCCEEEEEEEECCCCCCHHHHHH
T ss_conf             87630348999999999839848998037589999998538998999999999887579879999987799998899999


Q ss_pred             HHHHHHHCCCCCCEEECCCEEECCCCCCCC
Q ss_conf             999997408888602054112048741244
Q gi|254780485|r  217 MLLTLANLSTPPESIPINLLIPIPGSKFEE  246 (328)
Q Consensus       217 ~l~~lr~l~~~~~~v~~~~~~p~~gt~l~~  246 (328)
                      .+...++++.  +.+.++.++|.|||+|-+
T Consensus       358 Ti~fa~~l~~--d~~~~si~tPyPGT~ly~  385 (472)
T TIGR03471       358 TIDFAKELNP--HTIQVSLAAPYPGTELYD  385 (472)
T ss_pred             HHHHHHHCCC--CEEEEEEECCCCCCHHHH
T ss_conf             9999997598--908998725889969999


No 30 
>smart00876 BATS Biotin and Thiamin Synthesis associated domain. Biotin synthase (BioB), , catalyses the last step of the biotin biosynthetic pathway. The reaction consists in the introduction of a sulphur atom into dethiobiotin. BioB functions as a homodimer PUBMED:12482614. Thiamin synthesis if a complex process involving at least six gene products (ThiFSGH, ThiI and ThiJ). Two of the proteins required for the biosynthesis of the thiazole moiety of thiamine (vitamin B(1)) are ThiG and ThiH (this entry) and form a heterodimerPUBMED:12650933. Both of these reactions are thought of involve the binding of co-factors, and both function as dimers PUBMED:12482614, PUBMED:12650933. This domain therefore may be involved in co-factor binding or dimerisation.
Probab=99.76  E-value=2.7e-18  Score=142.31  Aligned_cols=93  Identities=45%  Similarity=0.784  Sum_probs=85.4

Q ss_pred             ECCCEEECCCCCCCCC-CCCCHHHHHHHHHHHHHHCCCCCCEEEEHHHHHCHHHHHHHHHHCCCEEEECCEEECCCCCCH
Q ss_conf             0541120487412445-687989999999999996868721423115651656899999809988997786651588898
Q gi|254780485|r  232 PINLLIPIPGSKFEEN-KKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSY  310 (328)
Q Consensus       232 ~~~~~~p~~gt~l~~~-~~~~~~e~lr~iAi~RL~lP~~~i~i~~~~~~~~~~~~~~~L~~GaN~~~~g~~~~t~~g~~~  310 (328)
                      |+|+|+|++||||++. +++++.|.+|+||++||++|++.|+++++|+.+.++.+..+|.+|||++|.|+.++|+.|.+.
T Consensus         1 pin~l~P~~Gtple~~~~~~~~~e~lk~ia~~Rl~~P~~~I~la~gr~~~~~~~~~~~l~aGan~~~~G~~~ltt~g~~~   80 (94)
T smart00876        1 PINRLRPIEGTPLEDPPPPVSPEEFLRTIAAARLALPDAGIRLSTGREALLRDLQALCFSAGANSIFGGDKYLTTSGPRS   80 (94)
T ss_pred             CCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCEEEECCCCCCCHHHHHHHHHHCCCCHHCCCCCCCCCCCCH
T ss_conf             96601368999778788999999999999999998699637973781200575899999834721404763307899587


Q ss_pred             HHHHHHHHHCCCCC
Q ss_conf             99999999829853
Q gi|254780485|r  311 NKDTILFNRLGLIP  324 (328)
Q Consensus       311 ~~~~~~i~~~G~~P  324 (328)
                      .+|++||+++|++|
T Consensus        81 ~~d~~~i~~~G~~~   94 (94)
T smart00876       81 ADDVAMLEKLGLEP   94 (94)
T ss_pred             HHHHHHHHHCCCCC
T ss_conf             89999999859999


No 31 
>COG1856 Uncharacterized homolog of biotin synthetase [Function unknown]
Probab=99.76  E-value=2.4e-16  Score=129.25  Aligned_cols=230  Identities=20%  Similarity=0.320  Sum_probs=175.2

Q ss_pred             EEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCCCCHHHHHHHHHHHCCC-
Q ss_conf             6453078683423212433547775641000685799999999996498389973036888744289999988762136-
Q gi|254780485|r   57 LLNIKTGGCPENCGYCNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSL-  135 (328)
Q Consensus        57 ~in~~TN~C~~~C~fCaf~~~~~~~~~~~~~~~~Eei~~~a~~~~~~G~~~~~l~~~~~~~~~~~~~~~~e~i~~i~~~-  135 (328)
                      .|.+.-++|..||..|+  +++-..--   ..+.+++++...++.+.|...+.+.+|......-+++.|-+.++.+++. 
T Consensus        13 sISVTG~yC~lnC~HCg--~~~L~~Mi---~vt~~~l~k~~~el~kkGy~g~llSGGm~srg~VPl~kf~d~lK~lke~~   87 (275)
T COG1856          13 SISVTGAYCSLNCPHCG--RHYLEHMI---KVTTKSLLKRCMELEKKGYEGCLLSGGMDSRGKVPLWKFKDELKALKERT   87 (275)
T ss_pred             EEEEECCCEEECCHHHH--HHHHHHHC---CCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCCCCHHHHHHHHHHHHHHH
T ss_conf             37886363575381777--99998752---53257788899999845760589757868799742899999999987753


Q ss_pred             CCCEEEECCCCCHHHHHHHHCCCCCEEEEECCC----CHHHHHCCCCCCCHHHHHHHHHHHHHCCCCCCCEEEECCC-CC
Q ss_conf             883241025699999998741576069751343----7777320588889899999999999879855770786689-89
Q gi|254780485|r  136 GLETCMTLGMLSFEQAQILSKAGLDYYNHNIDT----SERFYPHVTTTHTFEDRLQTLENVRKSGIKVCCGGILGLG-EM  210 (328)
Q Consensus       136 ~~~i~~~~g~~~~~~~~~Lk~aG~~~~~~~let----~~~~~~~~~~~~~~~~~l~~~~~a~~~G~~~~sg~l~G~g-Et  210 (328)
                      ++.+.++.|...++.+.+||++++|-+.+.+=.    ..+.|..   ..+.++.++.++...+.|+++-.++++|+- -.
T Consensus        88 ~l~inaHvGfvdE~~~eklk~~~vdvvsLDfvgDn~vIk~vy~l---~ksv~dyl~~l~~L~e~~irvvpHitiGL~~gk  164 (275)
T COG1856          88 GLLINAHVGFVDESDLEKLKEELVDVVSLDFVGDNDVIKRVYKL---PKSVEDYLRSLLLLKENGIRVVPHITIGLDFGK  164 (275)
T ss_pred             CEEEEEEEEECCHHHHHHHHHHCCCEEEEEECCCHHHHHHHHCC---CCCHHHHHHHHHHHHHCCCEECEEEEEEECCCC
T ss_conf             74899985100178899998716868998612774899999768---863777788999999709425305999731685


Q ss_pred             HHHHHHHHHHHHHCCCCCCEEECCCEEECCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCEEEEHHH--HHCHHHHHHH
Q ss_conf             99999999999740888860205411204874124456879899999999999968687214231156--5165689999
Q gi|254780485|r  211 IDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEHVRIISVARILMPKSRLRLAAGRA--MMSDELQALC  288 (328)
Q Consensus       211 ~eeri~~l~~lr~l~~~~~~v~~~~~~p~~gt~l~~~~~~~~~e~lr~iAi~RL~lP~~~i~i~~~~~--~~~~~~~~~~  288 (328)
                      .+.-.+.+..|.+  ..++.+-+..|+|.+||.|...++++++|..+.+--+|=.+|+ .+.|.+.|.  ....+++..+
T Consensus       165 i~~e~kaIdiL~~--~~~DalVl~vliPtpGtkm~~~~pp~~eE~i~v~~~AR~~f~~-pv~iGCmrP~Ge~rvk~d~~a  241 (275)
T COG1856         165 IHGEFKAIDILVN--YEPDALVLVVLIPTPGTKMGNSPPPPVEEAIKVVKYARKKFPN-PVSIGCMRPRGEWRVKLDKEA  241 (275)
T ss_pred             CCCHHHHHHHHHC--CCCCEEEEEEEECCCCHHCCCCCCCCHHHHHHHHHHHHHHCCC-CEEEEECCCCCHHHHHHHHHH
T ss_conf             2333878899860--7997399999813885010577976989999999999985899-746741476753678788888


Q ss_pred             HHHCCCEEE
Q ss_conf             980998899
Q gi|254780485|r  289 FFSGANSIF  297 (328)
Q Consensus       289 L~~GaN~~~  297 (328)
                      ..+|+|.|-
T Consensus       242 v~~gVd~It  250 (275)
T COG1856         242 VLAGVDRIT  250 (275)
T ss_pred             HHCCCCEEE
T ss_conf             871885044


No 32 
>PRK08207 coproporphyrinogen III oxidase; Provisional
Probab=99.73  E-value=7.8e-15  Score=119.06  Aligned_cols=242  Identities=19%  Similarity=0.218  Sum_probs=163.9

Q ss_pred             CCCCHHHHHHHHCC----CH--HHHHHHHHHHHHHHC-----CCCEEEEEEEEEECCCCCCCCCCCCCCCCCC----CCC
Q ss_conf             47899999999739----91--899999999988862-----8985699986453078683423212433547----775
Q gi|254780485|r   17 KVWTSKEVFQIYNM----PF--NDLLFWSHTVHRKNF-----EPNHIQLSKLLNIKTGGCPENCGYCNQSVHN----KSK   81 (328)
Q Consensus        17 e~ls~eea~~L~~~----~~--~el~~~Aa~~~r~~~-----~g~~V~~~~~in~~TN~C~~~C~fCaf~~~~----~~~   81 (328)
                      +.+|.+|+...|..    .+  .+|+...+..-+.-.     ..+.+.+..+|-    .|+..|.||+|....    +..
T Consensus       127 ~g~~~~~i~~~l~~~y~vs~eK~~L~~~ia~~e~~~l~~~~~~~~~~SLYIHIP----FC~~kC~YCdF~s~~i~~~~~~  202 (497)
T PRK08207        127 EGMSEEEIHEELKEEYLIREEKAELLQEVAKRELSFVPDLNKDKNEVSIYIGIP----FCPTRCLYCSFPSYPINGRKGL  202 (497)
T ss_pred             CCCCHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEEEEC----CCCCCCCCCCCCCCCCCCCCCC
T ss_conf             489999999999998668999999999999999987512323788479999818----9589878999803115776331


Q ss_pred             CCCCCCCCHHHHHHHHHHHHHCC--CEEEEEECCCCCCCCCCHHHHHHHHHHHCCCC------CCEEEE---CCCCCHHH
Q ss_conf             64100068579999999999649--83899730368887442899999887621368------832410---25699999
Q gi|254780485|r   82 LKASKLINVDQVLKEAKNAKENG--ATRYCMGAAWREPKERDLSIIVDMIKGVKSLG------LETCMT---LGMLSFEQ  150 (328)
Q Consensus        82 ~~~~~~~~~Eei~~~a~~~~~~G--~~~~~l~~~~~~~~~~~~~~~~e~i~~i~~~~------~~i~~~---~g~~~~~~  150 (328)
                      ...|...-..||...+......|  +..+.++  |++|.....+.+..++..+++.+      .++.+.   ++.++.+.
T Consensus       203 v~~Yl~aL~kEI~~~~~~l~~~~~~i~TIY~G--GGTPS~Ls~~ql~~ll~~i~~~F~~~~~~~EiTvEanRPdtit~ek  280 (497)
T PRK08207        203 VEPYLEALHYEIEEIGKYLKEKGLKIETIYFG--GGTPTSITAEEFEKLLEEIYESFPDVKNVKEFTVEAGRPDTITEEK  280 (497)
T ss_pred             HHHHHHHHHHHHHHHHHHHHCCCCEECEEEEC--CCCCCCCCHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCCCCHHH
T ss_conf             99999999999999998762379803569979--9810029999999999999986576899977999787989629999


Q ss_pred             HHHHHCCCCCEEEEECCC-CHHHHHCCCCCCCHHHHHHHHHHHHHCCC-CCCCEEEECC-CCCHHHHHHHHHHHHHCCCC
Q ss_conf             998741576069751343-77773205888898999999999998798-5577078668-98999999999999740888
Q gi|254780485|r  151 AQILSKAGLDYYNHNIDT-SERFYPHVTTTHTFEDRLQTLENVRKSGI-KVCCGGILGL-GEMIDDRIDMLLTLANLSTP  227 (328)
Q Consensus       151 ~~~Lk~aG~~~~~~~let-~~~~~~~~~~~~~~~~~l~~~~~a~~~G~-~~~sg~l~G~-gEt~eeri~~l~~lr~l~~~  227 (328)
                      ++.|+++|++++.+++.| .+.....+...|+.++-.++.+.|+++|+ .++.-+|+|+ |||.++..+.|..+.+|.  
T Consensus       281 L~~lk~~GvnRiSiGvQSf~~~~Lk~lGR~Ht~~~~~~a~~~ar~~GF~nIN~DLI~GLPgqt~~~~~~tL~~i~~L~--  358 (497)
T PRK08207        281 LEVLKKYNVDRISINPQSMNDETLKAIGRHHTVEDIIEKFHLARELGFDNINMDLIIGLPGEGLEEFKHTLEEIEKLM--  358 (497)
T ss_pred             HHHHHHCCCCEEEEECCCCCHHHHHHHCCCCCHHHHHHHHHHHHHCCCCEEEEEEECCCCCCCHHHHHHHHHHHHHCC--
T ss_conf             999997598758883532998999981899999999999999998599849774353799999999999999998139--


Q ss_pred             CCEEECCCEEECCCCCCCCCC----CCCHHHHHHHHHHHHHHC
Q ss_conf             860205411204874124456----879899999999999968
Q gi|254780485|r  228 PESIPINLLIPIPGSKFEENK----KVDPIEHVRIISVARILM  266 (328)
Q Consensus       228 ~~~v~~~~~~p~~gt~l~~~~----~~~~~e~lr~iAi~RL~l  266 (328)
                      |+.+++--|.-..+++|....    .++.++..+++..++-++
T Consensus       359 Pd~iTvhsLaikr~s~l~~~~~~~~l~~~~~~~~m~~~~~~~~  401 (497)
T PRK08207        359 PDSLTVHTLSIKRASRLTENKEKYKVADREEINAMMEEAEEWA  401 (497)
T ss_pred             CCEEEEEEEEECCCCHHHHCCCCCCCCCHHHHHHHHHHHHHHH
T ss_conf             9825876665546860222455668998589999999999999


No 33 
>TIGR02666 moaA molybdenum cofactor biosynthesis protein A; InterPro: IPR013483   The majority of molybdenum-containing enzymes utilise a molybdenum cofactor (MoCF or Moco) consisting of a Mo atom coordinated via a cisdithiolene moiety to molybdopterin (MPT). MoCF is ubiquitous in nature, and the pathway for MoCF biosynthesis is conserved in all three domains of life. MoCF-containing enzymes function as oxidoreductases in carbon, nitrogen, and sulphur metabolism , .    In Escherichia coli, biosynthesis of MoCF is a three stage process. It begins with the MoaA and MoaC conversion of GTP to the meta-stable pterin intermediate precursor Z. The second stage involves MPT synthase (MoaD and MoaE), which coverts precursor Z to MPT; MoeB is involved in the recycling of MPT synthase. The final step in MoCF synthesis is the attachment of mononuclear Mo to MPT, a process that requires MoeA and which is enhanced by MogA in an Mg2 ATP-dependent manner . MoCF is the active co-factor in eukaryotic and some prokaryotic molybdoenzymes, but the majority of bacterial enzymes requiring MoCF, need a modification of MTP for it to be active; MobA is involved in the attachment of a nucleotide monophosphate to MPT resulting in the MGD co-factor, the active co-factor for most prokaryotic molybdoenzymes. Bacterial two-hybrid studies have revealed the close interactions between MoeA, MogA, and MobA in the synthesis of MoCF . Moreover the close functional association of MoeA and MogA in the synthesis of MoCF is supported by fact that the known eukaryotic homologues to MoeA and MogA exist as fusion proteins: CNX1 () of Arabidopsis thaliana (Mouse-ear cress), mammalian Gephryin (e.g. Q9NQX3 from SWISSPROT) and Drosophila melanogaster (Fruit fly) Cinnamon (P39205 from SWISSPROT) .   This entry represents the bacterial form of MoaA (molybdenum cofactor biosynthesis protein A). The MoaA protein is a member of the wider S-adenosylmethionine(SAM)-dependent enzyme family which catalyze the formation of protein and/or substrate radicals by reductive cleavage of SAM via a [4Fe-4S] cluster. Monomeric and homodimeric forms of MoaA have been observed in vivo, and it is not clear what the physiologically relevant form of the enzyme is . The core of each monomer consists of an incomplete TIM barrel, formed by the N-terminal region of the protein, containing a [4Fe-4S] cluster. The C-terminal region of the protein, which also contains a [4Fe-4S] cluster consists of a beta-sheet covering the lateral opening of the barrel, an extended loop and three alpha helices. The N-terminal [4Fe-4S] cluster is coordinated with 3 cysteines and an exchangeable SAM molecule, while the C-terminal [4Fe-4S], also coordinated with 3 cysteines, is the binding and activation site for GTP .; GO: 0046872 metal ion binding, 0006777 Mo-molybdopterin cofactor biosynthetic process.
Probab=99.73  E-value=3e-15  Score=121.89  Aligned_cols=210  Identities=17%  Similarity=0.209  Sum_probs=158.1

Q ss_pred             CCCEEEEEEEEEECCCCCCCCCCCCCCCCC---CCCCCCCCCCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCCCCHHH
Q ss_conf             898569998645307868342321243354---77756410006857999999999964983899730368887442899
Q gi|254780485|r   48 EPNHIQLSKLLNIKTGGCPENCGYCNQSVH---NKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSI  124 (328)
Q Consensus        48 ~g~~V~~~~~in~~TN~C~~~C~fCaf~~~---~~~~~~~~~~~~~Eei~~~a~~~~~~G~~~~~l~~~~~~~~~~~~~~  124 (328)
                      +|..|++-+ |.+ |..|...|.||.=-..   .....++..+|+.|||.+-++.++..|++.|-| |||+|...+++..
T Consensus         5 fGR~~~YLR-iSv-TDRCNlRC~YCMP~~~FG~~~~f~~~~~~Lt~eEi~rl~~~~v~~Gv~KvRl-TGGEPLlR~~l~~   81 (346)
T TIGR02666         5 FGRRIDYLR-ISV-TDRCNLRCVYCMPEEGFGEGLDFLPKEELLTFEEIERLVRAFVGLGVRKVRL-TGGEPLLRKDLVE   81 (346)
T ss_pred             CCCEEEEEE-EEE-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCEEEEE-ECCCCCCCCCHHH
T ss_conf             677323577-876-1647872466688656788766787556689899999999999749716875-2777441367589


Q ss_pred             HHHHHHHHCCCC-CCEE-EECCCCCHHHHHHHHCCCCCEEEEECCC-CHHHHHCCCC-CCCHHHHHHHHHHHHHCCCC-C
Q ss_conf             999887621368-8324-1025699999998741576069751343-7777320588-88989999999999987985-5
Q gi|254780485|r  125 IVDMIKGVKSLG-LETC-MTLGMLSFEQAQILSKAGLDYYNHNIDT-SERFYPHVTT-THTFEDRLQTLENVRKSGIK-V  199 (328)
Q Consensus       125 ~~e~i~~i~~~~-~~i~-~~~g~~~~~~~~~Lk~aG~~~~~~~let-~~~~~~~~~~-~~~~~~~l~~~~~a~~~G~~-~  199 (328)
                      ++..++.+.... ..|+ .+.|.+-+..++.||+||++++|+.||| .|+.|.++.. ..+.++-|+.++.|.++|++ +
T Consensus        82 lv~~~~~~~g~~~~di~lTTNG~~L~~~a~~L~eAGL~rvNvSLDsLd~~~F~~It~~~~~l~~Vl~Gi~aA~~~Gl~~v  161 (346)
T TIGR02666        82 LVARLAALPGIEIEDIALTTNGLLLERHAKDLKEAGLKRVNVSLDSLDPERFAKITRRGGRLEQVLAGIDAALEAGLKPV  161 (346)
T ss_pred             HHHHHHHCCCCCCCEEEECCCHHHHHHHHHHHHHCCCCCEEEEEECCCHHHHHHHHCCCCCHHHHHHHHHHHHHCCCCCE
T ss_conf             99999842785433554100522358899999971888036540148889999985789988899999999996599831


Q ss_pred             CCEEEECCCCCHHHHHHHHHHHHHCCCCCCEEECCCEEECCCC-CC-CCCCCCCHHHHHHHHHHHH
Q ss_conf             7707866898999999999999740888860205411204874-12-4456879899999999999
Q gi|254780485|r  200 CCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGS-KF-EENKKVDPIEHVRIISVAR  263 (328)
Q Consensus       200 ~sg~l~G~gEt~eeri~~l~~lr~l~~~~~~v~~~~~~p~~gt-~l-~~~~~~~~~e~lr~iAi~R  263 (328)
                      --.+++==|=..+|+.+++...++-..+-=+|=++++   -.. .. ......+.+|.+.-+.-.-
T Consensus       162 KlN~V~~~G~Nd~Ei~~l~~~~~~~~~~lRFIE~MP~---G~~~~~~~~~~~~~~~~~l~~~~~~~  224 (346)
T TIGR02666       162 KLNTVVLRGVNDDEIVDLAEFAKERGVTLRFIELMPL---GEGGNGWRGKEFVSADEILERLEQAF  224 (346)
T ss_pred             EEEEEECCCCCHHHHHHHHHHHHHCCCEEEEEEECCC---CCCCCCCCCCCCCCHHHHHHHHHHHC
T ss_conf             4766762788977899999999757960788751546---76300000034535899999999743


No 34 
>TIGR01212 TIGR01212 radical SAM protein, TIGR01212 family; InterPro: IPR005911    This uncharacterised protein family shows significant similarity to IPR005910 from INTERPRO, a longer protein that is a histone acetyltransferase at its C-terminus and is a subunit of RNA polymerase II (in yeast). This family lacks the GNAT acetyltransferase domain..
Probab=99.72  E-value=3.2e-15  Score=121.64  Aligned_cols=229  Identities=19%  Similarity=0.352  Sum_probs=171.1

Q ss_pred             HHHHHHHCCCCEEE-EEEEEEECCCCCCCC--------CCCCCCCCCCCCC--CCCCCCCCHHHHHHHHHHHHHCCCEEE
Q ss_conf             99988862898569-998645307868342--------3212433547775--641000685799999999996498389
Q gi|254780485|r   40 HTVHRKNFEPNHIQ-LSKLLNIKTGGCPEN--------CGYCNQSVHNKSK--LKASKLINVDQVLKEAKNAKENGATRY  108 (328)
Q Consensus        40 a~~~r~~~~g~~V~-~~~~in~~TN~C~~~--------C~fCaf~~~~~~~--~~~~~~~~~Eei~~~a~~~~~~G~~~~  108 (328)
                      .+..+++| |.+|+ +..+.-| |  |+|.        |.||.-...+.--  .......-.|+|.+.++...+.|+..+
T Consensus         6 ~~ylk~~y-G~kV~Ki~~~gGF-~--CPNRDGT~G~GGCtfC~~a~~~~f~~~~~~~~~~~~~~i~~~~~~~~k~G~kkf   81 (307)
T TIGR01212         6 GDYLKERY-GEKVFKITLHGGF-S--CPNRDGTIGRGGCTFCNDASKPSFADEVTQARIPIKEQIKKRKKKYKKDGIKKF   81 (307)
T ss_pred             HHHHHHHH-CCCEEEEEEECCC-C--CCCCCCCCCCCCEEECCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCEEE
T ss_conf             57999980-8944999864578-8--778887002577252178888852451023544689999999976531573157


Q ss_pred             EE--ECCCCCCCCCCHHHHHHHHHHHCCCCCCEEEECC----CCCHHH---HHHHHCCCCC-EEEEECCC-CHHHHHCCC
Q ss_conf             97--3036888744289999988762136883241025----699999---9987415760-69751343-777732058
Q gi|254780485|r  109 CM--GAAWREPKERDLSIIVDMIKGVKSLGLETCMTLG----MLSFEQ---AQILSKAGLD-YYNHNIDT-SERFYPHVT  177 (328)
Q Consensus       109 ~l--~~~~~~~~~~~~~~~~e~i~~i~~~~~~i~~~~g----~~~~~~---~~~Lk~aG~~-~~~~~let-~~~~~~~~~  177 (328)
                      .+  |+..+  ..-++|.+-++....-...--|.+++|    .+.++.   ++.+++-|.+ ++.++|.| +.+...++=
T Consensus        82 ~aYFQ~yTn--TYApve~Lk~~y~~aL~~~~vVGlsvgTRPDC~P~~VLDlL~ey~~~GyevWvELGLQtah~~TL~~IN  159 (307)
T TIGR01212        82 IAYFQAYTN--TYAPVEVLKEMYEQALSEDDVVGLSVGTRPDCVPDEVLDLLAEYKERGYEVWVELGLQTAHDRTLKKIN  159 (307)
T ss_pred             EEEECCCCC--CCHHHHHHHHHHHHHHHHCCEEEEEECCCCCCCHHHHHHHHHHHHHCCEEEEEECCCCCHHHHHHHHHC
T ss_conf             899738876--500268888999987632780577536889877478999999995497589996053565589999851


Q ss_pred             CCCCHHHHHHHHHHHHHCCCCCCCEEEECC-CCCHHHHHHHHHHHHHCCCCCCEEECCCEEECCCCCCCCC------CCC
Q ss_conf             888989999999999987985577078668-9899999999999974088886020541120487412445------687
Q gi|254780485|r  178 TTHTFEDRLQTLENVRKSGIKVCCGGILGL-GEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEEN------KKV  250 (328)
Q Consensus       178 ~~~~~~~~l~~~~~a~~~G~~~~sg~l~G~-gEt~eeri~~l~~lr~l~~~~~~v~~~~~~p~~gt~l~~~------~~~  250 (328)
                      ..|++.+.+++...+|+.||++|+++|+|+ ||+++|.++.+..+.+|+.  ++|-+-+|+=.+||+|+..      ..+
T Consensus       160 RgHd~~~y~~a~~~~~krGikVC~H~I~GLPgE~~~~~~eTak~~~~l~v--dGiKiH~LhvvkGt~m~k~Y~~G~~~~l  237 (307)
T TIGR01212       160 RGHDFACYVDAVKRARKRGIKVCSHVILGLPGEDREEMLETAKIVASLDV--DGIKIHPLHVVKGTKMAKQYEKGELKTL  237 (307)
T ss_pred             CCCCHHHHHHHHHHHHHCCCEEEEEEEECCCCCCHHHHHHHHHHHHHCCC--CEEEEEEEEEEECCHHHHHHHCCCEEEC
T ss_conf             43787899999999976598899998742898888899999999983798--8488720178735757887545740104


Q ss_pred             CHHHHHHHHH-HHHHHCCCCCCE-EEEH
Q ss_conf             9899999999-999968687214-2311
Q gi|254780485|r  251 DPIEHVRIIS-VARILMPKSRLR-LAAG  276 (328)
Q Consensus       251 ~~~e~lr~iA-i~RL~lP~~~i~-i~~~  276 (328)
                      +.+||...++ ..|+.=|++.++ |++.
T Consensus       238 ~~e~Y~~~~~d~le~lpP~vv~HRi~~d  265 (307)
T TIGR01212       238 SLEEYISLACDFLEHLPPEVVVHRISGD  265 (307)
T ss_pred             CHHHHHHHHHHHHHCCCCCEEEEEECCC
T ss_conf             7677999999998508985599841277


No 35 
>PRK13361 molybdenum cofactor biosynthesis protein A; Provisional
Probab=99.70  E-value=6.7e-15  Score=119.53  Aligned_cols=204  Identities=17%  Similarity=0.235  Sum_probs=147.3

Q ss_pred             CCCEEEEEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCCCCHHHHHH
Q ss_conf             89856999864530786834232124335477756410006857999999999964983899730368887442899999
Q gi|254780485|r   48 EPNHIQLSKLLNIKTGGCPENCGYCNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVD  127 (328)
Q Consensus        48 ~g~~V~~~~~in~~TN~C~~~C~fCaf~~~~~~~~~~~~~~~~Eei~~~a~~~~~~G~~~~~l~~~~~~~~~~~~~~~~e  127 (328)
                      +|..+++-+ +.+ |..|..+|.||--. . ....++...+|.||+...++.+.+.|++.+-+ +||++...+++..+++
T Consensus         9 ~gR~i~yLR-iSv-TdrCN~rC~YCmpe-g-~~~~~~~~~Ls~eEi~~l~~~~~~~Gi~kvRl-TGGEPLlR~dl~~li~   83 (329)
T PRK13361          9 FGRTVTYLR-LSV-TDRCDFRCVYCMSE-D-PCFLPRDQVLTLEELAWLAQAFTELGVRKIRL-TGGEPLVRTGCDQLVA   83 (329)
T ss_pred             CCCCCCCEE-EEE-ECCCCCCCCCCCCC-C-CCCCCCCCCCCHHHHHHHHHHHHHCCCEEEEE-ECCCCCCCCCHHHHHH
T ss_conf             899048667-885-24405838787998-9-98787024689999999999999729528996-2788223568899999


Q ss_pred             HHHHHCCCC-CCEEEECCCCCHHHHHHHHCCCCCEEEEECCC-CHHHHHCCCCCCCHHHHHHHHHHHHHCCC-CCCCEEE
Q ss_conf             887621368-83241025699999998741576069751343-77773205888898999999999998798-5577078
Q gi|254780485|r  128 MIKGVKSLG-LETCMTLGMLSFEQAQILSKAGLDYYNHNIDT-SERFYPHVTTTHTFEDRLQTLENVRKSGI-KVCCGGI  204 (328)
Q Consensus       128 ~i~~i~~~~-~~i~~~~g~~~~~~~~~Lk~aG~~~~~~~let-~~~~~~~~~~~~~~~~~l~~~~~a~~~G~-~~~sg~l  204 (328)
                      .++.+.... +.+. +.|.+-...+..|++||++++++.+|| .|+.|.++......++.++.++.|.++|+ ++--.++
T Consensus        84 ~l~~~~gi~~islT-TNG~lL~~~a~~Lk~aGL~rvNISLDsLd~~~f~~ITr~~~l~~Vl~gI~aA~~~G~~~VKiN~V  162 (329)
T PRK13361         84 RLGKLPGLEELSMT-TNGSRLARFAAELADAGLKRLNISLDTLNPDLFAALTRNGRLERVIAGIDAAKAAGFERIKLNAV  162 (329)
T ss_pred             HHHHCCCCCEEEEE-CCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHCCCCHHHHHHHHHHHHHCCCCEEEEEEE
T ss_conf             98617997718996-64776899999999779986997357799999997728997699999999999779973889999


Q ss_pred             ECCCCCHHHHHHHHHHHHHCCCCCCEEECCCEEECCC-CCCCCCCCCCHHHHHHHHH
Q ss_conf             6689899999999999974088886020541120487-4124456879899999999
Q gi|254780485|r  205 LGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPG-SKFEENKKVDPIEHVRIIS  260 (328)
Q Consensus       205 ~G~gEt~eeri~~l~~lr~l~~~~~~v~~~~~~p~~g-t~l~~~~~~~~~e~lr~iA  260 (328)
                      +=-|-...|+.+.+...++......++-   |.|..+ .........+.++.+..+.
T Consensus       163 ~lrg~NddEi~~l~~~~~~~~~~vRFIE---~MP~g~~~~~~~~~~~~~~ei~~~i~  216 (329)
T PRK13361        163 ILRGQNDDEVLDLVEFCRERGLDIAFIE---EMPLGEIDERKRARHCSSDEVRAIIE  216 (329)
T ss_pred             EECCCCHHHHHHHHHHHHHCCCCEEEEE---EEECCCCCCCHHCCCCCHHHHHHHHH
T ss_conf             8368788899999999974898369887---43268755400026567999999998


No 36 
>PRK00164 moaA molybdenum cofactor biosynthesis protein A; Reviewed
Probab=99.68  E-value=1.3e-14  Score=117.50  Aligned_cols=209  Identities=18%  Similarity=0.271  Sum_probs=148.6

Q ss_pred             HHHCCCCEEEEEEEEEECCCCCCCCCCCCCCCCCC-CCCCCCCCCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCCCCH
Q ss_conf             88628985699986453078683423212433547-77564100068579999999999649838997303688874428
Q gi|254780485|r   44 RKNFEPNHIQLSKLLNIKTGGCPENCGYCNQSVHN-KSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDL  122 (328)
Q Consensus        44 r~~~~g~~V~~~~~in~~TN~C~~~C~fCaf~~~~-~~~~~~~~~~~~Eei~~~a~~~~~~G~~~~~l~~~~~~~~~~~~  122 (328)
                      ...| |..+.+-+ +.+ |..|..+|.||--.... ....++...+|.||+...++.+.+.|++.+.+ +||++....++
T Consensus         9 ~D~f-GR~i~yLR-iSv-TdrCN~rC~YCmpe~~~~~~~~~~~~~Ls~eEi~~i~~~~~~lGi~kiRl-TGGEPLlR~di   84 (334)
T PRK00164          9 IDRF-GRKVTYLR-LSV-TDRCNFRCTYCMPEGYFGLTFLPKEELLSLEEIERLVRAFAALGVRKIRL-TGGEPLLRKDL   84 (334)
T ss_pred             CCCC-CCCCCCEE-EEE-ECCCCCCCCCCCCCCCCCCCCCCHHHCCCHHHHHHHHHHHHHCCCCEEEE-CCCCCCCCCCH
T ss_conf             1688-99348667-885-04404738778997777878887342299999999999999709627986-07884323578


Q ss_pred             HHHHHHHHHHCCCC-CCEEEECCCCCHHHHHHHHCCCCCEEEEECCC-CHHHHHCCCCCCCHHHHHHHHHHHHHCCC-CC
Q ss_conf             99999887621368-83241025699999998741576069751343-77773205888898999999999998798-55
Q gi|254780485|r  123 SIIVDMIKGVKSLG-LETCMTLGMLSFEQAQILSKAGLDYYNHNIDT-SERFYPHVTTTHTFEDRLQTLENVRKSGI-KV  199 (328)
Q Consensus       123 ~~~~e~i~~i~~~~-~~i~~~~g~~~~~~~~~Lk~aG~~~~~~~let-~~~~~~~~~~~~~~~~~l~~~~~a~~~G~-~~  199 (328)
                      ..+++.++.+.... +.+ .+.|.+-...+..|++||++++++.||| .|+.|.++.....+++.++.++.|.++|+ ++
T Consensus        85 ~~li~~l~~~~gi~~v~l-TTNG~lL~~~a~~Lk~aGL~riNISLDsLd~~~f~~IT~~~~l~~Vl~gI~~A~~~G~~~v  163 (334)
T PRK00164         85 EDIIARLAALPGIRDLAL-TTNGYLLARRAAALKDAGLTRVNVSLDSLDPERFKAITGRDRLDQVLAGIDAALAAGLEPV  163 (334)
T ss_pred             HHHHHHHHHCCCCCCEEE-ECCHHHHHHHHHHHHHCCCCEEEEEEEECCHHHHHHHHCCCCHHHHHHHHHHHHHCCCCCE
T ss_conf             999999863279751788-4448899999999998599869971131899999998489975999999999995898761


Q ss_pred             CCEEEECCCCCHHHHHHHHHHHHHCCCCCCEEECCCEEECC-CCCCCCCCCCCHHHHHHHHH
Q ss_conf             77078668989999999999997408888602054112048-74124456879899999999
Q gi|254780485|r  200 CCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIP-GSKFEENKKVDPIEHVRIIS  260 (328)
Q Consensus       200 ~sg~l~G~gEt~eeri~~l~~lr~l~~~~~~v~~~~~~p~~-gt~l~~~~~~~~~e~lr~iA  260 (328)
                      -..+++=-|-...|+.+.+...++.+..--++-   |.|.. +.........+.++.+..+.
T Consensus       164 KiN~V~~~g~N~dEi~~li~~~~~~~i~vRFIE---~Mp~g~~~~~~~~~~~~~~~i~~~l~  222 (334)
T PRK00164        164 KVNAVLMKGVNDDEIPDLLRWAKDRGIQLRFIE---LMPTGEGNEWFRDHHLSGAEIRARLA  222 (334)
T ss_pred             EEEEEEECCCCHHHHHHHHHHHHHCCCEEEEEE---EECCCCCCCHHHCCCCCHHHHHHHHH
T ss_conf             689996379898999999999964696599999---82167776435306548999999998


No 37 
>TIGR02668 moaA_archaeal probable molybdenum cofactor biosynthesis protein A; InterPro: IPR013485    This entry consists of archaeal proteins which are predicted to be functionally equivalent to MoaA (molybdenum cofactor biosynthesis protein A) from bacteria (see IPR013483 from INTERPRO).; GO: 0046872 metal ion binding, 0006777 Mo-molybdopterin cofactor biosynthetic process.
Probab=99.64  E-value=1.6e-14  Score=117.05  Aligned_cols=169  Identities=21%  Similarity=0.347  Sum_probs=127.3

Q ss_pred             CCCEEE-EEEEEEECCCCCCCCCCCCCCCCCCCC---CCCCCCCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCCCCHH
Q ss_conf             898569-998645307868342321243354777---5641000685799999999996498389973036888744289
Q gi|254780485|r   48 EPNHIQ-LSKLLNIKTGGCPENCGYCNQSVHNKS---KLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLS  123 (328)
Q Consensus        48 ~g~~V~-~~~~in~~TN~C~~~C~fCaf~~~~~~---~~~~~~~~~~Eei~~~a~~~~~~G~~~~~l~~~~~~~~~~~~~  123 (328)
                      +|..|+ ++.  -+ |..|..+|-||=+=....+   ..+....||+|+|...++.+.+.|+..|-| +||+|....|  
T Consensus         5 fGR~v~~LRi--s~-T~~CN~~CfyCH~EG~~~~~~r~gp~~~~Ls~eei~~~~~~a~~fGV~kvKl-TGGEPlLR~D--   78 (324)
T TIGR02668         5 FGRPVTSLRI--SV-TDECNLSCFYCHREGEDESRGRQGPGGNELSPEEIERIVRVASEFGVRKVKL-TGGEPLLRKD--   78 (324)
T ss_pred             CCCEECCCEE--EE-CCCCCCCCEEECCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEEE-CCCCCCHHHH--
T ss_conf             6872046315--77-3423864221036788888888888644558999999999998708832775-1787434566--


Q ss_pred             HHHHHHHHHCCCCC-CEEE-ECCCCCHHHHHHHHCCCCCEEEEECCC-CHHHHHCCC--CCCCHHHHHHHHHHHHHCCC-
Q ss_conf             99998876213688-3241-025699999998741576069751343-777732058--88898999999999998798-
Q gi|254780485|r  124 IIVDMIKGVKSLGL-ETCM-TLGMLSFEQAQILSKAGLDYYNHNIDT-SERFYPHVT--TTHTFEDRLQTLENVRKSGI-  197 (328)
Q Consensus       124 ~~~e~i~~i~~~~~-~i~~-~~g~~~~~~~~~Lk~aG~~~~~~~let-~~~~~~~~~--~~~~~~~~l~~~~~a~~~G~-  197 (328)
                       +.++|+.++.... .|.+ +.|.+-+..++.||+||+|++|+.|+| +++.|+++-  +....++-++-++.|.++|+ 
T Consensus        79 -~~~Ii~~~~~~~~~~vSmTTNG~LL~~~A~~Lk~AGLdRVNVSLdtld~e~Y~kITG~~~~~~~~Vi~GI~~A~~~GL~  157 (324)
T TIGR02668        79 -LIEIIRRIKDYGIKDVSMTTNGILLEKLAKKLKEAGLDRVNVSLDTLDPEKYKKITGQSRDALDRVIEGIESAVDAGLT  157 (324)
T ss_pred             -HHHHHHHHCCCCCEEEECCCCHHHHHHHHHHHHHHCCCEEEECCCCCCHHHHHHHCCCCCCHHHHHHHHHHHHHHCCCC
T ss_conf             -9999986146750344203031448989999998285613120267886788864489986078999999999972898


Q ss_pred             CCCCEEEECCCCCHHH-HHHHHHHHHH
Q ss_conf             5577078668989999-9999999974
Q gi|254780485|r  198 KVCCGGILGLGEMIDD-RIDMLLTLAN  223 (328)
Q Consensus       198 ~~~sg~l~G~gEt~ee-ri~~l~~lr~  223 (328)
                      |+---|++=-|-+..+ .=+++...++
T Consensus       158 PVKlN~Vvl~G~N~~~~~~~m~~f~~~  184 (324)
T TIGR02668       158 PVKLNMVVLKGINDNEEIPDMVEFAAD  184 (324)
T ss_pred             CEEEEEEEECCCCCCCCHHHHHHHHHH
T ss_conf             137888875477885007999999987


No 38 
>PRK08208 coproporphyrinogen III oxidase; Validated
Probab=99.62  E-value=1.1e-13  Score=111.43  Aligned_cols=210  Identities=13%  Similarity=0.178  Sum_probs=149.6

Q ss_pred             HCCCCEEEEEEEEEECCCCCCCCCCCCCCCCCCCCC---CCCCCCCCHHHHHHHHHHHH----HCCCEEEEEECCCCCCC
Q ss_conf             628985699986453078683423212433547775---64100068579999999999----64983899730368887
Q gi|254780485|r   46 NFEPNHIQLSKLLNIKTGGCPENCGYCNQSVHNKSK---LKASKLINVDQVLKEAKNAK----ENGATRYCMGAAWREPK  118 (328)
Q Consensus        46 ~~~g~~V~~~~~in~~TN~C~~~C~fCaf~~~~~~~---~~~~~~~~~Eei~~~a~~~~----~~G~~~~~l~~~~~~~~  118 (328)
                      ..+++...+..+|-    .|...|.||.|.......   ...|    .+.+.++++...    ..-+..+.+  ||++|.
T Consensus        40 ~~~~~~LsLYiHiP----FC~~~C~YC~f~~~~~~~~~~~~~Y----~~aL~~Ei~~~~~~~~~~~~~tiy~--GGGTPS  109 (436)
T PRK08208         40 REYEDALHLYIHIP----FCESRCGFCNLFTCTGADNEFIDSY----LDALIRQARQVALALGGVHFASFAV--GGGTPT  109 (436)
T ss_pred             CCCCCCEEEEEECC----CCCCCCCCCCCCCCCCCCHHHHHHH----HHHHHHHHHHHHHHCCCCCEEEEEE--CCCHHH
T ss_conf             39999749998704----4079588999837668983389999----9999999999876638983568996--794322


Q ss_pred             CCCHHHHHHHHHHHCCC------CCCE--EEECCCCCHHHHHHHHCCCCCEEEEECCC-CHHHHHCCCCCCCHHHHHHHH
Q ss_conf             44289999988762136------8832--41025699999998741576069751343-777732058888989999999
Q gi|254780485|r  119 ERDLSIIVDMIKGVKSL------GLET--CMTLGMLSFEQAQILSKAGLDYYNHNIDT-SERFYPHVTTTHTFEDRLQTL  189 (328)
Q Consensus       119 ~~~~~~~~e~i~~i~~~------~~~i--~~~~g~~~~~~~~~Lk~aG~~~~~~~let-~~~~~~~~~~~~~~~~~l~~~  189 (328)
                      ....+.+..++..+++.      ..++  -++++.++.+.++.|+++|++++.+++++ .+...+.+...|+.++-.+++
T Consensus       110 ~L~~~~l~~ll~~l~~~f~~~~~~~EiTiE~nP~~~~~~~l~~l~~~GvNRiSlGVQsf~~~~L~~lgR~h~~~~~~~ai  189 (436)
T PRK08208        110 LLNIAQLEKLFFSVFDVLGVDLWNIPKSVETSPTTTTAEKLALLNAFGVNRVSIGVQSFHDSELHALHRRQNAASVHQAL  189 (436)
T ss_pred             CCCHHHHHHHHHHHHHHCCCCCCCEEEEEEECCCCCHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHCCCCCHHHHHHHH
T ss_conf             19999999999999985899846715999866363609999999973987278741448989999846889999999999


Q ss_pred             HHHHHCCC-CCCCEEEECC-CCCHHHHHHHHHHHHHCCCCCCEEECCCEEECCCCCCCCCCCCCHHHHHHHHHHHHHHCC
Q ss_conf             99998798-5577078668-989999999999997408888602054112048741244568798999999999999686
Q gi|254780485|r  190 ENVRKSGI-KVCCGGILGL-GEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEHVRIISVARILMP  267 (328)
Q Consensus       190 ~~a~~~G~-~~~sg~l~G~-gEt~eeri~~l~~lr~l~~~~~~v~~~~~~p~~gt~l~~~~~~~~~e~lr~iAi~RL~lP  267 (328)
                      +.++++|+ .++.-.|||+ |+|.++..+.+..+-+++.  +.+++-.+.-.|+|++.....+.+++.+.+...+.=.|.
T Consensus       190 ~~~r~~gf~niniDLIyGlPgQt~~~~~~~l~~~l~l~p--~HIS~Y~L~iep~T~l~~~~~~~~d~~~~my~~a~~~L~  267 (436)
T PRK08208        190 ELIRAAHFPSLNIDLIYGIPGQTHASFMESLHQALVYRP--EELFLYPLYVRPLTGLGRRGTAWDDNMHSLYVLARDLLL  267 (436)
T ss_pred             HHHHHCCCCEEEEEEEECCCCCCHHHHHHHHHHHHCCCC--CEEECCCCEECCCCCCCCCCCCCCHHHHHHHHHHHHHHH
T ss_conf             999981998575524436999999999999999982798--989876330478983012479893799999999999999


No 39 
>COG2516 Biotin synthase-related enzyme [General function prediction only]
Probab=99.62  E-value=2.9e-14  Score=115.21  Aligned_cols=209  Identities=23%  Similarity=0.362  Sum_probs=143.7

Q ss_pred             EEEEEEEEECCCCCCCCCCCCCCCCCCCCCCCC-------CCCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCCCCHHH
Q ss_conf             699986453078683423212433547775641-------0006857999999999964983899730368887442899
Q gi|254780485|r   52 IQLSKLLNIKTGGCPENCGYCNQSVHNKSKLKA-------SKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSI  124 (328)
Q Consensus        52 V~~~~~in~~TN~C~~~C~fCaf~~~~~~~~~~-------~~~~~~Eei~~~a~~~~~~G~~~~~l~~~~~~~~~~~~~~  124 (328)
                      ++.+....+ -..|..+|+||+|++...+..+.       +.....+++++...... .-+.++|++.-.++....+.-+
T Consensus        29 ~ta~l~t~~-~~~c~~~ca~c~~ar~s~a~p~~~~lsRv~w~~v~l~~~~~~~~~~~-g~~~rici~~i~~p~~~~d~~~  106 (339)
T COG2516          29 TTAYLMTTY-PGGCIADCAYCPQARSSTANPPKKVLSRVEWPAVALEEVLKRLFYDL-GNFKRICIQQIAYPRALNDLKL  106 (339)
T ss_pred             CEEEEEEEC-CCCEEECHHHCHHHHHCCCCCCCCEEEECCCCCCHHHHHHHHHHHHH-CCCCCCCCEEECCCCCCCHHHH
T ss_conf             056656622-78566465547355523458875036632662000787776766654-0214441100025542301666


Q ss_pred             HHHHHHHHCCCCCCEEEE--CCCCC-HHHHHHHHCCCCCEEEEECCC-CHHHHHCCC----CCCCHHHHHHHHHHHHHC-
Q ss_conf             999887621368832410--25699-999998741576069751343-777732058----888989999999999987-
Q gi|254780485|r  125 IVDMIKGVKSLGLETCMT--LGMLS-FEQAQILSKAGLDYYNHNIDT-SERFYPHVT----TTHTFEDRLQTLENVRKS-  195 (328)
Q Consensus       125 ~~e~i~~i~~~~~~i~~~--~g~~~-~~~~~~Lk~aG~~~~~~~let-~~~~~~~~~----~~~~~~~~l~~~~~a~~~-  195 (328)
                      +++-++.  ..+..+.++  +...+ .+.+...++.|.+.+.+.+|. .+++|.++.    ..|||++.++.++.+-++ 
T Consensus       107 i~~~~~~--~~~~~itiseci~~~~~~~~l~e~~klg~d~l~V~~daa~~~~~e~v~~~s~s~~S~e~~~~~l~~~~~~~  184 (339)
T COG2516         107 ILERLHI--RLGDPITISECITAVSLKEELEEYRKLGADYLGVAEDAANEELFEKVRKTSGSPHSWERYWEFLEKVAEAF  184 (339)
T ss_pred             HHHHHHH--CCCCCEEHHHHHHCCCCHHHHHHHHHCCHHHHHHHHHHCCHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHH
T ss_conf             4366510--24785012023302451687899885423553578875077789998741589871888999999999985


Q ss_pred             C-CCCCCEEEECCCCCHHHHHHHHHHHHHCCCCCCEEECCCEEECCCCCCCCCCCCCHHHHHHHHHHHHHHCCC
Q ss_conf             9-855770786689899999999999974088886020541120487412445687989999999999996868
Q gi|254780485|r  196 G-IKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEHVRIISVARILMPK  268 (328)
Q Consensus       196 G-~~~~sg~l~G~gEt~eeri~~l~~lr~l~~~~~~v~~~~~~p~~gt~l~~~~~~~~~e~lr~iAi~RL~lP~  268 (328)
                      | .+++.++++|+||+.++.++.+...++.+.   .+.++.|.|..||.|++..+++...|-| +-++|.+..+
T Consensus       185 ~k~rv~ihliVglGesD~~~ve~~~~v~~~g~---~v~Lfaf~P~~gt~me~r~~~pve~Yrk-~q~a~yli~~  254 (339)
T COG2516         185 GKGRVGIHLIVGLGESDKDIVETIKRVRKRGG---IVSLFAFTPLKGTQMENRKPPPVERYRK-IQVARYLIGN  254 (339)
T ss_pred             CCCCCCEEEEECCCCCHHHHHHHHHHHHHCCC---EEEEEEECCCCCCCCCCCCCCCHHHHHH-HHHHHHHHHC
T ss_conf             46774515796048756899999999985586---4899986465566445789986899999-9999999734


No 40 
>PRK05904 coproporphyrinogen III oxidase; Provisional
Probab=99.61  E-value=2.2e-13  Score=109.38  Aligned_cols=191  Identities=16%  Similarity=0.210  Sum_probs=135.9

Q ss_pred             CCCCCCCCCCCCCCCCC-CCCCCCCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCCCCHHHHHHHHHHHC---CCCCCE
Q ss_conf             68342321243354777-56410006857999999999964983899730368887442899999887621---368832
Q gi|254780485|r   64 GCPENCGYCNQSVHNKS-KLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVK---SLGLET  139 (328)
Q Consensus        64 ~C~~~C~fCaf~~~~~~-~~~~~~~~~~Eei~~~a~~~~~~G~~~~~l~~~~~~~~~~~~~~~~e~i~~i~---~~~~~i  139 (328)
                      .|...|.||.|+..... ....+...-.+++..+++......+..+.+++  ++|.....+.+..++..++   ..+.++
T Consensus        15 FC~~kC~YCdF~s~~~~~~~~~~~~~~~~el~~~~~~~~~~~i~TIyfGG--GTPSlL~~~~l~~ll~~i~~~~~~~~Ei   92 (353)
T PRK05904         15 FCQYICTFCDFKRILKTPQTKKIFKDFLKNIKMHIKNFKIKQFKTIYLGG--GTPNCLNDQLLDILLSTIKPYVDNNCEF   92 (353)
T ss_pred             CCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCEEEEEECC--CCCHHCCHHHHHHHHHHHHHHCCCCCEE
T ss_conf             99870899989841887685999999999999998764799544899899--8602089999999999999763878359


Q ss_pred             EE--ECCCCCHHHHHHHHCCCCCEEEEECCC-CHHHHHCCCCCCCHHHHHHHHHHHHHCCC-CCCCEEEECC-CCCHHHH
Q ss_conf             41--025699999998741576069751343-77773205888898999999999998798-5577078668-9899999
Q gi|254780485|r  140 CM--TLGMLSFEQAQILSKAGLDYYNHNIDT-SERFYPHVTTTHTFEDRLQTLENVRKSGI-KVCCGGILGL-GEMIDDR  214 (328)
Q Consensus       140 ~~--~~g~~~~~~~~~Lk~aG~~~~~~~let-~~~~~~~~~~~~~~~~~l~~~~~a~~~G~-~~~sg~l~G~-gEt~eer  214 (328)
                      .+  +++.++.+.++.++++|++++.++++| .+...+.+...|+.++-+++++.++++|+ .++.-+|||+ |+|.++.
T Consensus        93 TiEaNP~~~~~ekL~~lk~~GVNRiSlGVQSf~d~~Lk~LGR~H~~~~~~~ai~~~r~~Gf~nIsiDLIyGlPgQT~~~~  172 (353)
T PRK05904         93 TIECNPELITQSQINLLKKNKVNRISLGVQSMNNNILKQLNRTHTIQDSKEAINLLHKNGIYNISCDFLYCLPILKLKDL  172 (353)
T ss_pred             EEEECCCCCCHHHHHHHHHCCCCEEEEECCCCCHHHHHHHCCCCCHHHHHHHHHHHHHHCCCEEEECEEECCCCCCHHHH
T ss_conf             99865144878999999964987688874559989999838999899999999999981997360042635999999999


Q ss_pred             HHHHHHHHHCCCCCCEEECCCEEECCCCCCCCCCC-CCHHHHHHH
Q ss_conf             99999997408888602054112048741244568-798999999
Q gi|254780485|r  215 IDMLLTLANLSTPPESIPINLLIPIPGSKFEENKK-VDPIEHVRI  258 (328)
Q Consensus       215 i~~l~~lr~l~~~~~~v~~~~~~p~~gt~l~~~~~-~~~~e~lr~  258 (328)
                      .+.|..+-+++.  +.+++-.++-.|||++..... +++++....
T Consensus       173 ~~~L~~~l~l~p--~HiS~Y~LtiE~gT~~~~~~~~~~~d~~~~~  215 (353)
T PRK05904        173 DEVFNFILKHKI--NHISFYSLEIKEGSILKKYHYTIDEDKEAEQ  215 (353)
T ss_pred             HHHHHHHHHCCC--CCEEEEEEEECCCCHHCCCCCCCCCHHHHHH
T ss_conf             999999996599--9178888898579732047889992799999


No 41 
>PRK08599 coproporphyrinogen III oxidase; Provisional
Probab=99.61  E-value=3.6e-13  Score=107.94  Aligned_cols=199  Identities=19%  Similarity=0.247  Sum_probs=139.5

Q ss_pred             EEECCCCCCCCCCCCCCCCCCC--CCCCCCCCCCHHHHHHHHHHHHHCC---CEEEEEECCCCCCCCCCHHHHHHHHHHH
Q ss_conf             4530786834232124335477--7564100068579999999999649---8389973036888744289999988762
Q gi|254780485|r   58 LNIKTGGCPENCGYCNQSVHNK--SKLKASKLINVDQVLKEAKNAKENG---ATRYCMGAAWREPKERDLSIIVDMIKGV  132 (328)
Q Consensus        58 in~~TN~C~~~C~fCaf~~~~~--~~~~~~~~~~~Eei~~~a~~~~~~G---~~~~~l~~~~~~~~~~~~~~~~e~i~~i  132 (328)
                      ++|+  .|...|.||.|.....  .....|    .+.+.++.+.....+   +..+.+  ||++|.....+.+.+++..+
T Consensus         6 iHIP--FC~~~C~yC~f~~~~~~~~~~~~Y----~~aL~~Ei~~~~~~~~~~~~tiy~--GGGTPs~L~~~~l~~ll~~i   77 (377)
T PRK08599          6 IHIP--FCEHICYYCDFNKVFIENQPVDEY----LDALIKEMESTVAKYIRKLKTIYI--GGGTPTALSAEQLERLLNAI   77 (377)
T ss_pred             EECC--CCCCCCCCCCCCCCCCCCCCHHHH----HHHHHHHHHHHHHHCCCCEEEEEE--CCCCCCCCCHHHHHHHHHHH
T ss_conf             9727--899868999691646898779999----999999999765514995579997--99810009999999999999


Q ss_pred             CCC-----CCCEE--EECCCCCHHHHHHHHCCCCCEEEEECCC-CHHHHHCCCCCCCHHHHHHHHHHHHHCCCC-CCCEE
Q ss_conf             136-----88324--1025699999998741576069751343-777732058888989999999999987985-57707
Q gi|254780485|r  133 KSL-----GLETC--MTLGMLSFEQAQILSKAGLDYYNHNIDT-SERFYPHVTTTHTFEDRLQTLENVRKSGIK-VCCGG  203 (328)
Q Consensus       133 ~~~-----~~~i~--~~~g~~~~~~~~~Lk~aG~~~~~~~let-~~~~~~~~~~~~~~~~~l~~~~~a~~~G~~-~~sg~  203 (328)
                      ++.     ..++.  +++..++.+.++.|+++|++++.+++++ .+...+.+...|+.++-+++++.++++|+. ++.-+
T Consensus        78 ~~~f~~~~~~EiTiE~nP~~~~~~~l~~l~~~GvNRiSlGvQsf~~~~l~~lgR~h~~~~~~~~i~~~r~~gf~~iniDL  157 (377)
T PRK08599         78 HRTLPLSDLEEFTFEANPGDLTKEKLQVLKDYGVNRISLGVQTFNDELLKKIGRTHNEEDVYESIANAKKAGFKNISIDL  157 (377)
T ss_pred             HHHCCCCCCCEEEEEECCCCCCHHHHHHHHHCCCCEEEEECCCCCHHHHHHHCCCCCHHHHHHHHHHHHHCCCCCEEEEE
T ss_conf             99769776732799955151639999999970998799965359879999868999899999999999975997411565


Q ss_pred             EECC-CCCHHHHHHHHHHHHHCCCCCCEEECCCEEECCCCCCCC------CCCCCHHHHHHHHHHHHHHC
Q ss_conf             8668-989999999999997408888602054112048741244------56879899999999999968
Q gi|254780485|r  204 ILGL-GEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEE------NKKVDPIEHVRIISVARILM  266 (328)
Q Consensus       204 l~G~-gEt~eeri~~l~~lr~l~~~~~~v~~~~~~p~~gt~l~~------~~~~~~~e~lr~iAi~RL~l  266 (328)
                      |||+ ++|.++..+.+..+-+++.  +.+++..+.-.|+|++..      .+.|+.++...+...++=.|
T Consensus       158 IyGlP~Qt~~~~~~~l~~~~~l~p--~hiS~Y~L~ie~~t~~~~~~~~g~~~lp~~d~~~~m~~~~~~~L  225 (377)
T PRK08599        158 IYALPGQTIEDVKESLDKALALDI--PHYSLYSLILEPKTVFYNLMRKGKLRLPTEDLEAEMYEYLMSEM  225 (377)
T ss_pred             ECCCCCCCHHHHHHHHHHHHHHCC--CEEEEEEEEECCCCHHHHHHHCCCCCCCCHHHHHHHHHHHHHHH
T ss_conf             427888989999999999973063--63455442335887688887559878999799999999999999


No 42 
>PRK05799 coproporphyrinogen III oxidase; Provisional
Probab=99.59  E-value=8.1e-13  Score=105.58  Aligned_cols=200  Identities=22%  Similarity=0.319  Sum_probs=139.9

Q ss_pred             EEECCCCCCCCCCCCCCCCCCCCC--CCCCCCCCHHHHHHHHHHHH-HCCCEEEEEECCCCCCCCCCHHHHHHHHHHHCC
Q ss_conf             453078683423212433547775--64100068579999999999-649838997303688874428999998876213
Q gi|254780485|r   58 LNIKTGGCPENCGYCNQSVHNKSK--LKASKLINVDQVLKEAKNAK-ENGATRYCMGAAWREPKERDLSIIVDMIKGVKS  134 (328)
Q Consensus        58 in~~TN~C~~~C~fCaf~~~~~~~--~~~~~~~~~Eei~~~a~~~~-~~G~~~~~l~~~~~~~~~~~~~~~~e~i~~i~~  134 (328)
                      ++++  .|...|.||.|.......  ..+|    .+.+.++++... ..-++.+.++  |++|.....+.+..++..+++
T Consensus         8 iHiP--FC~~~C~yC~f~~~~~~~~~~~~Y----~~~L~~Ei~~~~~~~~i~tiy~G--GGTPs~l~~~~l~~l~~~i~~   79 (374)
T PRK05799          8 IHIP--FCKQKCLYCDFPSYSGKEDLMMEY----IKALSKEIVNKTKNKKIKSIFIG--GGTPSYLSLEALEILLKTIKK   79 (374)
T ss_pred             EEEC--CCCCCCCCCCCCCCCCCCHHHHHH----HHHHHHHHHHHCCCCCEEEEEEC--CCCCCCCCHHHHHHHHHHHHH
T ss_conf             9948--999858999794748870069999----99999999976579815499979--965022999999999999985


Q ss_pred             C----CCCE--EEECCCCCHHHHHHHHCCCCCEEEEECCC-CHHHHHCCCCCCCHHHHHHHHHHHHHCCCC-CCCEEEEC
Q ss_conf             6----8832--41025699999998741576069751343-777732058888989999999999987985-57707866
Q gi|254780485|r  135 L----GLET--CMTLGMLSFEQAQILSKAGLDYYNHNIDT-SERFYPHVTTTHTFEDRLQTLENVRKSGIK-VCCGGILG  206 (328)
Q Consensus       135 ~----~~~i--~~~~g~~~~~~~~~Lk~aG~~~~~~~let-~~~~~~~~~~~~~~~~~l~~~~~a~~~G~~-~~sg~l~G  206 (328)
                      .    ..++  -++++.++.+.++.|+++|++++.++++| .+...+.+...|+.++-.++++.+++.|++ ++.-.|||
T Consensus        80 ~~~~~~~E~TiE~nP~~~~~~~l~~l~~~GvNRiSiGVQSf~~~~l~~lgR~h~~~~~~~ai~~~~~~gf~niniDLIyG  159 (374)
T PRK05799         80 LNKKENLEFTVEGNPGTFTEEKLKILKSMGVNRISIGLQAWQNSLLKTLGRIHTFEEFLENYKLARKLGFNNINVDLMFG  159 (374)
T ss_pred             CCCCCCCEEEEEECCCCCCHHHHHHHHHCCCCEEEEECCCCCHHHHHHHCCCCCHHHHHHHHHHHHHCCCCCEEEEEECC
T ss_conf             68887845899856677899999999971997588853358899999847999899999999999975997466885448


Q ss_pred             C-CCCHHHHHHHHHHHHHCCCCCCEEECCCEEECCCCCCCC------CCCCCHHHHHHHHHHHHHHCC
Q ss_conf             8-989999999999997408888602054112048741244------568798999999999999686
Q gi|254780485|r  207 L-GEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEE------NKKVDPIEHVRIISVARILMP  267 (328)
Q Consensus       207 ~-gEt~eeri~~l~~lr~l~~~~~~v~~~~~~p~~gt~l~~------~~~~~~~e~lr~iAi~RL~lP  267 (328)
                      + |+|.++....+..+-+++.  +.+++..+.-.|+|++..      .+.++.++...+...+.=.|.
T Consensus       160 lPgQt~~~~~~~l~~~~~l~p--~hiS~Y~L~i~~~t~~~~~~~~~~~~~p~~~~~~~my~~~~~~L~  225 (374)
T PRK05799        160 LPNQTLEDWKETLEKVVELSP--EHISCYSLIIEEGTPFYNLYENGKLKLPKEEEERKMYHYTIEFLK  225 (374)
T ss_pred             CCCCCHHHHHHHHHHHHHHCC--CEEEEEEEECCCCCHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHH
T ss_conf             988878999999999984172--501365420578867998875188899999999999999999998


No 43 
>COG2896 MoaA Molybdenum cofactor biosynthesis enzyme [Coenzyme metabolism]
Probab=99.58  E-value=1.2e-12  Score=104.41  Aligned_cols=205  Identities=19%  Similarity=0.261  Sum_probs=147.3

Q ss_pred             CCCEEEEEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCCCCHHHHHH
Q ss_conf             89856999864530786834232124335477756410006857999999999964983899730368887442899999
Q gi|254780485|r   48 EPNHIQLSKLLNIKTGGCPENCGYCNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVD  127 (328)
Q Consensus        48 ~g~~V~~~~~in~~TN~C~~~C~fCaf~~~~~~~~~~~~~~~~Eei~~~a~~~~~~G~~~~~l~~~~~~~~~~~~~~~~e  127 (328)
                      +|..+.+-+ +.+ |..|..+|.||-.... ....++...+|.|||...++...+.|...+-| +||++...+++..++.
T Consensus         6 ~gR~~~~LR-iSv-TdrCNfrC~YCm~eg~-~~~~~~~~~Ls~eei~~~~~~~~~~Gv~kvRl-TGGEPllR~dl~eIi~   81 (322)
T COG2896           6 FGRPVRYLR-ISV-TDRCNFRCTYCMPEGP-LAFLPKEELLSLEEIRRLVRAFAELGVEKVRL-TGGEPLLRKDLDEIIA   81 (322)
T ss_pred             CCCEECEEE-EEE-ECCCCCCCCCCCCCCC-CCCCCCCCCCCHHHHHHHHHHHHHCCCCEEEE-ECCCCHHHCCHHHHHH
T ss_conf             588702079-998-2673774644688886-56676545489999999999999739645897-1898313327999999


Q ss_pred             HHHHHCCCCCCEEEE-CCCCCHHHHHHHHCCCCCEEEEECCC-CHHHHHCCCCCCCHHHHHHHHHHHHHCCC-CCCCEEE
Q ss_conf             887621368832410-25699999998741576069751343-77773205888898999999999998798-5577078
Q gi|254780485|r  128 MIKGVKSLGLETCMT-LGMLSFEQAQILSKAGLDYYNHNIDT-SERFYPHVTTTHTFEDRLQTLENVRKSGI-KVCCGGI  204 (328)
Q Consensus       128 ~i~~i~~~~~~i~~~-~g~~~~~~~~~Lk~aG~~~~~~~let-~~~~~~~~~~~~~~~~~l~~~~~a~~~G~-~~~sg~l  204 (328)
                      .++..  ....+.++ .|.+.....+.||+||++++++.+|| .++.|.++-....+++-++-++.|.++|+ ++.-.+.
T Consensus        82 ~l~~~--~~~~islTTNG~~L~~~a~~Lk~AGl~rVNVSLDsld~e~f~~IT~~~~~~~Vl~GI~~A~~~Gl~pVKlN~V  159 (322)
T COG2896          82 RLARL--GIRDLSLTTNGVLLARRAADLKEAGLDRVNVSLDSLDPEKFRKITGRDRLDRVLEGIDAAVEAGLTPVKLNTV  159 (322)
T ss_pred             HHHHC--CCCEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHCCCCHHHHHHHHHHHHHCCCCCEEEEEE
T ss_conf             87434--6442887445676799999999759868995034499899998867892999999999999769985578889


Q ss_pred             ECCCCCHHHHHHHHHHHHHCCCCCCEEECCCEEECCC-CCCCCCCCCCHHHHHHHHHH
Q ss_conf             6689899999999999974088886020541120487-41244568798999999999
Q gi|254780485|r  205 LGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPG-SKFEENKKVDPIEHVRIISV  261 (328)
Q Consensus       205 ~G~gEt~eeri~~l~~lr~l~~~~~~v~~~~~~p~~g-t~l~~~~~~~~~e~lr~iAi  261 (328)
                      +=-|=...|+.+.+...++.+..-.++-   +.|... +........+..+.++.+.-
T Consensus       160 v~kgvNd~ei~~l~e~~~~~~~~lrfIE---~m~~g~~~~~~~~~~~~~~~i~~~l~~  214 (322)
T COG2896         160 LMKGVNDDEIEDLLEFAKERGAQLRFIE---LMPLGEGNSWRLDKYLSLDEILRKLEE  214 (322)
T ss_pred             EECCCCHHHHHHHHHHHHHCCCCEEEEE---EEECCCCCCHHHHCCCCHHHHHHHHHH
T ss_conf             8469887899999999852698447999---866686540344044549999999986


No 44 
>PRK07379 coproporphyrinogen III oxidase; Provisional
Probab=99.58  E-value=1.1e-12  Score=104.80  Aligned_cols=208  Identities=15%  Similarity=0.230  Sum_probs=141.5

Q ss_pred             EEEEEECCCCCCCCCCCCCCCCCC---CCCCCCC--CCCCHHHHHHHHHHHHH--CCCEEEEEECCCCCCCCCCHHHHHH
Q ss_conf             986453078683423212433547---7756410--00685799999999996--4983899730368887442899999
Q gi|254780485|r   55 SKLLNIKTGGCPENCGYCNQSVHN---KSKLKAS--KLINVDQVLKEAKNAKE--NGATRYCMGAAWREPKERDLSIIVD  127 (328)
Q Consensus        55 ~~~in~~TN~C~~~C~fCaf~~~~---~~~~~~~--~~~~~Eei~~~a~~~~~--~G~~~~~l~~~~~~~~~~~~~~~~e  127 (328)
                      ..-++|+  .|...|.||.|...-   .......  ...-.+.+.++.+....  ..+..+.++  |++|.....+.+.+
T Consensus        12 slYiHIP--FC~~~C~YCdF~~~v~~~~~~~~~~~~~~~Y~~~L~~Ei~~~~~~~~~i~tiy~G--GGTPSlL~~~~l~~   87 (399)
T PRK07379         12 SAYLHIP--FCRRRCFYCDFPISVVGDRQRGGTSGLIEEYVEVLCQEIAITPSLGQPLQTVFFG--GGTPSLLPVEQLER   87 (399)
T ss_pred             EEEEECC--CCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHCCCCCEEEEEEC--CCHHHHCCHHHHHH
T ss_conf             4888650--0669288999975176666665405799999999999997314159962189969--95567489999999


Q ss_pred             HHHHHCCC-----CCCEE--EECCCCCHHHHHHHHCCCCCEEEEECCC-CHHHHHCCCCCCCHHHHHHHHHHHHHCCCC-
Q ss_conf             88762136-----88324--1025699999998741576069751343-777732058888989999999999987985-
Q gi|254780485|r  128 MIKGVKSL-----GLETC--MTLGMLSFEQAQILSKAGLDYYNHNIDT-SERFYPHVTTTHTFEDRLQTLENVRKSGIK-  198 (328)
Q Consensus       128 ~i~~i~~~-----~~~i~--~~~g~~~~~~~~~Lk~aG~~~~~~~let-~~~~~~~~~~~~~~~~~l~~~~~a~~~G~~-  198 (328)
                      ++..+++.     ..++.  ++++.++++.++.++++|++++.+++++ .+...+.+-..|+.++-.++++.++++|++ 
T Consensus        88 ll~~l~~~f~~~~~~EiTiE~nP~~~~~~~l~~l~~~GvNRiSiGvQSf~~~~L~~lgR~h~~~~~~~ai~~~~~~gf~n  167 (399)
T PRK07379         88 ILLTLDQRFGIAPDAEISLEIDPGTFDLEQLQGYRSLGVNRVSLGVQAFQDELLALCGRSHRVKDIYQAVADIHQAGIEN  167 (399)
T ss_pred             HHHHHHHHCCCCCCCEEEEEECCCCCCHHHHHHHHHCCCCEEEEEECCCCHHHHHHHCCCCCHHHHHHHHHHHHHCCCCC
T ss_conf             99999986899988579998458989999999998569885889702386889998489999999999999999769975


Q ss_pred             CCCEEEECC-CCCHHHHHHHHHHHHHCCCCCCEEECCCEEECCCCCCCCC------CCCCHHHHHHHHHHHHHHCCC
Q ss_conf             577078668-9899999999999974088886020541120487412445------687989999999999996868
Q gi|254780485|r  199 VCCGGILGL-GEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEEN------KKVDPIEHVRIISVARILMPK  268 (328)
Q Consensus       199 ~~sg~l~G~-gEt~eeri~~l~~lr~l~~~~~~v~~~~~~p~~gt~l~~~------~~~~~~e~lr~iAi~RL~lP~  268 (328)
                      ++.-.|||+ |+|.++....|..+-+++.  +.+++-.|.-.|||++...      +.|+.++.+.+...+.=+|..
T Consensus       168 iniDLIyGlPgQt~~~~~~~l~~~~~l~p--~hiS~Y~L~~e~~T~~~~~~~~~~~~lp~~~~~~~~~~~~~~~L~~  242 (399)
T PRK07379        168 FSLDLISGLPHQTLEDWQASLEAAIAINP--THLSCYDLVLEPVTAFGKQYQPGKAPLPSDETTAAMYRLAQEILTQ  242 (399)
T ss_pred             EEEEEEECCCCCCHHHHHHHHHHHHHCCC--CEEEEEEEEECCCCHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHHH
T ss_conf             54553307899889999999999973388--8078888896389779998605888999989999999999999986


No 45 
>PRK05628 coproporphyrinogen III oxidase; Validated
Probab=99.57  E-value=6e-13  Score=106.43  Aligned_cols=201  Identities=18%  Similarity=0.205  Sum_probs=139.3

Q ss_pred             EEECCCCCCCCCCCCCCCCCCC------CCCCCCCCCCHHHHHHHHHHHHH-CC-----CEEEEEECCCCCCCCCCHHHH
Q ss_conf             4530786834232124335477------75641000685799999999996-49-----838997303688874428999
Q gi|254780485|r   58 LNIKTGGCPENCGYCNQSVHNK------SKLKASKLINVDQVLKEAKNAKE-NG-----ATRYCMGAAWREPKERDLSII  125 (328)
Q Consensus        58 in~~TN~C~~~C~fCaf~~~~~------~~~~~~~~~~~Eei~~~a~~~~~-~G-----~~~~~l~~~~~~~~~~~~~~~  125 (328)
                      ++|+  .|...|.||+|.....      .....|    .+.+.++.+...+ .+     +..+.++  |++|.....+.+
T Consensus         7 iHiP--FC~~~C~yC~f~~~~~~~~~~~~~~~~Y----~~~L~~Ei~~~~~~l~~~~~~i~tiy~G--GGTPs~L~~~~l   78 (376)
T PRK05628          7 VHVP--FCATRCGYCDFNTYTAAELGGGASPDGY----LDALRAELELAAAVLGDPAPPVSTVFVG--GGTPSLLGAEGL   78 (376)
T ss_pred             EECC--CCCCCCCCCCCCCCCCCCCCCCCCHHHH----HHHHHHHHHHHHHHHCCCCCEEEEEEEC--CCHHHHCCHHHH
T ss_conf             8705--7646089997957336524787679999----9999999999987617789657899978--944664899999


Q ss_pred             HHHHHHHCCC-----CCCEE--EECCCCCHHHHHHHHCCCCCEEEEECCC-CHHHHHCCCCCCCHHHHHHHHHHHHHCCC
Q ss_conf             9988762136-----88324--1025699999998741576069751343-77773205888898999999999998798
Q gi|254780485|r  126 VDMIKGVKSL-----GLETC--MTLGMLSFEQAQILSKAGLDYYNHNIDT-SERFYPHVTTTHTFEDRLQTLENVRKSGI  197 (328)
Q Consensus       126 ~e~i~~i~~~-----~~~i~--~~~g~~~~~~~~~Lk~aG~~~~~~~let-~~~~~~~~~~~~~~~~~l~~~~~a~~~G~  197 (328)
                      .+++..+++.     +.++.  ++++.++.+.++.|+++|++++.+++++ .+...+.+...|+.++-.++++.+++.|+
T Consensus        79 ~~l~~~i~~~f~~~~~~EiTiE~nP~~~~~~~l~~l~~~GvnRiSlGvQsf~~~~l~~lgR~h~~~~~~~~~~~~~~~gf  158 (376)
T PRK05628         79 ARVLDAVRDTFGLAPDAEVTTEANPESTSPEFFAALRAAGYTRVSLGMQSAAPHVLAVLDRTHTPGRAVAAAREARAAGF  158 (376)
T ss_pred             HHHHHHHHHHCCCCCCCEEEEEECCCCCCHHHHHHHHHCCCCEEEEECCCCCHHHHHHCCCCCCHHHHHHHHHHHHHCCC
T ss_conf             99999999758999885699983426589999999997498759995155899999974999998999999999987599


Q ss_pred             C-CCCEEEECC-CCCHHHHHHHHHHHHHCCCCCCEEECCCEEECCCCCCCCC------CCCCHHHHHHHHHHHHHHCCC
Q ss_conf             5-577078668-9899999999999974088886020541120487412445------687989999999999996868
Q gi|254780485|r  198 K-VCCGGILGL-GEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEEN------KKVDPIEHVRIISVARILMPK  268 (328)
Q Consensus       198 ~-~~sg~l~G~-gEt~eeri~~l~~lr~l~~~~~~v~~~~~~p~~gt~l~~~------~~~~~~e~lr~iAi~RL~lP~  268 (328)
                      . ++.-+|||+ ++|.++..+.+..+-++..  +.+++-.+.-.|+|++...      +.++.++...+...+.-.|..
T Consensus       159 ~~in~DLIyGlP~Qt~~~~~~~l~~~~~l~p--~his~Y~l~~e~~t~~~~~~~~~~l~~p~e~~~~~~~~~~~~~L~~  235 (376)
T PRK05628        159 EHVNLDLIYGTPGETDDDLRRSLDAALEAGV--DHVSAYALIVEDGTALARRVRRGELPAPDDDVLADRYELADARLSA  235 (376)
T ss_pred             CCEEEEEECCCCCCCHHHHHHHHHHHHHCCC--CEEEEEEEEECCCCHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHH
T ss_conf             7255554427999999999999999973289--8156655565478677777751789999999999999999999984


No 46 
>PRK05660 coproporphyrinogen III oxidase; Provisional
Probab=99.57  E-value=6.4e-13  Score=106.26  Aligned_cols=205  Identities=14%  Similarity=0.196  Sum_probs=139.1

Q ss_pred             EEECCCCCCCCCCCCCCCCCCC-CC--CCCCCCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCCCCHHHHHHHHHHHCC
Q ss_conf             4530786834232124335477-75--64100068579999999999649838997303688874428999998876213
Q gi|254780485|r   58 LNIKTGGCPENCGYCNQSVHNK-SK--LKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKS  134 (328)
Q Consensus        58 in~~TN~C~~~C~fCaf~~~~~-~~--~~~~~~~~~Eei~~~a~~~~~~G~~~~~l~~~~~~~~~~~~~~~~e~i~~i~~  134 (328)
                      ++|+  .|...|.||+|..... ..  ..+|...-..|+...+......-+..+.+  ||++|.....+.+.+++..+++
T Consensus        11 iHiP--FC~~~C~YC~f~~~~~~~~~~~~~Y~~aL~~ei~~~~~~~~~~~i~tiy~--GGGTPs~L~~~~l~~l~~~i~~   86 (378)
T PRK05660         11 IHIP--WCVQKCPYCDFNSHALKGEVPEDEYVDHLLADLDADLPLVQGREVHSIFI--GGGTPSLFSAEAIQRLLDGVRA   86 (378)
T ss_pred             EECC--CCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCEEEEEEE--CCCHHHHCCHHHHHHHHHHHHH
T ss_conf             9727--89876999969650488877699999999999999877617975769997--8953330899999999999998


Q ss_pred             C-----CCCEE--EECCCCCHHHHHHHHCCCCCEEEEECCC-CHHHHHCCCCCCCHHHHHHHHHHHHHCCCC-CCCEEEE
Q ss_conf             6-----88324--1025699999998741576069751343-777732058888989999999999987985-5770786
Q gi|254780485|r  135 L-----GLETC--MTLGMLSFEQAQILSKAGLDYYNHNIDT-SERFYPHVTTTHTFEDRLQTLENVRKSGIK-VCCGGIL  205 (328)
Q Consensus       135 ~-----~~~i~--~~~g~~~~~~~~~Lk~aG~~~~~~~let-~~~~~~~~~~~~~~~~~l~~~~~a~~~G~~-~~sg~l~  205 (328)
                      .     +.++.  +++..++.+.++.++++|++++.++++| .+...+.+-..|+.++-+++++.++++|++ ++.-.||
T Consensus        87 ~f~~~~~~EiTiE~nP~~~~~~~l~~l~~~GvnRiSiGVQsf~~~~l~~lgR~h~~~~~~~ai~~~r~~gf~~iniDLiy  166 (378)
T PRK05660         87 RLPFAPDAEITMEANPGTVEADRFVGYQRAGVNRISIGVQSFSEEKLKRLGRIHGPDEAKRAAKLAQGAGLRSFNLDLMH  166 (378)
T ss_pred             HCCCCCCCEEEEECCCCCCCHHHHHHHHHCCCCEEEEEECCCCHHHHHHHCCCCCHHHHHHHHHHHHHCCCCEEEECCCC
T ss_conf             57987771489845705330889999998098759996143789999982799999999999999997699606542326


Q ss_pred             CC-CCCHHHHHHHHHHHHHCCCCCCEEECCCEEECCCCCCCCCCC--CCHHHHHHHHHHHHHHCCC
Q ss_conf             68-989999999999997408888602054112048741244568--7989999999999996868
Q gi|254780485|r  206 GL-GEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKK--VDPIEHVRIISVARILMPK  268 (328)
Q Consensus       206 G~-gEt~eeri~~l~~lr~l~~~~~~v~~~~~~p~~gt~l~~~~~--~~~~e~lr~iAi~RL~lP~  268 (328)
                      |+ |+|.++..+.+..+-+++.  +.|++-.+.-.|+|++...++  ++.++...+...++=.|..
T Consensus       167 GlP~Qt~~~~~~~l~~~~~l~p--~his~Y~L~~e~~T~~~~~~~~lp~~~~~~~my~~~~~~L~~  230 (378)
T PRK05660        167 GLPDQSLEEALDDLRQAIALNP--PHLSWYQLTIEPNTVFGSRPPVLPDDDALWDIFEQGHQLLTA  230 (378)
T ss_pred             CCCCCCHHHHHHHHHHHHCCCC--CCEEEEEEEECCCCHHHHCCCCCCCHHHHHHHHHHHHHHHHH
T ss_conf             8999889999999999864498--805788888658973764676699858999999999999997


No 47 
>PRK09058 coproporphyrinogen III oxidase; Provisional
Probab=99.57  E-value=3.1e-13  Score=108.40  Aligned_cols=203  Identities=15%  Similarity=0.265  Sum_probs=138.8

Q ss_pred             EEEEEEECCCCCCCCCCCCCCCCCCC--CCCCCCCCCCHHHHHHHHHHHHH----C--CCEEEEEECCCCCCCCCCHHHH
Q ss_conf             99864530786834232124335477--75641000685799999999996----4--9838997303688874428999
Q gi|254780485|r   54 LSKLLNIKTGGCPENCGYCNQSVHNK--SKLKASKLINVDQVLKEAKNAKE----N--GATRYCMGAAWREPKERDLSII  125 (328)
Q Consensus        54 ~~~~in~~TN~C~~~C~fCaf~~~~~--~~~~~~~~~~~Eei~~~a~~~~~----~--G~~~~~l~~~~~~~~~~~~~~~  125 (328)
                      +..+|-    .|...|.||+|.....  .....|    .+.+.++.+...+    .  .+..+.+++|  +|.....+.+
T Consensus        59 LYiHIP----FC~~~C~yC~F~~~~~~~~~~~~Y----~~aL~~Ei~~~~~~~~~~~~~i~tvy~GGG--TPs~L~~~~l  128 (447)
T PRK09058         59 LYIHIP----FCRTHCTFCGFFQNAWNPELVARY----TDALIRELAMEADSPLTQSAPIHAVYFGGG--TPTALSADDL  128 (447)
T ss_pred             EEEECC----CCCCCCCCCCCCCCCCCCCCHHHH----HHHHHHHHHHHHCCCCCCCCEEEEEEEECC--HHHHCCHHHH
T ss_conf             999825----415868999884848881209999----999999999985410126981689998086--3474899999


Q ss_pred             HHHHHHHCC-----CCCCEEE--ECCCCCHHHHHHHHCCCCCEEEEECCC-CHHHHHCCCCCCCHHHHHHHHHHHHHCCC
Q ss_conf             998876213-----6883241--025699999998741576069751343-77773205888898999999999998798
Q gi|254780485|r  126 VDMIKGVKS-----LGLETCM--TLGMLSFEQAQILSKAGLDYYNHNIDT-SERFYPHVTTTHTFEDRLQTLENVRKSGI  197 (328)
Q Consensus       126 ~e~i~~i~~-----~~~~i~~--~~g~~~~~~~~~Lk~aG~~~~~~~let-~~~~~~~~~~~~~~~~~l~~~~~a~~~G~  197 (328)
                      .+++..+++     .+.++.+  ++..++++.+..++++|++++.+++.+ +++..+.+...|+.++-++.++.+++.|+
T Consensus       129 ~~l~~~i~~~f~l~~d~EiTiE~nP~~~~~~~l~~l~~~GvNRiSiGVQSf~~~vlk~lgR~h~~~~~~~~l~~l~~~g~  208 (447)
T PRK09058        129 ARLIEALREYLPLAPDCEITLEGRINGFDDEKIDAALDAGANRFSFGVQSFNTQVRRRAGRKDDREEVLAFLEELVARDR  208 (447)
T ss_pred             HHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHCCCCEEEEECCCCCHHHHHHCCCCCCHHHHHHHHHHHHHCCC
T ss_conf             99999999768998884698833878799999999996499805772544888899864799999999999999997499


Q ss_pred             -CCCCEEEECC-CCCHHHHHHHHHHHHHCCCCCCEEECCCEEECCCCCCCCC------C-CCCHHHHHHHHHHHHHHCCC
Q ss_conf             -5577078668-9899999999999974088886020541120487412445------6-87989999999999996868
Q gi|254780485|r  198 -KVCCGGILGL-GEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEEN------K-KVDPIEHVRIISVARILMPK  268 (328)
Q Consensus       198 -~~~sg~l~G~-gEt~eeri~~l~~lr~l~~~~~~v~~~~~~p~~gt~l~~~------~-~~~~~e~lr~iAi~RL~lP~  268 (328)
                       .++.-+|||+ |+|.++..+.|..+-+++.  +.|++-.+...|+|++...      + +++.++...+...+.=.|..
T Consensus       209 ~~iniDLIyGlPgQT~e~~~~dl~~~~~l~p--~his~Y~L~~~~~t~~~~~~~~g~l~~~~d~~~~~~my~~a~~~L~~  286 (447)
T PRK09058        209 AAVVCDLIFGLPGQTPEIWQQDLAIVRDLGL--DGVDLYALNVLPGTPLAKAVEKGKLPPPATPAEQADMYAYGVEFLAQ  286 (447)
T ss_pred             CCEEEHHHCCCCCCCHHHHHHHHHHHHCCCC--CEEEEEEEEECCCCHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHHH
T ss_conf             6376476427988999999999999964599--86887654504897799998749999985999999999999999997


No 48 
>pfam04055 Radical_SAM Radical SAM superfamily. Radical SAM proteins catalyse diverse reactions, including unusual methylations, isomerisation, sulphur insertion, ring formation, anaerobic oxidation and protein radical formation.
Probab=99.57  E-value=1.5e-13  Score=110.46  Aligned_cols=158  Identities=25%  Similarity=0.362  Sum_probs=112.3

Q ss_pred             EECCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCCCCH-HHHHHHHHHHC--CC
Q ss_conf             5307868342321243354777564100068579999999999649838997303688874428-99999887621--36
Q gi|254780485|r   59 NIKTGGCPENCGYCNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDL-SIIVDMIKGVK--SL  135 (328)
Q Consensus        59 n~~TN~C~~~C~fCaf~~~~~~~~~~~~~~~~Eei~~~a~~~~~~G~~~~~l~~~~~~~~~~~~-~~~~e~i~~i~--~~  135 (328)
                      .+ |..|..+|.||.++...  ........+.|++.+.++...+.|...+.+. ++.+...... ..+..+.....  ..
T Consensus         2 ~~-~~gC~~~C~fC~~~~~~--~~~~~~~~~~~~i~~~~~~~~~~~~~~i~~~-gg~p~~~~~~~~~~~~~~~~~~~~~~   77 (165)
T pfam04055         2 II-TPGCNLRCTYCAFPSIR--ARGKGRELSPEEILEEAKELARLGVEVVILT-GGEPLLLPDLVELLERLLKLEELEGI   77 (165)
T ss_pred             EE-CCCCCCCCCCCCCCCCC--CCCCCCCCCHHHHHHHHHHHHHCCCEEEEEE-CCCCCCCHHHHHHHHHHHHHCCCCCE
T ss_conf             88-93748779689997857--8886522699999999988874598599993-16766652777778887653146764


Q ss_pred             CCCEEEECCCCCHHHHHHHHCCCCCEEEEECCCC-HHHHHCCCCCCCHHHHHHHHHHHHHCCCCCCCEEEECC-CCCHHH
Q ss_conf             8832410256999999987415760697513437-77732058888989999999999987985577078668-989999
Q gi|254780485|r  136 GLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTS-ERFYPHVTTTHTFEDRLQTLENVRKSGIKVCCGGILGL-GEMIDD  213 (328)
Q Consensus       136 ~~~i~~~~g~~~~~~~~~Lk~aG~~~~~~~let~-~~~~~~~~~~~~~~~~l~~~~~a~~~G~~~~sg~l~G~-gEt~ee  213 (328)
                      ...+..+.+..+++.++.|+++|.+.+.+.+|+. +...+...++++++++++.++.+++.|+.+..++++|+ +|+.++
T Consensus        78 ~~~~~t~~~~~~~~~~~~l~~~g~~~i~~~ie~~~~~~~~~~~~~~~~~~~~~~i~~~~~~gi~~~~~~i~~~~~e~~~~  157 (165)
T pfam04055        78 RITLETNGTLLDEELLEELKEAGLDRVSISLQSGDDEVLKIINRGHTFEEVLEALELLREAGIPVVVDNIVGLPGENDED  157 (165)
T ss_pred             EEEEEEECCCCCHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHCCCCCHHHHHHHHHHHHHCCCCEEEEEEEECCCCCHHH
T ss_conf             89999851433104568999719852224635599999998579999899999999999879978899999799999999


Q ss_pred             HHHHHHH
Q ss_conf             9999999
Q gi|254780485|r  214 RIDMLLT  220 (328)
Q Consensus       214 ri~~l~~  220 (328)
                      ..+.+..
T Consensus       158 ~~~~~~~  164 (165)
T pfam04055       158 LEETLEL  164 (165)
T ss_pred             HHHHHHH
T ss_conf             9999603


No 49 
>PRK08807 consensus
Probab=99.56  E-value=6e-13  Score=106.44  Aligned_cols=195  Identities=13%  Similarity=0.153  Sum_probs=133.3

Q ss_pred             CCCCCCCCCCCCCCCCCCC---CCCCCCCHHHHHHHHHH----HHHCCCEEEEEECCCCCCCCCCHHHHHHHHHHHCC--
Q ss_conf             6834232124335477756---41000685799999999----99649838997303688874428999998876213--
Q gi|254780485|r   64 GCPENCGYCNQSVHNKSKL---KASKLINVDQVLKEAKN----AKENGATRYCMGAAWREPKERDLSIIVDMIKGVKS--  134 (328)
Q Consensus        64 ~C~~~C~fCaf~~~~~~~~---~~~~~~~~Eei~~~a~~----~~~~G~~~~~l~~~~~~~~~~~~~~~~e~i~~i~~--  134 (328)
                      .|...|.||.|........   ..|.    +.++++.+.    ....-+..+.++  |+.|.....+.+..++..++.  
T Consensus        17 FC~~~C~YCdf~s~~~~~~~~~~~y~----~~l~~ei~~~~~~~~~~~~~tiy~G--GGTPs~L~~~~l~~ll~~i~~~~   90 (385)
T PRK08807         17 WCVRKCPYCDFNSHAAKGALPFDAYV----DALIRDLDADLPLVWGRVVHSVFFG--GGTPSLFPPEAIDRFLQAAAARL   90 (385)
T ss_pred             CCCCCCCCCCCCCCCCCCCCCHHHHH----HHHHHHHHHHHHHCCCCEEEEEEEC--CCHHHHCCHHHHHHHHHHHHHHC
T ss_conf             88885899989441078987699999----9999999974455069844389979--95557379999999999999966


Q ss_pred             ---CCCCEE--EECCCCCHHHHHHHHCCCCCEEEEECCC-CHHHHHCCCCCCCHHHHHHHHHHHHHCCCC-CCCEEEECC
Q ss_conf             ---688324--1025699999998741576069751343-777732058888989999999999987985-577078668
Q gi|254780485|r  135 ---LGLETC--MTLGMLSFEQAQILSKAGLDYYNHNIDT-SERFYPHVTTTHTFEDRLQTLENVRKSGIK-VCCGGILGL  207 (328)
Q Consensus       135 ---~~~~i~--~~~g~~~~~~~~~Lk~aG~~~~~~~let-~~~~~~~~~~~~~~~~~l~~~~~a~~~G~~-~~sg~l~G~  207 (328)
                         .+.++.  ++++.++.+.+..|+++|++++.++++| .+...+.+...|+.++-.++++.++++|++ ++.-+|||+
T Consensus        91 ~~~~~~E~TiE~nP~~~~~~~l~~l~~~GvnRlSlGvQsf~~~~L~~lgR~h~~~~~~~ai~~~r~~gf~nin~DLiygl  170 (385)
T PRK08807         91 RFAPNLEITLETNPGTAEHGRFDHYRAAGVNRLSFGVQSFDDVALQRLGRIHDSAEAERAIKLAQDAGYDNFNIDLMYAL  170 (385)
T ss_pred             CCCCCEEEEEECCCCCCHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHCCCCCHHHHHHHHHHHHHCCCCCCCCCEEECC
T ss_conf             97767169995272101088999998569875887415589999998489998999999999999749973130103269


Q ss_pred             -CCCHHHHHHHHHHHHHCCCCCCEEECCCEEECCCCCCCCCCC---CCHHHHHHHHHHHHHHC
Q ss_conf             -989999999999997408888602054112048741244568---79899999999999968
Q gi|254780485|r  208 -GEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKK---VDPIEHVRIISVARILM  266 (328)
Q Consensus       208 -gEt~eeri~~l~~lr~l~~~~~~v~~~~~~p~~gt~l~~~~~---~~~~e~lr~iAi~RL~l  266 (328)
                       |+|.++..+.+..+-+++.  +.+++-.+.-.|||++.....   +++++...+...+.=.|
T Consensus       171 P~Qt~~~~~~~l~~~~~l~p--~hiS~Y~L~ie~~t~~~~~~~~~lp~~d~~~~~~~~~~~~L  231 (385)
T PRK08807        171 PEQTLLQAEHDLERAFALQP--THLSHYQLTLEPNTVFFARPPQGIPDDDAAWDMQEHCQRLL  231 (385)
T ss_pred             CCCCHHHHHHHHHHHHCCCC--CEEEEEEEEECCCCHHHHCCCCCCCCHHHHHHHHHHHHHHH
T ss_conf             99989999999999855599--84789888851783575454225996789999999999999


No 50 
>COG1032 Fe-S oxidoreductase [Energy production and conversion]
Probab=99.56  E-value=1.2e-12  Score=104.54  Aligned_cols=191  Identities=21%  Similarity=0.339  Sum_probs=133.5

Q ss_pred             EEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCEEEEEE----CCCCCCCCCCHHHHHH---
Q ss_conf             986453078683423212433547775641000685799999999996498389973----0368887442899999---
Q gi|254780485|r   55 SKLLNIKTGGCPENCGYCNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMG----AAWREPKERDLSIIVD---  127 (328)
Q Consensus        55 ~~~in~~TN~C~~~C~fCaf~~~~~~~~~~~~~~~~Eei~~~a~~~~~~G~~~~~l~----~~~~~~~~~~~~~~~e---  127 (328)
                      ...+.+ |-.|+.+|.||+.+...     .+...+.+.+.++++...+.|..++...    .....+.. ..++..+   
T Consensus       199 ~~~ve~-~RGCp~~C~FC~~~~~~-----~~r~~~~~~v~~ei~~~~~~~~~~~~~~~~~~f~~~~~~~-~~~~~~~~l~  271 (490)
T COG1032         199 AFSVET-SRGCPRGCRFCSITKHF-----KYRRRRPERVVEEIKELIEEGGKRVVFFVDDIFLYGSPAL-NDEKRFELLS  271 (490)
T ss_pred             EEEEEE-ECCCCCCCCCCCCCCCC-----CCCCCCHHHHHHHHHHHHHHHHHCCCEECCCEEECCCCCC-CHHHHHHHHH
T ss_conf             699999-78888899888886114-----6005788999999999999873214502355774478543-4167888879


Q ss_pred             --HHHHHCCCCCCEE-----EECCCCC-HHHHHHHHCCCCCEEEEECCC-CHHHHHCCCCCCCHHHHHH-HHHHHHHCCC
Q ss_conf             --8876213688324-----1025699-999998741576069751343-7777320588889899999-9999998798
Q gi|254780485|r  128 --MIKGVKSLGLETC-----MTLGMLS-FEQAQILSKAGLDYYNHNIDT-SERFYPHVTTTHTFEDRLQ-TLENVRKSGI  197 (328)
Q Consensus       128 --~i~~i~~~~~~i~-----~~~g~~~-~~~~~~Lk~aG~~~~~~~let-~~~~~~~~~~~~~~~~~l~-~~~~a~~~G~  197 (328)
                        +++........++     +.+...+ ++....++++|...+.+.+|| +++..+.+.+.++.++-++ .++.+.+.|+
T Consensus       272 ~~~~~~~~~~~~~~~~~~~~~r~d~~~~~~~~~~~~~~g~~~~~iG~Esgs~~~l~~~~k~~~~~~~~~~a~~~~~~~~~  351 (490)
T COG1032         272 LELIERGLRKGCRVHISAPSLRADTVTDEELLKLLREAGLRRVYIGIESGSEELLKKINKGITTEEVLEEAVKIAKEHGL  351 (490)
T ss_pred             HHHHHHHCCCCCEEEEECCCCCCCCCCHHHHHHHHHHCCCEEEEEECCCCCHHHHHHHHCCCCHHHHHHHHHHHHHHCCC
T ss_conf             99998630467603575230033437879999998764943699965899999999861478868889999999986798


Q ss_pred             CCCCEEEECC-CCCHHHHHHH---HHHHHHCCCCCCEEECCCEEECCCCCCCCCCCCCHH
Q ss_conf             5577078668-9899999999---999974088886020541120487412445687989
Q gi|254780485|r  198 KVCCGGILGL-GEMIDDRIDM---LLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPI  253 (328)
Q Consensus       198 ~~~sg~l~G~-gEt~eeri~~---l~~lr~l~~~~~~v~~~~~~p~~gt~l~~~~~~~~~  253 (328)
                      .+..++|+|+ |||.++....   +..+++++.. ..+..++|+|.|+|++.........
T Consensus       352 ~~~~~~i~G~pget~ed~~~t~~~~~~~~~~~~~-~~~~~~~~~p~p~t~~~~~~~~~~~  410 (490)
T COG1032         352 RVKLYFIVGLPGETEEDVKETIELAKFIKKLGPK-LYVSPSPFVPLPGTPLQEMPKLENE  410 (490)
T ss_pred             CCEEEEEECCCCCCHHHHHHHHHHHHHHHHHCCC-CEEEEEEEEECCCCCHHHCCCCCCH
T ss_conf             6179999827999979999999999999871867-4588764164698841322453201


No 51 
>PRK06582 coproporphyrinogen III oxidase; Provisional
Probab=99.55  E-value=1.1e-12  Score=104.57  Aligned_cols=207  Identities=17%  Similarity=0.191  Sum_probs=143.4

Q ss_pred             CCEEEEEEEEEECCCCCCCCCCCCCCCCCCCC--CCCCCCCCCHHHHHHHHHHHH----HCCCEEEEEECCCCCCCCCCH
Q ss_conf             98569998645307868342321243354777--564100068579999999999----649838997303688874428
Q gi|254780485|r   49 PNHIQLSKLLNIKTGGCPENCGYCNQSVHNKS--KLKASKLINVDQVLKEAKNAK----ENGATRYCMGAAWREPKERDL  122 (328)
Q Consensus        49 g~~V~~~~~in~~TN~C~~~C~fCaf~~~~~~--~~~~~~~~~~Eei~~~a~~~~----~~G~~~~~l~~~~~~~~~~~~  122 (328)
                      .|.+.+..+|-    .|...|.||.|......  ....|.    +.+.++.+...    ..-+..+.+++  ++|.....
T Consensus         9 ~~~lsLYiHIP----FC~~~C~yC~f~~~~~~~~~~~~y~----~~l~~Ei~~~~~~~~~~~i~tiy~GG--GTPs~L~~   78 (390)
T PRK06582          9 ANDLSIYIHWP----FCLSKCPYCDFNSHVASTIDHNQWL----KSYEKEIEYFKDIIQNKYIKSIFFGG--GTPSLMNP   78 (390)
T ss_pred             CCCEEEEEEEC----CCCCCCCCCCCCCEECCCCCHHHHH----HHHHHHHHHHHHHCCCCEEEEEEECC--CHHHHCCH
T ss_conf             77749999838----9988089993907148858899999----99999999988764798057999898--51352899


Q ss_pred             HHHHHHHHHHCCC-----CCCEE--EECCCCCHHHHHHHHCCCCCEEEEECCC-CHHHHHCCCCCCCHHHHHHHHHHHHH
Q ss_conf             9999988762136-----88324--1025699999998741576069751343-77773205888898999999999998
Q gi|254780485|r  123 SIIVDMIKGVKSL-----GLETC--MTLGMLSFEQAQILSKAGLDYYNHNIDT-SERFYPHVTTTHTFEDRLQTLENVRK  194 (328)
Q Consensus       123 ~~~~e~i~~i~~~-----~~~i~--~~~g~~~~~~~~~Lk~aG~~~~~~~let-~~~~~~~~~~~~~~~~~l~~~~~a~~  194 (328)
                      +.+..++..++..     ..++.  ++++.++.+.++.|+++|++++.+++.+ .++..+.+...|+.++.+++++.|++
T Consensus        79 ~~l~~l~~~l~~~~~~~~~~EiTiE~nP~~~~~~~l~~l~~~GvNRiSiGVQsf~~~~L~~lgR~h~~~~~~~~i~~~~~  158 (390)
T PRK06582         79 VIVEGIINKISNLAIIDNQTEITLETNPTSFETEKFKAFKSAGINRVSIGVQSLKEDDLKKLGRTHDCMQAIKTIEAANT  158 (390)
T ss_pred             HHHHHHHHHHHHHCCCCCCCEEEEEECCCCCCHHHHHHHHHCCCCEEEEECCCCCHHHHHHHCCCCCHHHHHHHHHHHHH
T ss_conf             99999999999857888873489984432061989999985598679997133898999971899889999999999987


Q ss_pred             CCCCCCCEEEECC-CCCHHHHHHHHHHHHHCCCCCCEEECCCEEECCCCCCCC------CCCCCHHHHHHHHHHHHHHCC
Q ss_conf             7985577078668-989999999999997408888602054112048741244------568798999999999999686
Q gi|254780485|r  195 SGIKVCCGGILGL-GEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEE------NKKVDPIEHVRIISVARILMP  267 (328)
Q Consensus       195 ~G~~~~sg~l~G~-gEt~eeri~~l~~lr~l~~~~~~v~~~~~~p~~gt~l~~------~~~~~~~e~lr~iAi~RL~lP  267 (328)
                      ..-.++.-.|||+ ++|.++..+.|..+-+++.  +.+++..+.-.++||+..      ...|++++...+...+.=.|.
T Consensus       159 ~f~niniDLI~GlP~QT~~~~~~~L~~~~~l~p--~hiS~Y~L~ie~~t~~~~~~~~g~~~lp~~d~~~~~y~~~~~~L~  236 (390)
T PRK06582        159 IFPRVSFDLIYARSGQTLKDWQEELKQAMQLAT--SHISLYQLTIEKGTPFYKLFKEGNLILPHSDAAAEMYEWTNHYLE  236 (390)
T ss_pred             HCCCEEEEEECCCCCCCHHHHHHHHHHHHHCCC--CCEEEEEEEECCCCHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHH
T ss_conf             463354454147999989999999999983389--851789888537977888874189899988999999999999998


No 52 
>PRK08949 consensus
Probab=99.54  E-value=1.3e-12  Score=104.25  Aligned_cols=199  Identities=17%  Similarity=0.273  Sum_probs=135.6

Q ss_pred             EEECCCCCCCCCCCCCCCCCC-CCCC--CCCCCCCHHHHHHHHHH----HHHCCCEEEEEECCCCCCCCCCHHHHHHHHH
Q ss_conf             453078683423212433547-7756--41000685799999999----9964983899730368887442899999887
Q gi|254780485|r   58 LNIKTGGCPENCGYCNQSVHN-KSKL--KASKLINVDQVLKEAKN----AKENGATRYCMGAAWREPKERDLSIIVDMIK  130 (328)
Q Consensus        58 in~~TN~C~~~C~fCaf~~~~-~~~~--~~~~~~~~Eei~~~a~~----~~~~G~~~~~l~~~~~~~~~~~~~~~~e~i~  130 (328)
                      ++|+  .|...|.||.|.... +...  ..|.    +.++++.+.    ....-+..+.+++  ++|.....+.+..++.
T Consensus        11 iHIP--FC~~~C~YCdf~s~~~~~~~~~~~Y~----~aL~~El~~~~~~~~~~~~~tiy~GG--GTPs~L~~~~l~~ll~   82 (378)
T PRK08949         11 IHIP--WCVQKCPYCDFNSHALKGEVPHQDYV----QHLLADLDADVAYAQGRELHTIFIGG--GTPSLLSAEAMQTLLD   82 (378)
T ss_pred             EEEC--CCCCCCCCCCCCCCCCCCCCCHHHHH----HHHHHHHHHHHHHCCCCEEEEEEEEC--CHHHHCCHHHHHHHHH
T ss_conf             9808--87671899999863288887599999----99999999865650797687999728--2320079999999999


Q ss_pred             HHCC-----CCCCEE--EECCCCCHHHHHHHHCCCCCEEEEECCC-CHHHHHCCCCCCCHHHHHHHHHHHHHCCCC-CCC
Q ss_conf             6213-----688324--1025699999998741576069751343-777732058888989999999999987985-577
Q gi|254780485|r  131 GVKS-----LGLETC--MTLGMLSFEQAQILSKAGLDYYNHNIDT-SERFYPHVTTTHTFEDRLQTLENVRKSGIK-VCC  201 (328)
Q Consensus       131 ~i~~-----~~~~i~--~~~g~~~~~~~~~Lk~aG~~~~~~~let-~~~~~~~~~~~~~~~~~l~~~~~a~~~G~~-~~s  201 (328)
                      .+++     .+.++.  ++++.++.+.+..++++|++++.++++| .+...+.+...|+.++-+++++.++++|+. ++.
T Consensus        83 ~i~~~f~~~~~~EiTiE~nP~~~~~~~l~~l~~~GvNRiSlGvQsf~~~~L~~lgR~h~~~~~~~a~~~~~~~gf~~ini  162 (378)
T PRK08949         83 GVRARLPFAADAEITMEANPGTVEADRFVGYQRAGVNRISIGVQSFSEEKLKRLGRIHGPQEAKRAAKLASGLGLRSFNL  162 (378)
T ss_pred             HHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHCCCEEEEEECCCCHHHHHHHCCCCCHHHHHHHHHHHHHCCCCCEEE
T ss_conf             99986798767058995582523188999999719866999503489899998379999999999999998659962502


Q ss_pred             EEEECC-CCCHHHHHHHHHHHHHCCCCCCEEECCCEEECCCCCCCCCCCC--CHHHHHHHHHHHHHHC
Q ss_conf             078668-9899999999999974088886020541120487412445687--9899999999999968
Q gi|254780485|r  202 GGILGL-GEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKV--DPIEHVRIISVARILM  266 (328)
Q Consensus       202 g~l~G~-gEt~eeri~~l~~lr~l~~~~~~v~~~~~~p~~gt~l~~~~~~--~~~e~lr~iAi~RL~l  266 (328)
                      -+|||+ |+|.++..+.|..+-+++.  +.+++-.+...|+|++...+..  +.++...+...+.=.|
T Consensus       163 DLiyglP~Qt~~~~~~~l~~~~~l~p--~hiS~Y~L~ie~~t~~~~~~~~lp~~~~~~~~y~~~~~~L  228 (378)
T PRK08949        163 DLMHGLPDQSLEEALDDLRQAIALNP--PHLSWYQLTIEPNTLFGSRPPVLPDDDALWDIFEQGHQLL  228 (378)
T ss_pred             CCCCCCCCCCHHHHHHHHHHHHCCCC--CEEEEEEEEECCCCHHHHCCCCCCCHHHHHHHHHHHHHHH
T ss_conf             32368999899999999999966699--8378874686489737646778997599999999999999


No 53 
>PRK09057 coproporphyrinogen III oxidase; Provisional
Probab=99.53  E-value=9.4e-13  Score=105.13  Aligned_cols=202  Identities=12%  Similarity=0.161  Sum_probs=135.5

Q ss_pred             EEECCCCCCCCCCCCCCCCCC---CCCCCCCCCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCCCCHHHHHHHHHHHCC
Q ss_conf             453078683423212433547---77564100068579999999999649838997303688874428999998876213
Q gi|254780485|r   58 LNIKTGGCPENCGYCNQSVHN---KSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKS  134 (328)
Q Consensus        58 in~~TN~C~~~C~fCaf~~~~---~~~~~~~~~~~~Eei~~~a~~~~~~G~~~~~l~~~~~~~~~~~~~~~~e~i~~i~~  134 (328)
                      ++|+  .|...|.||.|...-   ..+..+|...-..|+...+......-+..+.+++  ++|.....+.+..++..++.
T Consensus         9 iHIP--FC~~~C~YCdf~~~~~~~~~~~~~Y~~~L~~Ei~~~~~~~~~~~i~tiy~GG--GTPs~L~~~~l~~ll~~l~~   84 (381)
T PRK09057          9 VHWP--FCLAKCPYCDFNSHVRHAPIDQARFAAAFLRELATEAARTGPRTLTSIFFGG--GTPSLMQPETVAALLDAIAR   84 (381)
T ss_pred             EEEC--CCCCCCCCCCCCCEECCCCCCHHHHHHHHHHHHHHHHHHCCCCCEEEEEECC--CHHHCCCHHHHHHHHHHHHH
T ss_conf             9817--8888289994987017887879999999999999999875999357999799--61230999999999999998


Q ss_pred             ---C--CCCEE--EECCCCCHHHHHHHHCCCCCEEEEECCC-CHHHHHCCCCCCCHHHHHHHHHHHHHCCCCCCCEEEEC
Q ss_conf             ---6--88324--1025699999998741576069751343-77773205888898999999999998798557707866
Q gi|254780485|r  135 ---L--GLETC--MTLGMLSFEQAQILSKAGLDYYNHNIDT-SERFYPHVTTTHTFEDRLQTLENVRKSGIKVCCGGILG  206 (328)
Q Consensus       135 ---~--~~~i~--~~~g~~~~~~~~~Lk~aG~~~~~~~let-~~~~~~~~~~~~~~~~~l~~~~~a~~~G~~~~sg~l~G  206 (328)
                         .  +.++.  ++++.++.+.++.|+++|++++.++++| .+...+.+...|+.++-+++++.+++..-.++.-+|||
T Consensus        85 ~f~~~~~~EiTiE~nP~~~~~~~l~~l~~~GvnRiSlGVQsf~~~~l~~lgR~h~~~~~~~ai~~~r~~f~~in~DLiyG  164 (381)
T PRK09057         85 LWPVADDIEITLEANPTSVEAGRFRGYRAAGVNRVSLGVQALNDADLRFLGRLHSVAEALAAIDLAREIFPRVSFDLIYA  164 (381)
T ss_pred             HCCCCCCCEEEEECCHHHCCHHHHHHHHHHCCCEEEEECCCCCHHHHHHCCCCCCHHHHHHHHHHHHHHCCCCCHHHHCC
T ss_conf             67986572367723742201679999997098769896234999999973899989999999999998654512066427


Q ss_pred             C-CCCHHHHHHHHHHHHHCCCCCCEEECCCEEECCCCCCCCC------CCCCHHHHHHHHHHHHHH
Q ss_conf             8-9899999999999974088886020541120487412445------687989999999999996
Q gi|254780485|r  207 L-GEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEEN------KKVDPIEHVRIISVARIL  265 (328)
Q Consensus       207 ~-gEt~eeri~~l~~lr~l~~~~~~v~~~~~~p~~gt~l~~~------~~~~~~e~lr~iAi~RL~  265 (328)
                      + |+|.++..+.+..+-+++.  +.|++..+...|||++...      ..|++++...+...+.=+
T Consensus       165 lPgQt~~~~~~~l~~~~~l~p--~hiS~Y~L~~e~~t~~~~~~~~g~~~~p~~d~~~~~y~~~~~~  228 (381)
T PRK09057        165 RPGQTLAAWRAELKEALGLAA--DHLSLYQLTIEEGTAFYGLHAAGKLTLPDEDLAADLYELTQEV  228 (381)
T ss_pred             CCCCCHHHHHHHHHHHHHCCC--CCCEEEEEEECCCCHHHHHHHCCCCCCCCHHHHHHHHHHHHHH
T ss_conf             988988899999999971277--7432235664489727878755888999999999999999999


No 54 
>COG1242 Predicted Fe-S oxidoreductase [General function prediction only]
Probab=99.53  E-value=7.6e-12  Score=99.04  Aligned_cols=232  Identities=19%  Similarity=0.299  Sum_probs=155.4

Q ss_pred             HHHHHHHHHHHHCCCCEEE-EEEEEEECCCCCCC--------CCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHC-C
Q ss_conf             9999999988862898569-99864530786834--------232124335477756410006857999999999964-9
Q gi|254780485|r   35 LLFWSHTVHRKNFEPNHIQ-LSKLLNIKTGGCPE--------NCGYCNQSVHNKSKLKASKLINVDQVLKEAKNAKEN-G  104 (328)
Q Consensus        35 l~~~Aa~~~r~~~~g~~V~-~~~~in~~TN~C~~--------~C~fCaf~~~~~~~~~~~~~~~~Eei~~~a~~~~~~-G  104 (328)
                      +...-.+..|++| |.+|+ +..+..|   -|+|        +|.||+-+......... ...-.+++.+.++..++. +
T Consensus         7 ~y~t~~~~lr~~f-g~Kv~Kv~ld~GF---~CPNRDGti~rGGCtFC~~~g~~d~~~~~-~~~i~~Q~~~q~~~~~kK~~   81 (312)
T COG1242           7 LYYTLNDYLREKF-GEKVFKVTLDGGF---SCPNRDGTIGRGGCTFCSVAGSGDFAGQP-KISIAEQFKEQAERMHKKWK   81 (312)
T ss_pred             HHHHHHHHHHHHH-CCEEEEEECCCCC---CCCCCCCCCCCCCEEEECCCCCCCCCCCC-CCCHHHHHHHHHHHHHHHHC
T ss_conf             7999999999983-8716998535777---89999996267864650677887634586-67789999999999987515


Q ss_pred             -CE-EEEEECCCCCCCCCCHHHHHHHHHHHCCC----CCCEEEECCCCCHHHHHHHHCCCCC---EEEEECCC-CHHHHH
Q ss_conf             -83-89973036888744289999988762136----8832410256999999987415760---69751343-777732
Q gi|254780485|r  105 -AT-RYCMGAAWREPKERDLSIIVDMIKGVKSL----GLETCMTLGMLSFEQAQILSKAGLD---YYNHNIDT-SERFYP  174 (328)
Q Consensus       105 -~~-~~~l~~~~~~~~~~~~~~~~e~i~~i~~~----~~~i~~~~g~~~~~~~~~Lk~aG~~---~~~~~let-~~~~~~  174 (328)
                       .+ -.-+|...+.  .-+++.+-++....-+.    ++.|..-+..+.++.+..|.+..-.   .+.+++.| ..+..+
T Consensus        82 ~~kyiaYFQ~~TNT--yApvevLre~ye~aL~~~~VVGLsIgTRPDClpd~VldlL~e~~~r~~vWvELGLQT~h~~Tlk  159 (312)
T COG1242          82 RGKYIAYFQAYTNT--YAPVEVLREMYEQALSEAGVVGLSIGTRPDCLPDDVLDLLAEYNKRYEVWVELGLQTAHDKTLK  159 (312)
T ss_pred             CCCEEEEEECCCCC--CCCHHHHHHHHHHHHCCCCEEEEEECCCCCCCCHHHHHHHHHHHHHEEEEEEECCCHHHHHHHH
T ss_conf             78679998146666--6759999999999727588047750589988818999999998644578877453055589999


Q ss_pred             CCCCCCCHHHHHHHHHHHHHCCCCCCCEEEECC-CCCHHHHHHHHHHHHHCCCCCCEEECCCEEECCCCCCCC------C
Q ss_conf             058888989999999999987985577078668-989999999999997408888602054112048741244------5
Q gi|254780485|r  175 HVTTTHTFEDRLQTLENVRKSGIKVCCGGILGL-GEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEE------N  247 (328)
Q Consensus       175 ~~~~~~~~~~~l~~~~~a~~~G~~~~sg~l~G~-gEt~eeri~~l~~lr~l~~~~~~v~~~~~~p~~gt~l~~------~  247 (328)
                      .+-..|+++...++.+.+++.||++|+++|+|+ ||++++.++.+..+.+++.  ++|-+-+++-.+||+|+.      .
T Consensus       160 ~iNRgHd~~~y~dav~r~rkrgIkvc~HiI~GLPgE~~~~mleTak~v~~~~v--~GIKlH~LhvvkgT~m~k~Y~~G~l  237 (312)
T COG1242         160 RINRGHDFACYVDAVKRLRKRGIKVCTHLINGLPGETRDEMLETAKIVAELGV--DGIKLHPLHVVKGTPMEKMYEKGRL  237 (312)
T ss_pred             HHHCCCCHHHHHHHHHHHHHCCCEEEEEEEECCCCCCHHHHHHHHHHHHHCCC--CEEEEEEEEEECCCHHHHHHHCCCC
T ss_conf             87624544999999999997497498888407988888999999999986687--5388887888638759999971886


Q ss_pred             CCCCHHHHHHHHH-HHHHHCCCCCCE-EEE
Q ss_conf             6879899999999-999968687214-231
Q gi|254780485|r  248 KKVDPIEHVRIIS-VARILMPKSRLR-LAA  275 (328)
Q Consensus       248 ~~~~~~e~lr~iA-i~RL~lP~~~i~-i~~  275 (328)
                      ..+|.+||..+++ ..+.+=|++.|+ |++
T Consensus       238 ~~ls~eeYv~~~~d~le~lpp~vviHRitg  267 (312)
T COG1242         238 KFLSLEEYVELVCDQLEHLPPEVVIHRITG  267 (312)
T ss_pred             EECCHHHHHHHHHHHHHHCCCCEEEEEECC
T ss_conf             554599999999999974893269997037


No 55 
>PRK06294 coproporphyrinogen III oxidase; Provisional
Probab=99.53  E-value=1.1e-12  Score=104.77  Aligned_cols=203  Identities=17%  Similarity=0.191  Sum_probs=136.5

Q ss_pred             EEECCCCCCCCCCCCCCCCCCC--CCCCCCCC-CCHHHHHHHHHHHHHCCCEEEEEECCCCCCCCCCHHHHHHHHHHHCC
Q ss_conf             4530786834232124335477--75641000-68579999999999649838997303688874428999998876213
Q gi|254780485|r   58 LNIKTGGCPENCGYCNQSVHNK--SKLKASKL-INVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKS  134 (328)
Q Consensus        58 in~~TN~C~~~C~fCaf~~~~~--~~~~~~~~-~~~Eei~~~a~~~~~~G~~~~~l~~~~~~~~~~~~~~~~e~i~~i~~  134 (328)
                      ++|+  .|...|.||.|.....  .....|.. +-.|++...+.......+..+.++  |++|.....+.+.+++..++.
T Consensus        11 iHIP--FC~~~C~yC~f~~~~~~~~~~~~Y~~al~~e~~~~~~~~~~~~~~~tiy~G--GGTPs~L~~~~L~~ll~~i~~   86 (374)
T PRK06294         11 IHIP--FCSKKCHYCSFYTIPYKEESVSLYCNAVIKEGLKKLAPLRCTHFIDTVFFG--GGTPSLVPPDLIQDILKTLEA   86 (374)
T ss_pred             EECC--CCCCCCCCCCCEEECCCCCCHHHHHHHHHHHHHHHHHHCCCCCEEEEEEEC--CCHHHHCCHHHHHHHHHHHCC
T ss_conf             8627--899879999881024882339999999999999997643489817999978--970163889999999997401


Q ss_pred             C-CCCE--EEECCCCCHHHHHHHHCCCCCEEEEECCC-CHHHHHCCCCCCCHHHHHHHHHHHHHCCC-CCCCEEEECC-C
Q ss_conf             6-8832--41025699999998741576069751343-77773205888898999999999998798-5577078668-9
Q gi|254780485|r  135 L-GLET--CMTLGMLSFEQAQILSKAGLDYYNHNIDT-SERFYPHVTTTHTFEDRLQTLENVRKSGI-KVCCGGILGL-G  208 (328)
Q Consensus       135 ~-~~~i--~~~~g~~~~~~~~~Lk~aG~~~~~~~let-~~~~~~~~~~~~~~~~~l~~~~~a~~~G~-~~~sg~l~G~-g  208 (328)
                      . ..++  -++++.++.+.++.|++.|++++.+++++ .++..+.+...|+.++-.++++.++++|+ .++.-+|||+ |
T Consensus        87 ~~~~E~TiE~nP~~~~~~~l~~l~~~GinRlSlGVQsf~d~~l~~lgR~h~~~~~~~~i~~~~~~gf~~iniDLIyGlPg  166 (374)
T PRK06294         87 PHATEITLEANPENLSFSYLRALAQTPINRISIGVQTFDDPLLKLLGRTHSSSAAIEAVLECYEHGFSNLSIDLIYGLPT  166 (374)
T ss_pred             CCCCEEEEEECCCCCCHHHHHHHHHCCCCEEEEEEECCCHHHHHHHCCCCCHHHHHHHHHHHHHCCCCCEEEEEECCCCC
T ss_conf             68843899853476999999999972987598972107678898738999999999999999975997433211047888


Q ss_pred             CCHHHHHHHHHHHHHCCCCCCEEECCCEEECCCCCCCCCC------CCCHHHHHHHHHHHHHHC
Q ss_conf             8999999999999740888860205411204874124456------879899999999999968
Q gi|254780485|r  209 EMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENK------KVDPIEHVRIISVARILM  266 (328)
Q Consensus       209 Et~eeri~~l~~lr~l~~~~~~v~~~~~~p~~gt~l~~~~------~~~~~e~lr~iAi~RL~l  266 (328)
                      +|.++....+..+-+++.  +.+++..+.-.|+|++....      .++.++...+...++=.|
T Consensus       167 Qt~~~~~~~l~~~~~l~p--~hiS~Y~L~iep~t~~~~~~~~~~~~~p~~~~~~~~~~~~~~~L  228 (374)
T PRK06294        167 QSLSDFIMDLHQALTLPI--THISLYNLTIDPHTSFYKHRKILLPSIADEDILAEMSLAAEELL  228 (374)
T ss_pred             CCHHHHHHHHHHHHHCCC--CEEEEEEEEECCCCHHHHHHCCCCCCCCCHHHHHHHHHHHHHHH
T ss_conf             888999999999973496--74555555765896588861338999989999999999999999


No 56 
>PRK08446 coproporphyrinogen III oxidase; Provisional
Probab=99.52  E-value=1.7e-12  Score=103.37  Aligned_cols=179  Identities=15%  Similarity=0.193  Sum_probs=130.5

Q ss_pred             CCCCCCCCCCCCCCC-CCCC-CCCCCCCHHHHHHHHHHH-H----HCCCEEEEEECCCCCCCCCCHHHHHHHHHHHCC--
Q ss_conf             683423212433547-7756-410006857999999999-9----649838997303688874428999998876213--
Q gi|254780485|r   64 GCPENCGYCNQSVHN-KSKL-KASKLINVDQVLKEAKNA-K----ENGATRYCMGAAWREPKERDLSIIVDMIKGVKS--  134 (328)
Q Consensus        64 ~C~~~C~fCaf~~~~-~~~~-~~~~~~~~Eei~~~a~~~-~----~~G~~~~~l~~~~~~~~~~~~~~~~e~i~~i~~--  134 (328)
                      .|...|.||.|.... +... ..|    .+.+.++.+.. .    ...+..+.++  |++|...+.+.+..++..+++  
T Consensus         9 FC~~~C~YCdF~~~~~~~~~~~~Y----~~aL~~Ei~~~~~~~~~~~~i~tiy~G--GGTPS~l~~~~l~~ll~~l~~~~   82 (351)
T PRK08446          9 FCESKCGYCAFNSYEDKFDLKEEY----FQALCLDLKFQLKQFIQDEKIESVFIG--GGTPSTVSAKLYEPIFEIIYPYL   82 (351)
T ss_pred             CCCCCCCCCCCCCEECCCCCHHHH----HHHHHHHHHHHHHHHCCCCCEEEEEEC--CCHHHHCCHHHHHHHHHHHHHHC
T ss_conf             838808999792851795679999----999999999998762689936699968--97456379999999999999766


Q ss_pred             -CCCCEE--EECCCCCHHHHHHHHCCCCCEEEEECCC-CHHHHHCCCCCCCHHHHHHHHHHHHHCCCC-CCCEEEECC-C
Q ss_conf             -688324--1025699999998741576069751343-777732058888989999999999987985-577078668-9
Q gi|254780485|r  135 -LGLETC--MTLGMLSFEQAQILSKAGLDYYNHNIDT-SERFYPHVTTTHTFEDRLQTLENVRKSGIK-VCCGGILGL-G  208 (328)
Q Consensus       135 -~~~~i~--~~~g~~~~~~~~~Lk~aG~~~~~~~let-~~~~~~~~~~~~~~~~~l~~~~~a~~~G~~-~~sg~l~G~-g  208 (328)
                       .+.++.  ++++.++.+.++.++++|++++.++++| .++..+.+...|+.++-+++++.|+++|++ ++.-.|||+ +
T Consensus        83 ~~~~EiTiE~nP~~~~~~~l~~l~~~GvNRiSiGVQSf~d~~Lk~lgR~H~~~~~~~ai~~~r~~gf~niniDLIyGlP~  162 (351)
T PRK08446         83 SKDCEITTEANPNSATLAWLKGMKNLGVNRISFGVQSFHEDKLKFLGRIHSKNQIIKAIENAKKAGFKNISIDLIYNTKL  162 (351)
T ss_pred             CCCCEEEEEECCCCCCHHHHHHHHHCCCCEEEEEECCCCHHHHHHHCCCCCHHHHHHHHHHHHHCCCCEECHHHHCCCCC
T ss_conf             98835999767686899999999864987699973137689999818998899999999999984996342255317999


Q ss_pred             CCHHHHHHHHHHHHHCCCCCCEEECCCEEECCCCCCCCCCCC
Q ss_conf             899999999999974088886020541120487412445687
Q gi|254780485|r  209 EMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKV  250 (328)
Q Consensus       209 Et~eeri~~l~~lr~l~~~~~~v~~~~~~p~~gt~l~~~~~~  250 (328)
                      +|.++..+.+..+-+++  ++.+++-.+...+||++......
T Consensus       163 Qt~e~~~~~l~~~~~l~--p~HiS~Y~L~ie~~T~~~~~~~~  202 (351)
T PRK08446        163 DNKKLLKEELKLAKELP--ITHLSAYALTIEENTPFEEKNAK  202 (351)
T ss_pred             CCHHHHHHHHHHHHCCC--CCEEECCCCEECCCCHHHHCCCC
T ss_conf             99999999999997489--69797423044699823325678


No 57 
>PRK13347 coproporphyrinogen III oxidase; Provisional
Probab=99.49  E-value=1.1e-11  Score=97.86  Aligned_cols=206  Identities=15%  Similarity=0.211  Sum_probs=135.0

Q ss_pred             CCEEEEEEEEEECCCCCCCCCCCCCCCCCC-CC--CCCCCCCCCHHHHHHHHHHHHH-----CCCEEEEEECCCCCCCCC
Q ss_conf             985699986453078683423212433547-77--5641000685799999999996-----498389973036888744
Q gi|254780485|r   49 PNHIQLSKLLNIKTGGCPENCGYCNQSVHN-KS--KLKASKLINVDQVLKEAKNAKE-----NGATRYCMGAAWREPKER  120 (328)
Q Consensus        49 g~~V~~~~~in~~TN~C~~~C~fCaf~~~~-~~--~~~~~~~~~~Eei~~~a~~~~~-----~G~~~~~l~~~~~~~~~~  120 (328)
                      +..+.+..+|-    .|...|.||+|.... ..  ....|.    +.+.++.+....     .-+..+.++  |++|...
T Consensus        48 ~~plsLYiHIP----FC~~~C~YC~f~~~~~~~~~~~~~Yl----~~L~~Ei~~~~~~~~~~~~v~ti~~G--GGTPs~L  117 (453)
T PRK13347         48 EEPVSLYLHVP----FCRSLCWFCGCNTIITQRDAPVEAYV----AALIREIRLVAALLPQRRRVSQLHWG--GGTPTIL  117 (453)
T ss_pred             CCCEEEEEECC----CCCCCCCCCCCCCCCCCCCCHHHHHH----HHHHHHHHHHHHHHCCCCEEEEEEEC--CCCHHHC
T ss_conf             99869998527----71680899989733778866799999----99999999988762789807899978--8482859


Q ss_pred             CHHHHHHHHHHHCC---C--CCCEEE--ECCCCCHHHHHHHHCCCCCEEEEECCC-CHHHHHCCCCCCCHHHHHHHHHHH
Q ss_conf             28999998876213---6--883241--025699999998741576069751343-777732058888989999999999
Q gi|254780485|r  121 DLSIIVDMIKGVKS---L--GLETCM--TLGMLSFEQAQILSKAGLDYYNHNIDT-SERFYPHVTTTHTFEDRLQTLENV  192 (328)
Q Consensus       121 ~~~~~~e~i~~i~~---~--~~~i~~--~~g~~~~~~~~~Lk~aG~~~~~~~let-~~~~~~~~~~~~~~~~~l~~~~~a  192 (328)
                      ..+.+.+++..+++   .  +.++.+  +++.++.+.++.|+++|++++.+++.+ .+...+.+...|+.++-.++++.|
T Consensus       118 ~~~~l~~ll~~l~~~f~~~~~~EitiE~nP~~~~~~~l~~l~~~GvNRlSlGVQsfd~~vl~~lgR~h~~~~~~~av~~a  197 (453)
T PRK13347        118 NPDQFERLMAALRDAFDFAPEAEIAVEIDPRTVTAEMLQALAALGFNRASFGVQDFDPQVQKAINRIQPEEMVARAVELL  197 (453)
T ss_pred             CHHHHHHHHHHHHHHCCCCCCCEEEEEECCCCCCHHHHHHHHHCCCCEEEEECCCCCHHHHHHHCCCCCHHHHHHHHHHH
T ss_conf             99999999999997589999966999867786899999999864986588713457878999825989999999999999


Q ss_pred             HHCCCC-CCCEEEECC-CCCHHHHHHHHHHHHHCCCCCCEEECCCEEECCCCC-----CCCCCCCCHHHHHHHHHHHHHH
Q ss_conf             987985-577078668-989999999999997408888602054112048741-----2445687989999999999996
Q gi|254780485|r  193 RKSGIK-VCCGGILGL-GEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSK-----FEENKKVDPIEHVRIISVARIL  265 (328)
Q Consensus       193 ~~~G~~-~~sg~l~G~-gEt~eeri~~l~~lr~l~~~~~~v~~~~~~p~~gt~-----l~~~~~~~~~e~lr~iAi~RL~  265 (328)
                      +++|++ ++.-.|||+ ++|.++..+.|..+-+|+.  +.|++..+...|++.     .....-|++++.+.+...++=.
T Consensus       198 r~~Gf~~iniDLIyGlP~QT~~~~~~tL~~~~~l~p--dhiS~Y~l~~~p~~~~~qr~i~~~~LP~~~~~~~m~~~a~~~  275 (453)
T PRK13347        198 RAAGFESINFDLIYGLPHQTVESFRETLDKVIALSP--DRIAVFGYAHVPSRRKNQRLIDEAALPDAEERLRQARAAADR  275 (453)
T ss_pred             HHCCCCCEEEEEECCCCCCCHHHHHHHHHHHHHCCC--CEEEECCCCCCCCHHHHHHCCCCCCCCCHHHHHHHHHHHHHH
T ss_conf             981898655555524899989999999999983199--978852320265323565325767895999999999999999


Q ss_pred             C
Q ss_conf             8
Q gi|254780485|r  266 M  266 (328)
Q Consensus       266 l  266 (328)
                      |
T Consensus       276 L  276 (453)
T PRK13347        276 L  276 (453)
T ss_pred             H
T ss_conf             9


No 58 
>TIGR00089 TIGR00089 RNA modification enzyme, MiaB family; InterPro: IPR005839   This entry represents a family defined on the basis of sequence similarity. Most of these proteins are not yet characterised, but those that are include  CDK5 regulatory subunit-associated protein 1, which specifically inhibits CDK5 activation by CDK5R1 . MiaB, a tRNA modification enzyme .  The size of proteins in this entry ranges from 47 to 61 kDa and they contain six conserved cysteines, three of which are clustered. .
Probab=99.48  E-value=1.5e-11  Score=97.12  Aligned_cols=189  Identities=16%  Similarity=0.306  Sum_probs=136.5

Q ss_pred             EEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCEEEEEECC----C-CCCCC--CC-HHHH
Q ss_conf             998645307868342321243354777564100068579999999999649838997303----6-88874--42-8999
Q gi|254780485|r   54 LSKLLNIKTGGCPENCGYCNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAA----W-REPKE--RD-LSII  125 (328)
Q Consensus        54 ~~~~in~~TN~C~~~C~fCaf~~~~~~~~~~~~~~~~Eei~~~a~~~~~~G~~~~~l~~~----~-~~~~~--~~-~~~~  125 (328)
                      +...++| ..+|.+.|+||.-.. -++  . ..-.+.|.|+++++.+.++|.+++.|.+.    . +.+..  .. +..+
T Consensus       153 ~~a~~~I-~~GC~~~CtyCivP~-~RG--~-~rSr~~e~Il~E~~~Lv~~G~kEi~L~Gqnv~~YgG~D~~~~~~~La~L  227 (455)
T TIGR00089       153 TRAFVKI-QEGCDKFCTYCIVPY-TRG--R-ERSRPPEDILEEVKELVSKGVKEITLLGQNVNAYGGKDLEGKTNSLADL  227 (455)
T ss_pred             EEEEEEE-CCCCCCCCCEEEECC-CCC--E-ECCCCHHHHHHHHHHHHHCCCEEEEEEEEEECCCCCCCCCCCCCCHHHH
T ss_conf             3899984-026586977688134-266--0-0135889999999999846980999998852562477888897647999


Q ss_pred             HHHHHH-HCCC-CCC-EEEECCCCCHHHHHHHHCC--C--CCEEEEECCC-CHHHHHCCCCCCCHHHHHHHHHHHHHC--
Q ss_conf             998876-2136-883-2410256999999987415--7--6069751343-777732058888989999999999987--
Q gi|254780485|r  126 VDMIKG-VKSL-GLE-TCMTLGMLSFEQAQILSKA--G--LDYYNHNIDT-SERFYPHVTTTHTFEDRLQTLENVRKS--  195 (328)
Q Consensus       126 ~e~i~~-i~~~-~~~-i~~~~g~~~~~~~~~Lk~a--G--~~~~~~~let-~~~~~~~~~~~~~~~~~l~~~~~a~~~--  195 (328)
                      ++.+.. |... -+. ...++-.++++-...+.+.  .  ...+++-+.+ +.+..+....+++-++.++.++..++.  
T Consensus       228 L~~l~~ki~G~~RIR~~~~hP~~~~d~li~~~~~~~~~~v~~~lHlPvQSGSd~iLK~M~R~Y~~e~~~~~~~k~r~~~P  307 (455)
T TIGR00089       228 LRELSKKIDGIERIRFTSSHPDDVTDDLIELIAENKDPKVCKHLHLPVQSGSDRILKRMNRKYTREEYLEIVEKLRAKVP  307 (455)
T ss_pred             HHHHHHHCCCCEEEEEECCCCCCCCHHHHHHHHHCCCCCCCCEECCCEECCCHHHHHCCCCCCCHHHHHHHHHHHHHHCC
T ss_conf             99984005970268860467032687899999850788535202212661886999703789888999999999998478


Q ss_pred             CCCCCCEEEECC-CCCHHHHHHHHHHHHHCCCCCCEEECCCEEECCCCCCCCCCC
Q ss_conf             985577078668-989999999999997408888602054112048741244568
Q gi|254780485|r  196 GIKVCCGGILGL-GEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKK  249 (328)
Q Consensus       196 G~~~~sg~l~G~-gEt~eeri~~l~~lr~l~~~~~~v~~~~~~p~~gt~l~~~~~  249 (328)
                      .+-.+|.+|+|+ |||.||--+.+..+++++.  +.+.++.+-|-||||=.....
T Consensus       308 ~~~i~TDiIVGFPGETeEdF~~Tl~l~~ev~F--~~~~~F~YSpR~gTpAa~~~d  360 (455)
T TIGR00089       308 DAAITTDIIVGFPGETEEDFEETLDLVEEVKF--DKLHSFIYSPRPGTPAADMKD  360 (455)
T ss_pred             CCEEECCEEECCCCCCHHHHHHHHHHHHHCCC--CEEEEECCCCCCCCCCCCCCC
T ss_conf             81775026882899988999999999852384--434312057888874635678


No 59 
>PRK08898 coproporphyrinogen III oxidase; Provisional
Probab=99.48  E-value=5.7e-12  Score=99.91  Aligned_cols=196  Identities=14%  Similarity=0.168  Sum_probs=132.2

Q ss_pred             EEECCCCCCCCCCCCCCCCCC-CCCC---CCCCCCCHHHHHHHHHHHH----HCCCEEEEEECCCCCCCCCCHHHHHHHH
Q ss_conf             453078683423212433547-7756---4100068579999999999----6498389973036888744289999988
Q gi|254780485|r   58 LNIKTGGCPENCGYCNQSVHN-KSKL---KASKLINVDQVLKEAKNAK----ENGATRYCMGAAWREPKERDLSIIVDMI  129 (328)
Q Consensus        58 in~~TN~C~~~C~fCaf~~~~-~~~~---~~~~~~~~Eei~~~a~~~~----~~G~~~~~l~~~~~~~~~~~~~~~~e~i  129 (328)
                      ++|+  .|...|.||.|.... +...   ..|.    +.+.++.+...    ..-+..+.++  |++|.....+.+.+++
T Consensus        24 iHIP--FC~~~C~YC~f~s~~~~~~~~~~~~Y~----~aL~~Ei~~~~~~~~~~~~~tiy~G--GGTPs~L~~~~l~~l~   95 (393)
T PRK08898         24 VHFP--WCVRKCPYCDFNSHEWKGGGIPEAAYL----DALRADLEQALPLVWGRQVHTVFIG--GGTPSLLSAAGLDRLL   95 (393)
T ss_pred             EECC--CCCCCCCCCCCCCCCCCCCCCCHHHHH----HHHHHHHHHHHHHHCCCEEEEEEEC--CCHHHHCCHHHHHHHH
T ss_conf             8717--871609999881422787886799999----9999999975777069867799976--8424638999999999


Q ss_pred             HHHCC---C--CCCE--EEECCCCCHHHHHHHHCCCCCEEEEECCC-CHHHHHCCCCCCCHHHHHHHHHHHHHCCCCCCC
Q ss_conf             76213---6--8832--41025699999998741576069751343-777732058888989999999999987985577
Q gi|254780485|r  130 KGVKS---L--GLET--CMTLGMLSFEQAQILSKAGLDYYNHNIDT-SERFYPHVTTTHTFEDRLQTLENVRKSGIKVCC  201 (328)
Q Consensus       130 ~~i~~---~--~~~i--~~~~g~~~~~~~~~Lk~aG~~~~~~~let-~~~~~~~~~~~~~~~~~l~~~~~a~~~G~~~~s  201 (328)
                      ..++.   .  ..++  -++++.++.+.++.++++|++++.+++++ .+...+.+...|+.++-.++++.+++..-.++.
T Consensus        96 ~~l~~~f~~~~~~E~tiE~nP~~~~~~~l~~l~~~GvnRiSlGVQsf~~~~l~~lgR~h~~~~~~~~i~~~~~~f~~ini  175 (393)
T PRK08898         96 SDVRALLPLDPDAEITLEANPGTFEAEKFAQFRASGVNRLSIGIQSFNDAHLKALGRIHDGAEARAAIEIAAKHFDNFNL  175 (393)
T ss_pred             HHHHHHCCCCCCCEEEEEECCCCCCHHHHHHHHHCCCCEEEEEEECCCHHHHHHHCCCCCHHHHHHHHHHHHHHCCCCCC
T ss_conf             99998589765731688736250609999999854986489952028999999818999999999999999973746672


Q ss_pred             EEEECC-CCCHHHHHHHHHHHHHCCCCCCEEECCCEEECCCCCCCCCCC--CCHHHHHHHHHHHH
Q ss_conf             078668-989999999999997408888602054112048741244568--79899999999999
Q gi|254780485|r  202 GGILGL-GEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKK--VDPIEHVRIISVAR  263 (328)
Q Consensus       202 g~l~G~-gEt~eeri~~l~~lr~l~~~~~~v~~~~~~p~~gt~l~~~~~--~~~~e~lr~iAi~R  263 (328)
                      -+|||+ |+|.++..+.|..+-+++.  +.|++..+...|+|++...+.  ++.++.+.+...+.
T Consensus       176 DLiyGlP~Qt~~~~~~~l~~~~~l~p--~hiS~Y~L~iep~T~~~~~~~~lP~~d~~~~m~~~~~  238 (393)
T PRK08898        176 DLMYALPNQTLDECRADVETALAFGP--PHLSLYHLTLEPNTLFAKFPPALPDDDASADMQDWIH  238 (393)
T ss_pred             HHHHCCCCCCHHHHHHHHHHHHCCCC--CEEEEEEEEECCCCHHHHCCCCCCCHHHHHHHHHHHH
T ss_conf             89835988989999999999862499--9589877776489733215767959899999999999


No 60 
>COG0621 MiaB 2-methylthioadenine synthetase [Translation, ribosomal structure and biogenesis]
Probab=99.47  E-value=9.8e-12  Score=98.32  Aligned_cols=188  Identities=15%  Similarity=0.265  Sum_probs=131.3

Q ss_pred             EEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCEEEEEECCC----CCCC---CCCHHHHH
Q ss_conf             9986453078683423212433547775641000685799999999996498389973036----8887---44289999
Q gi|254780485|r   54 LSKLLNIKTGGCPENCGYCNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAW----REPK---ERDLSIIV  126 (328)
Q Consensus        54 ~~~~in~~TN~C~~~C~fCaf~~~~~~~~~~~~~~~~Eei~~~a~~~~~~G~~~~~l~~~~----~~~~---~~~~~~~~  126 (328)
                      ....+.| ++.|...|+||.---. +   .+..-.+.|+|+.+++.+.++|.+++.+.+..    +.+.   ...+..++
T Consensus       144 ~~A~v~I-~eGCn~~CtfCiiP~~-R---G~~rSr~~e~Il~ev~~Lv~~G~kEI~L~gqdv~aYG~D~~~~~~~l~~Ll  218 (437)
T COG0621         144 VRAFVKI-QEGCNKFCTFCIIPYA-R---GKERSRPPEDILKEVKRLVAQGVKEIVLTGQDVNAYGKDLGGGKPNLADLL  218 (437)
T ss_pred             EEEEEEH-HCCCCCCCCEEEEECC-C---CCCCCCCHHHHHHHHHHHHHCCCEEEEEEEEEHHHCCCCCCCCCCCHHHHH
T ss_conf             4799881-2086788880640536-7---875577989999999999988974999998811010446777766899999


Q ss_pred             HHHHHHCCC-CCCE-EEECCCCCHHHHHHHHCC-CC-CEEEEECCC-CHHHHHCCCCCCCHHHHHHHHHHHHHC--CCCC
Q ss_conf             988762136-8832-410256999999987415-76-069751343-777732058888989999999999987--9855
Q gi|254780485|r  127 DMIKGVKSL-GLET-CMTLGMLSFEQAQILSKA-GL-DYYNHNIDT-SERFYPHVTTTHTFEDRLQTLENVRKS--GIKV  199 (328)
Q Consensus       127 e~i~~i~~~-~~~i-~~~~g~~~~~~~~~Lk~a-G~-~~~~~~let-~~~~~~~~~~~~~~~~~l~~~~~a~~~--G~~~  199 (328)
                      +.+..|... -+.+ .+++-..+++-+..+.+. -+ ..+++-+.+ ++...+....+++.++.++.++..++.  .+..
T Consensus       219 ~~l~~I~G~~riR~~~~~P~~~~d~lIe~~~~~~kv~~~lHlPvQsGsd~ILk~M~R~yt~e~~~~~i~k~R~~~Pd~~i  298 (437)
T COG0621         219 RELSKIPGIERIRFGSSHPLEFTDDLIEAIAETPKVCPHLHLPVQSGSDRILKRMKRGYTVEEYLEIIEKLRAARPDIAI  298 (437)
T ss_pred             HHHHCCCCCEEEEEECCCCHHCCHHHHHHHHCCCCCCCCCCCCCCCCCHHHHHHHCCCCCHHHHHHHHHHHHHHCCCCEE
T ss_conf             99960799108999358800118899999865784143446755569879999737876799999999999986898567


Q ss_pred             CCEEEECC-CCCHHHHHHHHHHHHHCCCCCCEEECCCEEECCCCCCCCCC
Q ss_conf             77078668-98999999999999740888860205411204874124456
Q gi|254780485|r  200 CCGGILGL-GEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENK  248 (328)
Q Consensus       200 ~sg~l~G~-gEt~eeri~~l~~lr~l~~~~~~v~~~~~~p~~gt~l~~~~  248 (328)
                      ++.+|+|+ |||.||--+.+..+++.+.  +.+.++.|-|.||||-...+
T Consensus       299 ~tDiIVGFPgETEedFe~tl~lv~e~~f--d~~~~F~YSpRpGTpAa~~~  346 (437)
T COG0621         299 STDIIVGFPGETEEDFEETLDLVEEVRF--DRLHVFKYSPRPGTPAALMP  346 (437)
T ss_pred             ECCEEEECCCCCHHHHHHHHHHHHHHCC--CEEEEEECCCCCCCCCCCCC
T ss_conf             5267997999999999999999997488--87853304899998211377


No 61 
>PRK09249 coproporphyrinogen III oxidase; Provisional
Probab=99.47  E-value=1.4e-11  Score=97.22  Aligned_cols=204  Identities=16%  Similarity=0.212  Sum_probs=131.7

Q ss_pred             CCEEEEEEEEEECCCCCCCCCCCCCCCCCCC---CCCCCCCCCCHHHHHHHHHHHHH-----CCCEEEEEECCCCCCCCC
Q ss_conf             9856999864530786834232124335477---75641000685799999999996-----498389973036888744
Q gi|254780485|r   49 PNHIQLSKLLNIKTGGCPENCGYCNQSVHNK---SKLKASKLINVDQVLKEAKNAKE-----NGATRYCMGAAWREPKER  120 (328)
Q Consensus        49 g~~V~~~~~in~~TN~C~~~C~fCaf~~~~~---~~~~~~~~~~~Eei~~~a~~~~~-----~G~~~~~l~~~~~~~~~~  120 (328)
                      +..+.+..+|-    .|...|.||+|.....   .....|    .+.+.++.+....     ..+..+.++  |++|...
T Consensus        49 ~~plSLYiHiP----FC~~~C~YC~~~~~~~~~~~~~~~Y----l~~L~~Ei~~~~~~l~~~~~v~~i~~G--GGTPs~L  118 (456)
T PRK09249         49 GSPLSLYVHIP----FCRSLCYYCGCNKIITRDHEKADPY----LDALEKEIALVAPLLPGGRKVSQLHWG--GGTPTFL  118 (456)
T ss_pred             CCCEEEEEECC----CCCCCCCCCCCCCCCCCCCCHHHHH----HHHHHHHHHHHHHHHCCCCCEEEEEEC--CCCHHHC
T ss_conf             99559998517----8168289999801357885579999----999999999988761789836799978--9670649


Q ss_pred             CHHHHHHHHHHHCCC-----CCCEE--EECCCCCHHHHHHHHCCCCCEEEEECCC-CHHHHHCCCCCCCHHHHHHHHHHH
Q ss_conf             289999988762136-----88324--1025699999998741576069751343-777732058888989999999999
Q gi|254780485|r  121 DLSIIVDMIKGVKSL-----GLETC--MTLGMLSFEQAQILSKAGLDYYNHNIDT-SERFYPHVTTTHTFEDRLQTLENV  192 (328)
Q Consensus       121 ~~~~~~e~i~~i~~~-----~~~i~--~~~g~~~~~~~~~Lk~aG~~~~~~~let-~~~~~~~~~~~~~~~~~l~~~~~a  192 (328)
                      ..+.+.+++..++..     +.++.  ++++.++.+.++.|+++|++++.+++.+ .+...+.+...|+.++-.++++.|
T Consensus       119 ~~~~l~~l~~~l~~~f~~~~~~EitiE~nP~~~~~~~l~~l~~~GvnRiSlGVQsfd~~vl~~igR~h~~~~~~~~i~~a  198 (456)
T PRK09249        119 SPEQLTRLMALLREHFNFAPDAEISIEIDPRELDLEMLDALRELGFNRLSLGVQDFDPEVQKAINRIQPFELTFALVEAA  198 (456)
T ss_pred             CHHHHHHHHHHHHHHCCCCCCCEEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCCHHHHHHHCCCCCHHHHHHHHHHH
T ss_conf             99999999999998668898835999843475879999999845975688605357879999852889999999999999


Q ss_pred             HHCCCC-CCCEEEECC-CCCHHHHHHHHHHHHHCCCCCCEEECCCEEECCC-----CCCCCCCCCCHHHHHHHHHHHHH
Q ss_conf             987985-577078668-9899999999999974088886020541120487-----41244568798999999999999
Q gi|254780485|r  193 RKSGIK-VCCGGILGL-GEMIDDRIDMLLTLANLSTPPESIPINLLIPIPG-----SKFEENKKVDPIEHVRIISVARI  264 (328)
Q Consensus       193 ~~~G~~-~~sg~l~G~-gEt~eeri~~l~~lr~l~~~~~~v~~~~~~p~~g-----t~l~~~~~~~~~e~lr~iAi~RL  264 (328)
                      +++|+. ++.-.|||+ ++|.++..+.|..+-+|+.  +.+++..+.-.|.     ..+....-|++++-+.+...+.=
T Consensus       199 r~~Gf~~in~DLIyGLP~QT~~~~~~tl~~~~~l~P--dhis~y~yah~P~~~~~qr~i~~~~LP~~~~~~~m~~~a~~  275 (456)
T PRK09249        199 RELGFTSINFDLIYGLPKQTPESFARTLEKVLELRP--DRLAVFNYAHVPWLFKAQRKIDEADLPSPEEKLEILQAAIE  275 (456)
T ss_pred             HHCCCCCCCHHHHHCCCCCCHHHHHHHHHHHHCCCC--CEEEECCCCCCCHHHHHHHHCCCCCCCCHHHHHHHHHHHHH
T ss_conf             981997210488606998769999999999965599--88995022347204556530365679799999999999999


No 62 
>PRK05301 pyrroloquinoline quinone biosynthesis protein PqqE; Provisional
Probab=99.46  E-value=4e-11  Score=94.19  Aligned_cols=174  Identities=17%  Similarity=0.266  Sum_probs=123.8

Q ss_pred             EEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCCCCHHHHHHHHHHHC
Q ss_conf             99864530786834232124335477756410006857999999999964983899730368887442899999887621
Q gi|254780485|r   54 LSKLLNIKTGGCPENCGYCNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVK  133 (328)
Q Consensus        54 ~~~~in~~TN~C~~~C~fCaf~~~~~~~~~~~~~~~~Eei~~~a~~~~~~G~~~~~l~~~~~~~~~~~~~~~~e~i~~i~  133 (328)
                      +....++ |+-|..+|.||.-.....   +...-++.||+++.++++.+.|...+.+ +||++....++   .++++.++
T Consensus        17 ~~v~~el-T~~CNL~C~hCy~~~~~~---~~~~ELs~~e~~~~id~l~~~Gv~~v~~-tGGEPllr~D~---~ei~~~a~   88 (375)
T PRK05301         17 LWLLAEL-TYRCPLQCPYCSNPLDLA---RHGAELSTAEWIRVLREARALGVLQLHF-SGGEPLLRKDL---EELVAHAR   88 (375)
T ss_pred             EEEEEHH-HCHHCCCCCCCCCCCCCC---CCCCCCCHHHHHHHHHHHHHCCCCEEEE-CCCCCCCCCCH---HHHHHHHH
T ss_conf             2843573-140078784669850048---7657899999999999999869988996-18652456689---99999999


Q ss_pred             CCCCCEEE--ECCCCCHHHHHHHHCCCCCEEEEECCC-CHHHHHCCCC-CCCHHHHHHHHHHHHHCCCCCCCEEEECCCC
Q ss_conf             36883241--025699999998741576069751343-7777320588-8898999999999998798557707866898
Q gi|254780485|r  134 SLGLETCM--TLGMLSFEQAQILSKAGLDYYNHNIDT-SERFYPHVTT-THTFEDRLQTLENVRKSGIKVCCGGILGLGE  209 (328)
Q Consensus       134 ~~~~~i~~--~~g~~~~~~~~~Lk~aG~~~~~~~let-~~~~~~~~~~-~~~~~~~l~~~~~a~~~G~~~~sg~l~G~gE  209 (328)
                      +.++.+.+  |-..++++.+++|+++|++.+.+.+|. .++.+..++. +.+|+.-++.++.+++.|+++...+.+- -+
T Consensus        89 ~~G~~~~l~TNG~lit~~~a~~L~~~gl~~v~vSlDg~~~e~hD~~rG~~G~f~~~~~~i~~l~~~Gi~v~i~~ti~-r~  167 (375)
T PRK05301         89 RLGLYTNLITSGVGLTEARLAALKAAGLDHIQLSFQDSDPELADRIAGTRGAFAQKLEVARLVKAHGYPLTLNAVIH-RH  167 (375)
T ss_pred             HCCCEEEEEECCCCCCHHHHHHHHHHCCCEEEEECCCCCHHHHHHHCCCCCHHHHHHHHHHHHHHCCCCEEEEEEEC-CC
T ss_conf             76975899606745579999999850998899956779877877763788629999999999997498169998723-05


Q ss_pred             CHHHHHHHHHHHHHCCCCCCEEECCCEEE
Q ss_conf             99999999999974088886020541120
Q gi|254780485|r  210 MIDDRIDMLLTLANLSTPPESIPINLLIP  238 (328)
Q Consensus       210 t~eeri~~l~~lr~l~~~~~~v~~~~~~p  238 (328)
                      +..|.-+.+....+++..  .+.+..+.+
T Consensus       168 N~~~l~~i~~la~~lGv~--~~~l~~~~~  194 (375)
T PRK05301        168 NIDQIPRIIELAVELGAD--RLELANTQY  194 (375)
T ss_pred             CHHHHHHHHHHHHHCCCC--EEEEEEEEE
T ss_conf             688899999999972998--289876567


No 63 
>KOG2672 consensus
Probab=99.45  E-value=5.3e-12  Score=100.09  Aligned_cols=177  Identities=17%  Similarity=0.311  Sum_probs=135.2

Q ss_pred             EEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCEEEEEECCCCCC-CCCCHHHHHHHHHHH
Q ss_conf             9986453078683423212433547775641000685799999999996498389973036888-744289999988762
Q gi|254780485|r   54 LSKLLNIKTGGCPENCGYCNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREP-KERDLSIIVDMIKGV  132 (328)
Q Consensus        54 ~~~~in~~TN~C~~~C~fCaf~~~~~~~~~~~~~~~~Eei~~~a~~~~~~G~~~~~l~~~~~~~-~~~~~~~~~e~i~~i  132 (328)
                      .-..|-+--.-|+.+|+||+.-. ++++.    .+++-|-...|+++.+.|..-+++.+..+++ ++.--+.+.+.++.|
T Consensus       110 ATATIMlmGDTCTRGCRFCsVKT-sR~Pp----PlDp~EPeNTAeAIasWgl~YiVlTSVDRDDlpDgGa~HiAkTVq~i  184 (360)
T KOG2672         110 ATATIMLMGDTCTRGCRFCSVKT-SRNPP----PLDPNEPENTAEAIASWGLDYIVLTSVDRDDLPDGGANHIAKTVQKI  184 (360)
T ss_pred             EEEEEEEECCCCCCCCCEEEEEC-CCCCC----CCCCCCCCCHHHHHHHCCCCEEEEEECCCCCCCCCCHHHHHHHHHHH
T ss_conf             36898863474346752012103-78896----77999864489999971888699971145647675227899999999


Q ss_pred             CCCCCCEEEECCCC----CHHHHHHHHCCCCCEEEEECCCCHHHHHCCCC-CCCHHHHHHHHHHHHHC--CCCCCCEEEE
Q ss_conf             13688324102569----99999987415760697513437777320588-88989999999999987--9855770786
Q gi|254780485|r  133 KSLGLETCMTLGML----SFEQAQILSKAGLDYYNHNIDTSERFYPHVTT-THTFEDRLQTLENVRKS--GIKVCCGGIL  205 (328)
Q Consensus       133 ~~~~~~i~~~~g~~----~~~~~~~Lk~aG~~~~~~~let~~~~~~~~~~-~~~~~~~l~~~~~a~~~--G~~~~sg~l~  205 (328)
                      |+..+++.+.+-..    .-+....+...|+|-|.||+||.+++-+.++. ...|.+-|.+++.|++.  ++-+.+-||.
T Consensus       185 K~k~p~ilvE~L~pDF~Gd~~~Ve~va~SGLDV~AHNvETVe~Ltp~VRD~RA~yrQSL~VLk~aK~~~P~litktsiMl  264 (360)
T KOG2672         185 KEKAPEILVECLTPDFRGDLKAVEKVAKSGLDVYAHNVETVEELTPFVRDPRANYRQSLSVLKHAKEVKPGLITKTSIML  264 (360)
T ss_pred             HHHCCCCCHHHCCCCCCCCHHHHHHHHHCCCCCEECCHHHHHHCCHHHCCCCCCHHHHHHHHHHHHHHCCCCEEHHHHHH
T ss_conf             85284232132475545734799999853740000111408760233318540167769999987751887012021000


Q ss_pred             CCCCCHHHHHHHHHHHHHCCCCCCEEECCCEE
Q ss_conf             68989999999999997408888602054112
Q gi|254780485|r  206 GLGEMIDDRIDMLLTLANLSTPPESIPINLLI  237 (328)
Q Consensus       206 G~gEt~eeri~~l~~lr~l~~~~~~v~~~~~~  237 (328)
                      |+|||.|++...+..||..++.  .+.+.-+.
T Consensus       265 glgetdeei~~tl~dLr~~~vd--v~t~gqym  294 (360)
T KOG2672         265 GLGETDEEIKQTLKDLRAADVD--VVTFGQYM  294 (360)
T ss_pred             CCCCCHHHHHHHHHHHHHCCCC--EEECCCCC
T ss_conf             2678889999999999971970--88400005


No 64 
>COG0635 HemN Coproporphyrinogen III oxidase and related Fe-S oxidoreductases [Coenzyme metabolism]
Probab=99.43  E-value=3.3e-11  Score=94.76  Aligned_cols=201  Identities=20%  Similarity=0.345  Sum_probs=139.5

Q ss_pred             EEEEEEEEEECCCCCCCCCCCCCCCCCCCCC---CCCCCCCCHHHHHHHHHHHHHC-----CCEEEEEECCCCCCCCC--
Q ss_conf             5699986453078683423212433547775---6410006857999999999964-----98389973036888744--
Q gi|254780485|r   51 HIQLSKLLNIKTGGCPENCGYCNQSVHNKSK---LKASKLINVDQVLKEAKNAKEN-----GATRYCMGAAWREPKER--  120 (328)
Q Consensus        51 ~V~~~~~in~~TN~C~~~C~fCaf~~~~~~~---~~~~~~~~~Eei~~~a~~~~~~-----G~~~~~l~~~~~~~~~~--  120 (328)
                      ...+..+|-    .|..-|.||+|.......   ...|.    +-++++.+.....     -++.+.+++|  +|...  
T Consensus        34 ~~slYiHiP----FC~~~C~YC~fn~~~~~~~~~~~~Y~----~aL~~Ei~~~~~~~~~~~~v~ti~~GGG--TPslL~~  103 (416)
T COG0635          34 PLSLYIHIP----FCVSKCPYCDFNSHVTKRGQPVDEYL----DALLEEIELVAALLGGQREVKTIYFGGG--TPSLLSP  103 (416)
T ss_pred             CCEEEEECC----CHHCCCCCCCCEEEECCCCCHHHHHH----HHHHHHHHHHHHHCCCCCEEEEEEECCC--CCCCCCH
T ss_conf             736888723----21250887888545347777399999----9999999998862278872789997698--3267799


Q ss_pred             -CHHHHHHHHHHHCC-C--CCCEEE--ECCCCCHHHHHHHHCCCCCEEEEECCC-CHHHHHCCCCCCCHHHHHHHHHHHH
Q ss_conf             -28999998876213-6--883241--025699999998741576069751343-7777320588889899999999999
Q gi|254780485|r  121 -DLSIIVDMIKGVKS-L--GLETCM--TLGMLSFEQAQILSKAGLDYYNHNIDT-SERFYPHVTTTHTFEDRLQTLENVR  193 (328)
Q Consensus       121 -~~~~~~e~i~~i~~-~--~~~i~~--~~g~~~~~~~~~Lk~aG~~~~~~~let-~~~~~~~~~~~~~~~~~l~~~~~a~  193 (328)
                       .++.+++.++..-. .  ..++.+  +++..+.+.++.++++|++++.+++.+ .++..+.+...|+.++-.++++.++
T Consensus       104 ~~l~~ll~~l~~~~~~~~~~~EitiE~nP~~~~~e~~~~l~~~GvNRiSlGVQsf~~~~lk~lgR~h~~~~~~~a~~~~~  183 (416)
T COG0635         104 EQLERLLKALRELFNDLDPDAEITIEANPGTVEAEKFKALKEAGVNRISLGVQSFNDEVLKALGRIHDEEEAKEAVELAR  183 (416)
T ss_pred             HHHHHHHHHHHHHHCCCCCCCEEEEEECCCCCCHHHHHHHHHHCCCEEEEECCCCCHHHHHHHCCCCCHHHHHHHHHHHH
T ss_conf             99999999999972357888279995088866899999999829877986014599899997478887899999999998


Q ss_pred             HCCC-CCCCEEEECC-CCCHHHHHHHHHHHHHCCCCCCEEECCCEEECCCCCCCCCCC-----CCHHHHHHHHHHHH
Q ss_conf             8798-5577078668-989999999999997408888602054112048741244568-----79899999999999
Q gi|254780485|r  194 KSGI-KVCCGGILGL-GEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKK-----VDPIEHVRIISVAR  263 (328)
Q Consensus       194 ~~G~-~~~sg~l~G~-gEt~eeri~~l~~lr~l~~~~~~v~~~~~~p~~gt~l~~~~~-----~~~~e~lr~iAi~R  263 (328)
                      +.|+ .++.-.|||+ ++|.++..+.+..+.+++  |+.+++.-+.-.|+|++.....     |++++.+.+....+
T Consensus       184 ~~g~~~in~DLIyglP~QT~~~~~~~l~~a~~l~--pdhis~y~L~~~p~t~~~~~~~~~~~lP~~d~~~~~~~~~~  258 (416)
T COG0635         184 KAGFTSINIDLIYGLPGQTLESLKEDLEQALELG--PDHLSLYSLAIEPGTKFAQRKIKGKALPDEDEKADMYELVE  258 (416)
T ss_pred             HCCCCCEEEEEECCCCCCCHHHHHHHHHHHHHCC--CCEEEEEEEEECCCCHHHHHCCCCCCCCCHHHHHHHHHHHH
T ss_conf             6389747887243899999999999999998349--98786462686588567662335778998689999999999


No 65 
>TIGR03470 HpnH hopanoid biosynthesis associated radical SAM protein HpnH. The sequences represented by this model are members of the radical SAM superfamily of enzymes (pfam04055). These enzymes utilize an iron-sulfur redox cluster and S-adenosylmethionine to carry out diverse radical mediated reactions. The members of this clade are frequently found in the same locus as squalene-hopene cyclase (SHC, TIGR01507) and other genes associated with the biosynthesis of hopanoid natural products. The linkage between SHC and this radical SAM enzyme is strong; one is nearly always observed in the same genome where the other is found. A hopanoid biosynthesis locus was described in Zymomonas mobilis consisting of the genes HpnA-E and SHC (HpnF). Continuing past SHC are found a phosphorylase enzyme (ZMO0873, i.e. HpnG, TIGR03468) and this radical SAM enzyme (ZMO0874) which we name here HpnH. Granted, in Z. mobilis, HpnH is in a convergent orientation with respect to HpnA-G, but one gene beyond HpnH
Probab=99.40  E-value=1.2e-10  Score=91.03  Aligned_cols=194  Identities=12%  Similarity=0.175  Sum_probs=135.0

Q ss_pred             CHHHHHHHHHHHHHHHCCCCEEE-EEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCEEEE
Q ss_conf             91899999999988862898569-99864530786834232124335477756410006857999999999964983899
Q gi|254780485|r   31 PFNDLLFWSHTVHRKNFEPNHIQ-LSKLLNIKTGGCPENCGYCNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYC  109 (328)
Q Consensus        31 ~~~el~~~Aa~~~r~~~~g~~V~-~~~~in~~TN~C~~~C~fCaf~~~~~~~~~~~~~~~~Eei~~~a~~~~~~G~~~~~  109 (328)
                      |+.--+..+..+.+++..|++-+ +...+.. |..|...|.+|+.-..+.. ... ..++.||.++.++   +.|+.-+.
T Consensus         4 ~~~~~~~~~~y~~~~~~~g~kr~Plvl~le~-t~rCNL~C~~C~~i~~~~~-~l~-~~Ls~ee~~~~~~---e~Gap~V~   77 (318)
T TIGR03470         4 PLRQNLRVGAYIIKQKLNGRKRFPLVLMLEP-LFRCNLACAGCGKIQYPAE-ILK-QRLSVEECLRAVD---ECGAPVVS   77 (318)
T ss_pred             CHHHHHHHHHHHHHHHHCCCCCCCEEEEEEE-CCCCCCCCCCCCCCCCCCH-HHH-CCCCHHHHHHHHH---HCCCCEEE
T ss_conf             4899999999999877337646675887312-1322677889974136764-654-4389999999999---84997899


Q ss_pred             EECCCCCCCCCCHHHHHHHHHHHCCCCCCEEE-ECCCCCHHHHHHHHCCCCCEEEEECCCCHHHHHCC-CCCCCHHHHHH
Q ss_conf             73036888744289999988762136883241-02569999999874157606975134377773205-88889899999
Q gi|254780485|r  110 MGAAWREPKERDLSIIVDMIKGVKSLGLETCM-TLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHV-TTTHTFEDRLQ  187 (328)
Q Consensus       110 l~~~~~~~~~~~~~~~~e~i~~i~~~~~~i~~-~~g~~~~~~~~~Lk~aG~~~~~~~let~~~~~~~~-~~~~~~~~~l~  187 (328)
                      + +||++....++..+   ++.+++.+..+.+ +.|.+.++.+.+++++|...+.+.+|..++.+... +....++.-++
T Consensus        78 i-tGGEPLLr~dl~eI---v~~a~~~g~~v~l~TNG~Ll~k~i~~~~~~~~~~~~VsLDG~~e~HD~~r~~~G~Fd~av~  153 (318)
T TIGR03470        78 I-PGGEPLLHPEIDEI---VRGLVARKKFVYLCTNALLLEKKLDKFEPSPYLTFSVHLDGLREHHDASVCREGVFDRAVE  153 (318)
T ss_pred             E-CCCCCCCCCCHHHH---HHHHHHCCCEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHCCCCHHHHHHH
T ss_conf             5-18874556479999---9999975997999775520099999985188836999801787886688717977999999


Q ss_pred             HHHHHHHCCCCCCCEEEECCCCCHHHHHHHHHHHHHCCCCCCEEECCCE
Q ss_conf             9999998798557707866898999999999999740888860205411
Q gi|254780485|r  188 TLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLL  236 (328)
Q Consensus       188 ~~~~a~~~G~~~~sg~l~G~gEt~eeri~~l~~lr~l~~~~~~v~~~~~  236 (328)
                      .++.|++.|++++...-+=-+++.+++.+.+..+.+|++  +++.+++-
T Consensus       154 aIr~ak~~G~~V~iN~Tvf~~~n~~~i~~~~d~~~~lgV--dgi~isp~  200 (318)
T TIGR03470       154 AIREAKARGFRVTTNTTLFNDTDPEEVAEFFDYLTDLGV--DGMTISPG  200 (318)
T ss_pred             HHHHHHHCCCCEEEEEEEECCCCHHHHHHHHHHHHHCCC--CEEEECCC
T ss_conf             999999869946799897068999999999999987699--73897665


No 66 
>PRK08629 coproporphyrinogen III oxidase; Provisional
Probab=99.37  E-value=1.2e-10  Score=90.95  Aligned_cols=207  Identities=14%  Similarity=0.094  Sum_probs=129.4

Q ss_pred             CCEEEEEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCC--CEEEEEECCCCCCCCCCHHHHH
Q ss_conf             98569998645307868342321243354777564100068579999999999649--8389973036888744289999
Q gi|254780485|r   49 PNHIQLSKLLNIKTGGCPENCGYCNQSVHNKSKLKASKLINVDQVLKEAKNAKENG--ATRYCMGAAWREPKERDLSIIV  126 (328)
Q Consensus        49 g~~V~~~~~in~~TN~C~~~C~fCaf~~~~~~~~~~~~~~~~Eei~~~a~~~~~~G--~~~~~l~~~~~~~~~~~~~~~~  126 (328)
                      |+...+..+|-    .|...|.||.|..........  ..-.+.+.++.+...+.|  +..+.+++|  +|... .+.+.
T Consensus        41 ~~~~~LYiHIP----FC~~~C~YC~F~~~~~~~~~~--~~Y~~aL~kEi~~~~~~~~~i~tiy~GGG--TPs~L-~~~l~  111 (424)
T PRK08629         41 GKKYMLYAHVP----FCHTLCPYCSFHRFLFKEDKA--RAYFISLRKEMEMVKELGYDFESMYVGGG--TTTIL-EDELA  111 (424)
T ss_pred             CCEEEEEEECC----CCCCCCCCCCCCCCCCCCCHH--HHHHHHHHHHHHHHHHCCCCCCEEEECCC--HHHCC-HHHHH
T ss_conf             98568998905----407988899895826882419--99999999999998853998376997797--12257-99999


Q ss_pred             HHHHHHCCCC--CCEE--EECCCCCHHHHHHHHCCCCCEEEEECCC-CHHHHHCCCCCCCHH---HHHHHHHHHHHCCC-
Q ss_conf             9887621368--8324--1025699999998741576069751343-777732058888989---99999999998798-
Q gi|254780485|r  127 DMIKGVKSLG--LETC--MTLGMLSFEQAQILSKAGLDYYNHNIDT-SERFYPHVTTTHTFE---DRLQTLENVRKSGI-  197 (328)
Q Consensus       127 e~i~~i~~~~--~~i~--~~~g~~~~~~~~~Lk~aG~~~~~~~let-~~~~~~~~~~~~~~~---~~l~~~~~a~~~G~-  197 (328)
                      +.+..+++..  .++.  ++++.++.+.++.|++. ++++.+++.+ .+...+.+...|+++   +-++.++.|++. + 
T Consensus       112 ~~l~~~~~~f~~~EiTiE~nP~~~~~~~l~~l~~~-vNRiSlGVQsf~~~~L~~lgR~h~~~~~~~~~~~~~~a~~~-f~  189 (424)
T PRK08629        112 KTLELAKKLFSIKEVSCESDPNHLDPPGLKQLKGL-IDRLSIGVQSFNDDILKMVDRYEKFGSGQETFEKIMAAKGL-FP  189 (424)
T ss_pred             HHHHHHHHHCCCCEEEEECCCCCCCHHHHHHHHHH-CCEEEEECCCCCHHHHHHHCCCCCCCCHHHHHHHHHHHHHH-CC
T ss_conf             99999986489824999538686899999999864-25166623669988999809999854699999999997634-46


Q ss_pred             CCCCEEEECC-CCCHHHHHHHHHHHHHCCCCCCEEECCCEEECCCCCCCCC---CCCCHHHHHHHHHHHHHHCCC
Q ss_conf             5577078668-9899999999999974088886020541120487412445---687989999999999996868
Q gi|254780485|r  198 KVCCGGILGL-GEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEEN---KKVDPIEHVRIISVARILMPK  268 (328)
Q Consensus       198 ~~~sg~l~G~-gEt~eeri~~l~~lr~l~~~~~~v~~~~~~p~~gt~l~~~---~~~~~~e~lr~iAi~RL~lP~  268 (328)
                      .++.-.|||+ ++|.++..+.+..+-+++.  +.+++.++...|+|.....   +.++.+.......+.+-...+
T Consensus       190 niniDLIyGlP~QT~~~~~~~l~~~~~l~p--~hIS~Y~L~iep~t~~~~~~~l~~p~~d~~~~~~~i~~~~~~~  262 (424)
T PRK08629        190 IINVDLIFNFPGQTDEVLQHDLDIAKRLDP--RQITTYPLMKSHQTRKSVKGSLGASQKDNARQYRQILNSLFGQ  262 (424)
T ss_pred             CEEEEEECCCCCCCHHHHHHHHHHHHCCCC--CEEECCCCEECCCCCHHHCCCCCCCCHHHHHHHHHHHHHHHCC
T ss_conf             253532327999999999999999981798--9898636622647213423789989879999999999997279


No 67 
>TIGR01574 miaB-methiolase tRNA-i(6)A37 thiotransferase enzyme MiaB; InterPro: IPR006463    These sequences are homologs of the MiaB enzyme responsible for the modification of the isopentenylated adenine-37 base of most bacterial and eukaryotic tRNAs that read codons beginning with uracil (all except tRNA(I,V) Ser). Adenine-37 is next to the anticodon on the 3 side in these tRNAs, and lack of modification at this site leads to an increased spontaneous mutation frequency. Isopentenylated A-37 is modified by methylthiolation at position 2, either by MiaB alone or in concert with a separate methylase yet to be discovered (MiaC?) , , ..
Probab=99.28  E-value=8.1e-10  Score=85.45  Aligned_cols=192  Identities=18%  Similarity=0.230  Sum_probs=139.9

Q ss_pred             EEEEEEEECCCCCCCCCCCCC--CCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCEEEEEECCC-C---------CCCCC
Q ss_conf             999864530786834232124--33547775641000685799999999996498389973036-8---------88744
Q gi|254780485|r   53 QLSKLLNIKTGGCPENCGYCN--QSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAW-R---------EPKER  120 (328)
Q Consensus        53 ~~~~~in~~TN~C~~~C~fCa--f~~~~~~~~~~~~~~~~Eei~~~a~~~~~~G~~~~~l~~~~-~---------~~~~~  120 (328)
                      .+-+-||| +++|.+-|+||=  +-|.     .. .-.+.|.|+.++..+.+.|.+++.|.+.- +         +....
T Consensus       154 ~~~sfv~I-m~GCdkfCtYCiVPYtRG-----~E-~Sr~~~~Il~Ev~~l~~~G~kEi~LLGQNVN~YRG~~frne~~~~  226 (456)
T TIGR01574       154 KFKSFVNI-MEGCDKFCTYCIVPYTRG-----EE-ISRPLDDILQEVQKLAEKGVKEITLLGQNVNAYRGKDFRNEGKTV  226 (456)
T ss_pred             CCEEEEEC-CCCCCCCCCEEECCCCCC-----CC-CCCCHHHHHHHHHHHHHCCCEEEEECCCCCCCCCCCCCCCCCCEE
T ss_conf             42252403-147688545466153048-----20-125744699999999865864874036530111587522588673


Q ss_pred             CHHHHHHHHHH---HCCC---CCCEEEECCCCCHHHHHHHHCCC--CCEEEEECCC-CHHHHHCCCCCCCHHHHHHHHHH
Q ss_conf             28999998876---2136---88324102569999999874157--6069751343-77773205888898999999999
Q gi|254780485|r  121 DLSIIVDMIKG---VKSL---GLETCMTLGMLSFEQAQILSKAG--LDYYNHNIDT-SERFYPHVTTTHTFEDRLQTLEN  191 (328)
Q Consensus       121 ~~~~~~e~i~~---i~~~---~~~i~~~~g~~~~~~~~~Lk~aG--~~~~~~~let-~~~~~~~~~~~~~~~~~l~~~~~  191 (328)
                      ++..+++.++.   .++.   --.+.-|+-.++++-+.-+.+.+  ++.+++=+.+ +.+..+....+++-+++++.+.-
T Consensus       227 ~f~dLL~~l~rrCe~~~~i~RIRFtsSHP~~~~D~liev~a~~~~l~~~~HLPvQsGS~~vLk~M~R~Yt~e~Y~~~v~K  306 (456)
T TIGR01574       227 DFADLLRELARRCEVKDGIERIRFTSSHPKDFDDDLIEVLAKEPKLCKLLHLPVQSGSSEVLKLMKRKYTRERYLELVRK  306 (456)
T ss_pred             CHHHHHHHHHHHCCHHHCCCCEEECCCCCCCCCHHHHHHHHCCCCEEEEECCCCEECHHHHHHHCCCCCCHHHHHHHHHH
T ss_conf             66999999987510221585113137878765446878873789466664375200707998510775568999999999


Q ss_pred             HHHC--CCCCCCEEEECC-CCCHHHHHHHHHHHHHCCCCCCEEECCCEEECCCCCCCCCCCCCHH
Q ss_conf             9987--985577078668-9899999999999974088886020541120487412445687989
Q gi|254780485|r  192 VRKS--GIKVCCGGILGL-GEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPI  253 (328)
Q Consensus       192 a~~~--G~~~~sg~l~G~-gEt~eeri~~l~~lr~l~~~~~~v~~~~~~p~~gt~l~~~~~~~~~  253 (328)
                      ++++  .+..++-+|+|. |||.||--+.|..+++.+-  ++...+-|.|.||||-.+.+.-=|+
T Consensus       307 Lk~~~Pnv~lStDiivGFPGEt~edFE~Tl~l~~~V~F--d~~f~F~Ys~ReGTpAa~m~d~vp~  369 (456)
T TIGR01574       307 LKEAVPNVSLSTDIIVGFPGETEEDFEETLDLLREVEF--DSAFSFIYSPREGTPAADMPDDVPE  369 (456)
T ss_pred             HHHHCCCCEECCCEEEECCCCCHHHHHHHHHHHHHCCC--CCEEEEEECCCCCCCCCCCCCCCCH
T ss_conf             98737871212453673687784668999999852262--4123344138676855678788648


No 68 
>TIGR00510 lipA lipoic acid synthetase; InterPro: IPR003698 Lipoic acid is a covalently bound disulphide-containing cofactor required for function of the pyruvate dehydrogenase, alpha-ketoglutarate dehydrogenase, and glycine cleavage enzyme complexes of Escherichia coli. Two genes, lipA and lipB, are involved in lipoic acid biosynthesis or metabolism. LipA is required for the insertion of the first sulphur into the octanoic acid backbone. LipB functions downstream of LipA, but its role in lipoic acid metabolism remains unclear . Lipoate synthase (or lipoic acid synthetase) catalyses the formation of alpha-(+)-lipoic acid, required for lipoate biosynthesis.; GO: 0016992 lipoate synthase activity, 0009107 lipoate biosynthetic process.
Probab=99.25  E-value=2.3e-10  Score=89.08  Aligned_cols=196  Identities=17%  Similarity=0.255  Sum_probs=146.2

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCEEEEEECCCCCC-CCCCHHHHHHHHHHHCCCCCCEE
Q ss_conf             78683423212433547775641000685799999999996498389973036888-74428999998876213688324
Q gi|254780485|r   62 TGGCPENCGYCNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREP-KERDLSIIVDMIKGVKSLGLETC  140 (328)
Q Consensus        62 TN~C~~~C~fCaf~~~~~~~~~~~~~~~~Eei~~~a~~~~~~G~~~~~l~~~~~~~-~~~~~~~~~e~i~~i~~~~~~i~  140 (328)
                      ...|+..|.||..... +...    .-++++-...++.+.+.|...+.+....+++ .+.....+.++++.+++..+.+.
T Consensus        76 g~~c~~~c~fc~~~~~-~~p~----~pdp~ep~~~~~~~~~~~l~~~~~~~~~~ddl~dgg~~~~~~~~~~~~~~~p~~~  150 (310)
T TIGR00510        76 GDICTRRCPFCDVAHG-RNPL----PPDPEEPEKLAETIKDLGLKYVVITSVDRDDLEDGGAGHLAECVEALREKLPNIK  150 (310)
T ss_pred             HHHHHCCCCCCCCCCC-CCCC----CCCCCCHHHHHHHHHHHCCCEEEEEECCCCCCCCCCHHHHHHHHHHHHHHCCCCE
T ss_conf             1365224763102246-7789----8873322568999987305535775122000234534678999999875245413


Q ss_pred             EEC----CCC-CHHHHHHHHCCCCCEEEEECCCCHHHHHCCCC-CCCHHHHHHHHHHHHHC--CCCCCCEEEECCCCCHH
Q ss_conf             102----569-99999987415760697513437777320588-88989999999999987--98557707866898999
Q gi|254780485|r  141 MTL----GML-SFEQAQILSKAGLDYYNHNIDTSERFYPHVTT-THTFEDRLQTLENVRKS--GIKVCCGGILGLGEMID  212 (328)
Q Consensus       141 ~~~----g~~-~~~~~~~Lk~aG~~~~~~~let~~~~~~~~~~-~~~~~~~l~~~~~a~~~--G~~~~sg~l~G~gEt~e  212 (328)
                      +..    +.- ....+..+.+++.+.|++++|+.+++++.+.+ +.+|.+-+..++.+++.  .+.+.+|+|+|+||+.+
T Consensus       151 ~e~l~~df~g~~~~~~~~~~~~~~~~~~hn~e~~~~~~~~~~~~~~~y~~~l~~l~~~~~~~p~~~~k~g~~~glge~~~  230 (310)
T TIGR00510       151 IETLVPDFRGRDLKALDILLDAPPDVYNHNLETVPRLTPFVRPRGATYRWSLKLLERAKETLPNLPTKSGLMVGLGETNE  230 (310)
T ss_pred             EEEECCCCCHHHHHHHHHHHHCCHHHHHCCHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHCCCCCCCCCCEECCCCCHH
T ss_conf             21001320104689999886246134530112334543333013321688999999988750321011220110475247


Q ss_pred             HHHHHHHHHHHCCCCCCEEECC-CEEEC-CCCCCCCCCCCCHHHHHHHHHHHHH
Q ss_conf             9999999997408888602054-11204-8741244568798999999999999
Q gi|254780485|r  213 DRIDMLLTLANLSTPPESIPIN-LLIPI-PGSKFEENKKVDPIEHVRIISVARI  264 (328)
Q Consensus       213 eri~~l~~lr~l~~~~~~v~~~-~~~p~-~gt~l~~~~~~~~~e~lr~iAi~RL  264 (328)
                      +..+.+..|++.+..  .+.+. .+.|. ...|....-.+...++.+-.+..--
T Consensus       231 ~~~~~~~dl~~~g~~--~~~~g~y~~p~~~h~p~~~y~~p~~fd~~~~~~~~~g  282 (310)
T TIGR00510       231 EILQTLKDLRDHGVT--VLTLGQYLRPSRRHLPVKRYVSPEEFDYWKERALELG  282 (310)
T ss_pred             HHHHHHHHHHHCCCC--EEECCCHHCCHHHCCCCHHCCCCCHHHHHHHHHHHHH
T ss_conf             899999989863740--5650101052001253000257402467887776510


No 69 
>TIGR02026 BchE magnesium-protoporphyrin IX monomethyl ester anaerobic oxidative cyclase; InterPro: IPR011772    This entry respresents the cobalamin-dependent oxidative cyclase responsible for forming the distinctive E-ring of the chlorin ring system under anaerobic conditions . This step is essential in the biosynthesis of both bacteriochlorophyll and chlorophyll under anaerobic conditions (a separate enzyme, AcsF, acts under aerobic conditions). This entry identifies two clades of sequences, one from photosynthetic, non-cyanobacterial bacteria and another including Synechocystis and several non-photosynthetic bacteria. The function of the Synechocystis gene is supported by gene clustering with other photosynthetic genes, so the purpose of the gene in the non-photosynthetic bacteria is uncertain. Note that homologues of this gene are not found in plants which rely solely on the aerobic cyclase.; GO: 0016709 oxidoreductase activity acting on paired donors with incorporation or reduction of molecular oxygen NADH or NADPH as one donor and incorporation of one atom of oxygen, 0050661 NADP binding, 0015995 chlorophyll biosynthetic process.
Probab=99.21  E-value=5.4e-10  Score=86.64  Aligned_cols=209  Identities=17%  Similarity=0.230  Sum_probs=141.1

Q ss_pred             EEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHC-CCEEEEEECCCCCCCC---CCHHHHHHHHHH
Q ss_conf             864530786834232124335477756410006857999999999964-9838997303688874---428999998876
Q gi|254780485|r   56 KLLNIKTGGCPENCGYCNQSVHNKSKLKASKLINVDQVLKEAKNAKEN-GATRYCMGAAWREPKE---RDLSIIVDMIKG  131 (328)
Q Consensus        56 ~~in~~TN~C~~~C~fCaf~~~~~~~~~~~~~~~~Eei~~~a~~~~~~-G~~~~~l~~~~~~~~~---~~~~~~~e~i~~  131 (328)
                      ..+|+ +-+|+.-|+||+|.+..    .+|+..++..+.++++.++.. |.. +.+. ..++|..   ...+...++|+.
T Consensus       199 av~~f-aRGCPf~C~fCsQwkFW----rryR~RdPkKfvdEI~~L~r~hgVg-fF~L-ADEePT~Nr~~f~efCEe~Iar  271 (506)
T TIGR02026       199 AVPNF-ARGCPFTCNFCSQWKFW----RRYRARDPKKFVDEIEKLVREHGVG-FFIL-ADEEPTVNRKKFQEFCEELIAR  271 (506)
T ss_pred             EEECC-CCCCCCCCCCCCCCHHH----HHHCCCCCCHHHHHHHHHHHHCCCC-EEEE-CCCCCCCCHHHHHHHHHHHHHC
T ss_conf             87316-78697655745752044----5404788613899999998631853-3663-2788730168999999999857


Q ss_pred             HCCCCCCEEEECC----CCCHHHHHHHHCCCCCEEEEECCCC-HHHHHCCCCCCCHHHHHHHHHHHHHCCCCCCCEEEEC
Q ss_conf             2136883241025----6999999987415760697513437-7773205888898999999999998798557707866
Q gi|254780485|r  132 VKSLGLETCMTLG----MLSFEQAQILSKAGLDYYNHNIDTS-ERFYPHVTTTHTFEDRLQTLENVRKSGIKVCCGGILG  206 (328)
Q Consensus       132 i~~~~~~i~~~~g----~~~~~~~~~Lk~aG~~~~~~~let~-~~~~~~~~~~~~~~~~l~~~~~a~~~G~~~~sg~l~G  206 (328)
                      --...+.+..|.-    ..+++.+.-.+.||+..+.++.|.+ .-..+.+.+..+.++=-++++-.++.+|-+-|+.+.|
T Consensus       272 ~l~~~v~~ginTRv~Di~RD~~~L~lyR~AGl~~i~LG~Eaaa~~~Ld~~rK~t~~~~nkeAIrLlr~h~i~~~A~fi~g  351 (506)
T TIGR02026       272 NLQIKVTWGINTRVTDIVRDADLLKLYRRAGLVHISLGTEAAAQLTLDRFRKETTVSENKEAIRLLRQHNILSEAQFIVG  351 (506)
T ss_pred             CCCEEEEEEEEECCCHHHHHHHHHHHHHHCCEEEEHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHCCCEEEEEEEEC
T ss_conf             89569999651113042402898888886060300121004665323121366752444899999976184021002425


Q ss_pred             C-CCCHHHHHHHHHHHHHCCCCCCEEECCCEEECCCCCCCC-----------------------CCCCCHHHHHHHHH--
Q ss_conf             8-989999999999997408888602054112048741244-----------------------56879899999999--
Q gi|254780485|r  207 L-GEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEE-----------------------NKKVDPIEHVRIIS--  260 (328)
Q Consensus       207 ~-gEt~eeri~~l~~lr~l~~~~~~v~~~~~~p~~gt~l~~-----------------------~~~~~~~e~lr~iA--  260 (328)
                      + .||.++..+.+..+-+-  .|+.+--+..+|+|.|+|-.                       ...+++.+.|+.|-  
T Consensus       352 ~e~~~~~~~~etyr~~ldw--~PD~~~w~~yTPwpft~lf~~l~dr~~v~LDy~Kynf~~pi~~p~~m~r~~~l~gV~~~  429 (506)
T TIGR02026       352 LENETDETLEETYRQLLDW--DPDLANWLMYTPWPFTSLFEELSDRVEVQLDYTKYNFVTPILKPTLMPREEILKGVLLN  429 (506)
T ss_pred             CCCCCHHHHHHHHHHHHCC--CCCHHHHCCCCCCCCHHHHHHHCCCEEEEECCCCCCCCCCCCCCCCCCHHHHHHHHHHH
T ss_conf             4358756899999997337--83324214558987636788630756898414201124532366778768999999999


Q ss_pred             HHHHHC-CCCCCEE
Q ss_conf             999968-6872142
Q gi|254780485|r  261 VARILM-PKSRLRL  273 (328)
Q Consensus       261 i~RL~l-P~~~i~i  273 (328)
                      -.|+++ |++..+.
T Consensus       430 y~rfy~rPKAl~~y  443 (506)
T TIGR02026       430 YIRFYMRPKALLRY  443 (506)
T ss_pred             HHHHHCCCHHHHHC
T ss_conf             99862251488742


No 70 
>TIGR00539 hemN_rel putative oxygen-independent coproporphyrinogen III oxidase; InterPro: IPR004559   Experimentally determined examples of oxygen-independent coproporphyrinogen III oxidase, an enzyme that replaces HemF function under anaerobic conditions, belong to a family of proteins called HemN (IPR004558 from INTERPRO). This family contains a closely related protein, shorter at the amino end and lacking the region containing the motif PYRT[SC]YP found in members of the hemN family. Several species, including Escherichia coli, Helicobacter pylori, Aquifex aeolicus, and Chlamydia trachomatis, have members of both this family and the Escherichia coli hemN family. The member of this family from Bacillus subtilis was shown to complement a hemF/hemN double mutant of Salmonella typhimurium and to prevent accumulation of coproporphyrinogen III under anaerobic conditions, but the exact role of this protein is still uncertain. It is found in a number of species that do not synthesize haem de novo. ; GO: 0004109 coproporphyrinogen oxidase activity, 0006779 porphyrin biosynthetic process, 0005737 cytoplasm.
Probab=99.20  E-value=2.4e-10  Score=88.95  Aligned_cols=236  Identities=19%  Similarity=0.265  Sum_probs=153.0

Q ss_pred             EEECCCCCCCCCCCCCCCCCC-CCCCC--CCC-CCCHHHHHHHHHHH----HHCCCEEEEEECCCCCC-CCCCHHHHHHH
Q ss_conf             453078683423212433547-77564--100-06857999999999----96498389973036888-74428999998
Q gi|254780485|r   58 LNIKTGGCPENCGYCNQSVHN-KSKLK--ASK-LINVDQVLKEAKNA----KENGATRYCMGAAWREP-KERDLSIIVDM  128 (328)
Q Consensus        58 in~~TN~C~~~C~fCaf~~~~-~~~~~--~~~-~~~~Eei~~~a~~~----~~~G~~~~~l~~~~~~~-~~~~~~~~~e~  128 (328)
                      |+|+  .|...|.||+|.... +++.+  .|. -|..| +.......    ....+..+.|++|+... ..+.++++.+.
T Consensus         5 IHIP--fCe~kC~YCdFNsy~~ksd~p~~eY~~aL~~d-l~~~l~~t~dsiqQ~~l~siFIGGGTP~~lS~e~~~~l~~~   81 (371)
T TIGR00539         5 IHIP--FCEQKCGYCDFNSYAQKSDIPKEEYLQALLQD-LKAALAKTDDSIQQEDLKSIFIGGGTPSLLSAEALKKLLEE   81 (371)
T ss_pred             EECC--HHCCCCCCCCCCCHHHHCCCCHHHHHHHHHHH-HHHHHHHCCCCCCCCCCCEEEECCCCCCHHHHHHHHHHHHH
T ss_conf             5560--22375888653324554278567999999999-99999860443236765568856887414689999999999


Q ss_pred             HHHHCC---CCCCE--EEECCCCCHHHHHHHHCCCCCEEEEECCC-CHHHHHCCCCCCCHHHHHHHHHHHHHCCCC-CCC
Q ss_conf             876213---68832--41025699999998741576069751343-777732058888989999999999987985-577
Q gi|254780485|r  129 IKGVKS---LGLET--CMTLGMLSFEQAQILSKAGLDYYNHNIDT-SERFYPHVTTTHTFEDRLQTLENVRKSGIK-VCC  201 (328)
Q Consensus       129 i~~i~~---~~~~i--~~~~g~~~~~~~~~Lk~aG~~~~~~~let-~~~~~~~~~~~~~~~~~l~~~~~a~~~G~~-~~s  201 (328)
                      |...-+   ...++  -+|++.++.+.++.|+++|+.++.+++.| ..+...++-.-|+..+-.-.++.|++.|++ ++-
T Consensus        82 I~~~~~P~sd~~Eit~eANP~~~~ae~~kglk~aGinRlS~GvQsF~dDkL~~lgR~H~~k~~~~a~e~a~~sG~enisl  161 (371)
T TIGR00539        82 IKKQLKPLSDDIEITVEANPDLVEAEKLKGLKEAGINRLSLGVQSFEDDKLEKLGRVHKAKDVASAVELAKKSGLENISL  161 (371)
T ss_pred             HHHHCCCCCCCCCEEECCCCCHHHHHHHHHHHHCCEEEEECCCCCCHHHHHHHHHHHCCHHHHHHHHHHHHHCCCCCCCH
T ss_conf             87521743102111110782125698863676557023321334541557888642113334667999998717520005


Q ss_pred             EEEECC-CCCHHHHHHHHHHHHHCCCCCCEEECCCEEECCCCCCCCCCC------CCHHHHHHHHHHHHHHCCCCCCE--
Q ss_conf             078668-989999999999997408888602054112048741244568------79899999999999968687214--
Q gi|254780485|r  202 GGILGL-GEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKK------VDPIEHVRIISVARILMPKSRLR--  272 (328)
Q Consensus       202 g~l~G~-gEt~eeri~~l~~lr~l~~~~~~v~~~~~~p~~gt~l~~~~~------~~~~e~lr~iAi~RL~lP~~~i~--  272 (328)
                      -.|||+ ++|.++..+.|....+|..  ..++.-.|.-.|+|-|+..++      |+.+...-+.-+-|=.|--..++  
T Consensus       162 DL~~glP~qtl~~l~~~l~~A~eL~~--~H~S~Y~L~vEpnT~f~~~~~KGrlhlP~~~~~a~~~e~v~~~le~~g~~QY  239 (371)
T TIGR00539       162 DLMYGLPLQTLEELKEELKLALELDA--EHLSVYALIVEPNTVFEKRAKKGRLHLPDDDALAEIYEVVRELLEAFGYKQY  239 (371)
T ss_pred             HHHCCCCHHHHHHHHHHHHHHHHCCC--CCCEEEEEEECCCHHHHHCCCCCCCCCCCCHHHHHHHHHHHHHHHHCCCCHH
T ss_conf             54407861348999999865531784--5112332342233045426888878946703456799999999985582222


Q ss_pred             -EE-------------EHHHHHCHHHHHHHHHHCCCEEEECCEE
Q ss_conf             -23-------------1156516568999998099889977866
Q gi|254780485|r  273 -LA-------------AGRAMMSDELQALCFFSGANSIFVGDTL  302 (328)
Q Consensus       273 -i~-------------~~~~~~~~~~~~~~L~~GaN~~~~g~~~  302 (328)
                       +|             ++|    ...+.+++-|||-|.++++..
T Consensus       240 E~SnyAkaG~q~KHNL~YW----~~~dYlg~GaGA~G~~~~~r~  279 (371)
T TIGR00539       240 EVSNYAKAGYQVKHNLAYW----SAEDYLGIGAGAHGKVANERT  279 (371)
T ss_pred             HHHHHHHCCCCCCCCCCCC----CCCCCEEECCCEEEECCCCEE
T ss_conf             1238863787620022336----766613533740100147402


No 71 
>TIGR01125 TIGR01125 MiaB-like tRNA modifying enzyme YliG, TIGR01125; InterPro: IPR005840   This is a family of mainly hypothetical proteins of unknown function. .
Probab=99.19  E-value=3.8e-09  Score=80.98  Aligned_cols=190  Identities=18%  Similarity=0.257  Sum_probs=136.2

Q ss_pred             EEEEC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCCCC----------H---
Q ss_conf             64530-786834232124335477756410006857999999999964983899730368887442----------8---
Q gi|254780485|r   57 LLNIK-TGGCPENCGYCNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERD----------L---  122 (328)
Q Consensus        57 ~in~~-TN~C~~~C~fCaf~~~~~~~~~~~~~~~~Eei~~~a~~~~~~G~~~~~l~~~~~~~~~~~----------~---  122 (328)
                      .-+++ +..|...|+||..-.- +   -...-.+.|+|+.+|+.+.+.|.+++++++..-.....|          -   
T Consensus       165 YAYlKvaEGC~~~CaFCiIP~~-r---G~~rSR~ie~i~~Ea~~L~~~GvKEiiliaQDTt~YG~DL~~R~~~~~~e~v~  240 (475)
T TIGR01125       165 YAYLKVAEGCNRRCAFCIIPSL-R---GKLRSRPIEEILKEAKRLVDQGVKEIILIAQDTTAYGVDLYTRESEFDGEQVK  240 (475)
T ss_pred             EEEEEECCCCCCCCCEECCCCC-C---CCCCCCCHHHHHHHHHHHHHCCCCEEEEEEEECCCCCCEEEECCCCCCCHHHH
T ss_conf             0368700577898652136233-6---77677688889999999984398389999640347764111105522401457


Q ss_pred             HHHHHHHHHHCCCC-C-CE---EEECCCCCHHHHHHHHCCCCCEEEEECC-----CCHHHHHCCCCCCCHHHHHHHHHHH
Q ss_conf             99999887621368-8-32---4102569999999874157606975134-----3777732058888989999999999
Q gi|254780485|r  123 SIIVDMIKGVKSLG-L-ET---CMTLGMLSFEQAQILSKAGLDYYNHNID-----TSERFYPHVTTTHTFEDRLQTLENV  192 (328)
Q Consensus       123 ~~~~e~i~~i~~~~-~-~i---~~~~g~~~~~~~~~Lk~aG~~~~~~~le-----t~~~~~~~~~~~~~~~~~l~~~~~a  192 (328)
                      ..+.+++..+.+.+ . ++   .+.+..++++....+.+..  -++=++|     .+|++.+....+.+.+.-++.++.+
T Consensus       241 ~~L~~Ll~~L~k~~G~~WiR~~YlYP~~~~~~vI~~m~~~~--KvLPYlDiPLQH~sd~ILK~M~R~~~~~~~~~~i~~~  318 (475)
T TIGR01125       241 SKLVELLEELGKLGGIYWIRLLYLYPDELTDDVIDLMAEGP--KVLPYLDIPLQHASDRILKLMRRPGSGEEQLDLIERL  318 (475)
T ss_pred             HHHHHHHHHHHHCCCCCEEEEEEECCCCCCHHHHHHHHCCC--CCCCEECCCCCCCCHHHHHCCCCCCCHHHHHHHHHHH
T ss_conf             89999999740058962278887608888667889986389--8051225431238737874278996388999999999


Q ss_pred             HHC--CCCCCCEEEECC-CCCHHHHHHHHHHHHHCCCCCCEEECCCEEECCCCCCCCCCCCCHHH
Q ss_conf             987--985577078668-98999999999999740888860205411204874124456879899
Q gi|254780485|r  193 RKS--GIKVCCGGILGL-GEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIE  254 (328)
Q Consensus       193 ~~~--G~~~~sg~l~G~-gEt~eeri~~l~~lr~l~~~~~~v~~~~~~p~~gt~l~~~~~~~~~e  254 (328)
                      ++.  -.-.=||+|+|. |||.||-=+++..+.+.+.  +-+++|.+-|.+||.-.+-|..=|+|
T Consensus       319 R~~~P~~vlRttfIVGFPGETEEdF~eL~~Fv~e~~~--D~lG~F~YS~eEgt~A~~Lpd~vPeE  381 (475)
T TIGR01125       319 REKVPDAVLRTTFIVGFPGETEEDFQELLDFVEEGQF--DRLGVFTYSPEEGTDAFALPDQVPEE  381 (475)
T ss_pred             HHHCCCCEEEEEEEECCCCCCHHHHHHHHHHHHHHCC--CEEEEEECCCCCCCHHHCCCCCCCHH
T ss_conf             9755661772246886889987889999999852021--50000207832366035077887888


No 72 
>TIGR01578 MiaB-like-B MiaB-like tRNA modifying enzyme, archaeal-type; InterPro: IPR006466   This clade of sequences is closely related to MiaB, a modifier of isopentenylated adenosine-37 of certain eukaryotic and bacterial tRNAs (see IPR006463 from INTERPRO). Sequence alignments suggest that this family of sequences perform the same chemical transformation as MiaB, perhaps on a different (or differently modified) tRNA base substrate. This clade represents a subfamily that spans the archaea and eukaryotes. The only archaeal miaB-like genes are in this group of sequences , , ..
Probab=99.15  E-value=2.2e-09  Score=82.50  Aligned_cols=205  Identities=20%  Similarity=0.353  Sum_probs=136.0

Q ss_pred             EEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCEEEEEECCCCCC-----CCCC-HHHHHH
Q ss_conf             9986453078683423212433547775641000685799999999996498389973036888-----7442-899999
Q gi|254780485|r   54 LSKLLNIKTGGCPENCGYCNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREP-----KERD-LSIIVD  127 (328)
Q Consensus        54 ~~~~in~~TN~C~~~C~fCaf~~~~~~~~~~~~~~~~Eei~~~a~~~~~~G~~~~~l~~~~~~~-----~~~~-~~~~~e  127 (328)
                      +..++.| +..|..+|+||= .++.++...-   ..+|+|++.|+.+...|++++-|. +..+.     -... +..+++
T Consensus       144 ~i~i~pI-~~GC~~~CsYCi-~K~ARG~L~S---~PpEkiV~~ar~l~~~G~kEI~iT-s~DT~~YG~DiG~~kLPeLL~  217 (487)
T TIGR01578       144 LIEILPI-NQGCLGNCSYCI-TKIARGKLAS---YPPEKIVEKARELVAEGAKEIWIT-SQDTAAYGKDIGERKLPELLR  217 (487)
T ss_pred             CCCCCCC-CCCCCCCCCEEE-EEEEECCCCC---CCCHHHHHHHHHHHHCCCCEEEEC-CCCCCCCCCCCCCCCCHHHHH
T ss_conf             7555543-666356887546-7776445248---872256899999997053126513-446663442237621279999


Q ss_pred             -HHHHHCCCCCCEEEECCCCC--------HHHHHHHHC-CCCCEEEE-ECCC-CHHHHHCCCCCCCHHHHHHHHHHHHHC
Q ss_conf             -88762136883241025699--------999998741-57606975-1343-777732058888989999999999987
Q gi|254780485|r  128 -MIKGVKSLGLETCMTLGMLS--------FEQAQILSK-AGLDYYNH-NIDT-SERFYPHVTTTHTFEDRLQTLENVRKS  195 (328)
Q Consensus       128 -~i~~i~~~~~~i~~~~g~~~--------~~~~~~Lk~-aG~~~~~~-~let-~~~~~~~~~~~~~~~~~l~~~~~a~~~  195 (328)
                       ++..|+..   -.+-+|++.        ++-..-+.+ -=+..++| =+.| +.....+....|..++.-+++...++.
T Consensus       218 ~~~t~I~g~---F~~RVGMmnP~~~~~IldeL~~v~~~h~kV~kFLHlPvQSGsD~VL~~M~R~y~v~~f~~Iv~~FR~~  294 (487)
T TIGR01578       218 RLITEIPGD---FRLRVGMMNPKNVLEILDELIEVFQSHDKVYKFLHLPVQSGSDSVLKEMKREYTVDDFEDIVEKFRER  294 (487)
T ss_pred             HHHHHCCCC---CEEEEECCCCCCHHHHHHHHHHHHHCCCCEEEECCCCCCCCCHHHHHHCCCCCCHHHHHHHHHHHHHH
T ss_conf             998625993---27876258876334788999999854882000115420158758897448565257789999999876


Q ss_pred             --CCCCCCEEEECC-CCCHHHHHHHHHHHHHCCCCCCEEECCCEEECCCCCCCCCCCCCH---HHHHHHHH-HHHHHCCC
Q ss_conf             --985577078668-989999999999997408888602054112048741244568798---99999999-99996868
Q gi|254780485|r  196 --GIKVCCGGILGL-GEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDP---IEHVRIIS-VARILMPK  268 (328)
Q Consensus       196 --G~~~~sg~l~G~-gEt~eeri~~l~~lr~l~~~~~~v~~~~~~p~~gt~l~~~~~~~~---~e~lr~iA-i~RL~lP~  268 (328)
                        ++..++=+|+|. .||.+|--+.|..++++-  |+.+-++.|.|.|||+=....+.+.   .+--+.++ ++--+-|.
T Consensus       295 ~~~~tl~TDiIvGFp~EtdddFE~T~~l~~k~R--Pe~In~~~fS~RpgT~Aa~~~~~~~~i~K~Rs~~l~dlfysyePy  372 (487)
T TIGR01578       295 FPDLTLSTDIIVGFPTETDDDFEETMELLRKYR--PEKINVTKFSPRPGTEAAKMKRLDTNIKKKRSKALTDLFYSYEPY  372 (487)
T ss_pred             HCCCEEEEEEEECCCCCCHHHHHHHHHHHHHHC--CCEEEEECCCCCCCCHHHHHCCCCCCEEHHHHHHHHHHHHHCCCC
T ss_conf             268647300167178988355899999999828--983453024688887113305899620116667777654202630


Q ss_pred             C
Q ss_conf             7
Q gi|254780485|r  269 S  269 (328)
Q Consensus       269 ~  269 (328)
                      +
T Consensus       373 a  373 (487)
T TIGR01578       373 A  373 (487)
T ss_pred             C
T ss_conf             0


No 73 
>COG2100 Predicted Fe-S oxidoreductase [General function prediction only]
Probab=99.15  E-value=2.1e-08  Score=75.97  Aligned_cols=205  Identities=16%  Similarity=0.173  Sum_probs=132.6

Q ss_pred             EEEC-CCCCCCCCCCCCCCCCC--CCCCCCCCCCCHHHHHHHHHHHHH--CCCEEEEEECCCCCCCCCCHHHHHHHHHHH
Q ss_conf             4530-78683423212433547--775641000685799999999996--498389973036888744289999988762
Q gi|254780485|r   58 LNIK-TGGCPENCGYCNQSVHN--KSKLKASKLINVDQVLKEAKNAKE--NGATRYCMGAAWREPKERDLSIIVDMIKGV  132 (328)
Q Consensus        58 in~~-TN~C~~~C~fCaf~~~~--~~~~~~~~~~~~Eei~~~a~~~~~--~G~~~~~l~~~~~~~~~~~~~~~~e~i~~i  132 (328)
                      |.+. |-.|..||-||+--..+  ++.... +..++|..+++.+...+  .+.-+.++-+.|++...-.+.++++.++.+
T Consensus       109 iqVRp~tgCnlnCIfCSVdeGp~SrtR~~d-y~Vd~eyLl~w~~kVa~~KgkglEaHlDGqGEP~lYP~l~~lVqalk~~  187 (414)
T COG2100         109 IQVRPSTGCNLNCIFCSVDEGPYSRTRKLD-YVVDPEYLLEWFEKVARFKGKGLEAHLDGQGEPLLYPHLVDLVQALKEH  187 (414)
T ss_pred             EEECCCCCCCCEEEEEECCCCCCCCEECCC-EEECHHHHHHHHHHHHHHHCCCEEEEECCCCCCCCCHHHHHHHHHHHCC
T ss_conf             996477664320589852578643300256-1756899999999999640787278753788875453399999997438


Q ss_pred             CCCC-CCEEEECCCCCHHHHHHHHCCCCCEEEEECCC-CHHHHHCCCC--CCCHHHHHHHHHHHHHCCCCCCCEEEECCC
Q ss_conf             1368-83241025699999998741576069751343-7777320588--889899999999999879855770786689
Q gi|254780485|r  133 KSLG-LETCMTLGMLSFEQAQILSKAGLDYYNHNIDT-SERFYPHVTT--THTFEDRLQTLENVRKSGIKVCCGGILGLG  208 (328)
Q Consensus       133 ~~~~-~~i~~~~g~~~~~~~~~Lk~aG~~~~~~~let-~~~~~~~~~~--~~~~~~~l~~~~~a~~~G~~~~sg~l~G~g  208 (328)
                      +... +....+...++++....|.+||+|++++.+++ .|...+....  ..+.+.-+++.+.+..+|+.+-..=+.=.|
T Consensus       188 ~~v~vVSmQTng~~L~~~lv~eLeeAGLdRiNlSv~aLDpk~Ak~L~G~~dYdv~kvle~aE~i~~a~idvlIaPv~lPG  267 (414)
T COG2100         188 KGVEVVSMQTNGVLLSKKLVDELEEAGLDRINLSVDALDPKLAKMLAGRKDYDVKKVLEVAEYIANAGIDVLIAPVWLPG  267 (414)
T ss_pred             CCCEEEEEEECCEECCHHHHHHHHHHCCCEEEEECCCCCHHHHHHHCCCCCCCHHHHHHHHHHHHHCCCCEEEEEEECCC
T ss_conf             98428998507644459999999970875588620237988987742840117899999999998679888983144278


Q ss_pred             CCHHHHHHHHHHHHHCCCCC--CEEECCCEEECCCCCCC-CCCCCCHHHHHHHHHHHH
Q ss_conf             89999999999997408888--60205411204874124-456879899999999999
Q gi|254780485|r  209 EMIDDRIDMLLTLANLSTPP--ESIPINLLIPIPGSKFE-ENKKVDPIEHVRIISVAR  263 (328)
Q Consensus       209 Et~eeri~~l~~lr~l~~~~--~~v~~~~~~p~~gt~l~-~~~~~~~~e~lr~iAi~R  263 (328)
                      -..+|....+.+.++++...  .-..++.+.|++-..-. -..+.+-.|+.+++.-.-
T Consensus       268 ~ND~E~~~iIe~A~~iGaGkk~p~lgiQkyipyk~GRkp~~~k~~~fkeFYrwLrelE  325 (414)
T COG2100         268 VNDDEMPKIIEWAREIGAGKKWPPLGIQKYIPYKFGRKPVIAKVWPFKEFYRWLRELE  325 (414)
T ss_pred             CCHHHHHHHHHHHHHHCCCCCCCCCCEEEEEEECCCCCCCCCCCCCHHHHHHHHHHHH
T ss_conf             6817789999999984888779985307755402068863035575999999999999


No 74 
>TIGR01579 MiaB-like-C MiaB-like tRNA modifying enzyme; InterPro: IPR006467   This clade of sequences is closely related to MiaB, a modifier of isopentenylated adenosine-37 of certain eukaryotic and bacterial tRNAs (see IPR006463 from INTERPRO). Sequence alignments suggest that these sequences perform the same chemical transformation as MiaB, perhaps on a different (or differently modified) tRNA base substrate. This clade represents a subfamily that spans low GC Gram-positive bacteria, alpha and epsilon proteobacteria, Campylobacter, Porphyromonas, Aquifex, Thermotoga, Chlamydia, Treponema and Fusobacterium , , ..
Probab=99.12  E-value=8e-09  Score=78.78  Aligned_cols=181  Identities=15%  Similarity=0.249  Sum_probs=131.5

Q ss_pred             CCCCCCCCCCCCC--CCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCEEEEEECCC---CC-CC---CCCHHHHHHHHHH-
Q ss_conf             7868342321243--3547775641000685799999999996498389973036---88-87---4428999998876-
Q gi|254780485|r   62 TGGCPENCGYCNQ--SVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAW---RE-PK---ERDLSIIVDMIKG-  131 (328)
Q Consensus        62 TN~C~~~C~fCaf--~~~~~~~~~~~~~~~~Eei~~~a~~~~~~G~~~~~l~~~~---~~-~~---~~~~~~~~e~i~~-  131 (328)
                      -|+|...|+||..  .|+.     +.+-.+.|.|+++++.....|.+|++|.|.-   +. +.   ...+..+++.|-. 
T Consensus       217 QdGCn~~CsyC~IP~~RGt-----~~RS~~~e~~~~~v~~Lv~~gy~EvVLTGvnlg~Yg~d~~~~g~~L~~Ll~~i~~q  291 (492)
T TIGR01579       217 QDGCNKFCSYCIIPFARGT-----RSRSVPLEKILEQVKELVAKGYKEVVLTGVNLGSYGDDLGENGSSLAKLLEQILKQ  291 (492)
T ss_pred             ECCCCCCCCCCCCCCCCCC-----CCCCCCHHHHHHHHHHHHHCCCEEEEEEEECCCCCCCCCCCCCCCHHHHHHHHHHH
T ss_conf             7588988441014033789-----76416678999999999737755999840014445688876676089999999864


Q ss_pred             HCCC-CCCE-EEECCCCCHHHHHHHHC-C-CCCEEEEECCC-CHHHHHCCCCCCCHHHHHHHHHHHHHC--CCCCCCEEE
Q ss_conf             2136-8832-41025699999998741-5-76069751343-777732058888989999999999987--985577078
Q gi|254780485|r  132 VKSL-GLET-CMTLGMLSFEQAQILSK-A-GLDYYNHNIDT-SERFYPHVTTTHTFEDRLQTLENVRKS--GIKVCCGGI  204 (328)
Q Consensus       132 i~~~-~~~i-~~~~g~~~~~~~~~Lk~-a-G~~~~~~~let-~~~~~~~~~~~~~~~~~l~~~~~a~~~--G~~~~sg~l  204 (328)
                      |... .+.+ .+.+..++++-++.++. . =.-..|+.|.+ +....+....+++-++.++++..++..  .+..||=+|
T Consensus       292 ~~g~~RiRlSS~~p~~~~~~l~~l~~s~~~l~PHlHlsLQSGsd~vLkrM~R~Y~r~~~~~~v~~lr~~~p~~~~gtD~I  371 (492)
T TIGR01579       292 IPGIERIRLSSIDPEDIDEELLELIKSEKKLCPHLHLSLQSGSDRVLKRMRRKYTRDDFLKLVQKLRSVRPDYAFGTDVI  371 (492)
T ss_pred             CCCCEEEEECCCCHHHHCHHHHHHHHCCCCCCCCCCEEEECCCHHHHHHCCCCCCHHHHHHHHHHHHHCCCCCCCCCCEE
T ss_conf             68834676325776550489999973476416320000222773798424878876899999999985077630376037


Q ss_pred             ECC-CCCHHHHHHHHHHHHHCCCCCCEEECCCEEECCCCCCCCCCC
Q ss_conf             668-989999999999997408888602054112048741244568
Q gi|254780485|r  205 LGL-GEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKK  249 (328)
Q Consensus       205 ~G~-gEt~eeri~~l~~lr~l~~~~~~v~~~~~~p~~gt~l~~~~~  249 (328)
                      +|+ |||.++.-+.+..++++...  .+=+|+|-|.|||+=...+.
T Consensus       372 VGFP~E~eedFq~t~~~~~~~~~~--~~HiFpyS~R~~T~A~~m~~  415 (492)
T TIGR01579       372 VGFPGESEEDFQETLRIVKEIEFS--GLHIFPYSARPGTPASAMDD  415 (492)
T ss_pred             EECCCCCHHHHHHHHHHHHHCCCC--EEEEECCCCCCCCCCCCCCC
T ss_conf             408889889999999998526602--13354268843281204787


No 75 
>COG2108 Uncharacterized conserved protein related to pyruvate formate-lyase activating enzyme [General function prediction only]
Probab=99.09  E-value=2.1e-09  Score=82.66  Aligned_cols=212  Identities=18%  Similarity=0.169  Sum_probs=123.6

Q ss_pred             HHHCCCCEEEEEEEEEECCCCCCCCCCCCCCCCCCCCCCCC----CCCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCC
Q ss_conf             88628985699986453078683423212433547775641----00068579999999999649838997303688874
Q gi|254780485|r   44 RKNFEPNHIQLSKLLNIKTGGCPENCGYCNQSVHNKSKLKA----SKLINVDQVLKEAKNAKENGATRYCMGAAWREPKE  119 (328)
Q Consensus        44 r~~~~g~~V~~~~~in~~TN~C~~~C~fCaf~~~~~~~~~~----~~~~~~Eei~~~a~~~~~~G~~~~~l~~~~~~~~~  119 (328)
                      |.=..|.+.    .+.+ ||+|..+|.||..|...++...-    ....+.|+|.++|+...+.|+.   + +||+ | .
T Consensus        22 ~~C~~G~Kl----VlFv-TG~C~~~CfYCPvs~~r~gkdviyaNErpV~~~eDii~ea~~~~a~Gas---i-TGGd-P-l   90 (353)
T COG2108          22 RLCVLGGKL----VLFV-TGLCNRSCFYCPVSDERKGKDVIYANERPVKSVEDIIEEAKLMDALGAS---I-TGGD-P-L   90 (353)
T ss_pred             HHHHCCCCE----EEEE-ECCCCCCCCCCCCCHHHCCCCCEEECCCCCCCHHHHHHHHHHHCCCCCC---C-CCCC-H-H
T ss_conf             777258716----9999-5566898525768777648863311563147578899999972466653---3-2787-4-8


Q ss_pred             CCHHHHHHHHHHHCCCC---CCEEE--ECCCCCHHHHHHHHCCCCCEEEEECCCCHHHHHCCCCCCCHHHHHHHHHHHHH
Q ss_conf             42899999887621368---83241--02569999999874157606975134377773205888898999999999998
Q gi|254780485|r  120 RDLSIIVDMIKGVKSLG---LETCM--TLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRK  194 (328)
Q Consensus       120 ~~~~~~~e~i~~i~~~~---~~i~~--~~g~~~~~~~~~Lk~aG~~~~~~~let~~~~~~~~~~~~~~~~~l~~~~~a~~  194 (328)
                      ..++++.+.+|.+|+.+   .++|+  +.-..+++.++.|.+||+|.+-....        .......+.|++.++.|++
T Consensus        91 ~~ieR~~~~ir~LK~efG~~fHiHLYT~g~~~~~e~l~~L~eAGLDEIRfHp~--------~~~~~~~e~~i~~l~~A~~  162 (353)
T COG2108          91 LEIERTVEYIRLLKDEFGEDFHIHLYTTGILATEEALKALAEAGLDEIRFHPP--------RPGSKSSEKYIENLKIAKK  162 (353)
T ss_pred             HHHHHHHHHHHHHHHHHCCCEEEEEEECCCCCCHHHHHHHHHCCCCEEEECCC--------CCCCCCCHHHHHHHHHHHH
T ss_conf             99999999999998763532059984066568889999998679875994689--------7211231899999999998


Q ss_pred             CCCCCCCEEEECCCCCHH-HHHHHHHHHHHCCCCCCEEECCCEEECCCCC-------C------CCCCCCCHHHHHHHHH
Q ss_conf             798557707866898999-9999999997408888602054112048741-------2------4456879899999999
Q gi|254780485|r  195 SGIKVCCGGILGLGEMID-DRIDMLLTLANLSTPPESIPINLLIPIPGSK-------F------EENKKVDPIEHVRIIS  260 (328)
Q Consensus       195 ~G~~~~sg~l~G~gEt~e-eri~~l~~lr~l~~~~~~v~~~~~~p~~gt~-------l------~~~~~~~~~e~lr~iA  260 (328)
                      .|+.++--+-.  ....+ .+++....+-+...  .++-+|=|-...++.       +      ......|.+-.||.+.
T Consensus       163 ~g~dvG~EiPa--ipg~e~~i~e~~~~~~~~~~--~FlNiNELE~sE~N~~~l~~~gy~~~~~~~~av~GS~E~~Lk~l~  238 (353)
T COG2108         163 YGMDVGVEIPA--IPGEEEAILEFAKALDENGL--DFLNINELEFSENNYENLLERGYKISDDGSSAVAGSLEAALKVLK  238 (353)
T ss_pred             HCCCCEEECCC--CCCHHHHHHHHHHHHHHCCC--CEEEEEEEEECCCHHHHHHHCCCEECCCCCCCCCCHHHHHHHHHH
T ss_conf             28551043278--86568899999999876066--534210044052119999866761326875543445899999999


Q ss_pred             HHHHHCCCCCCEEEEHHHH
Q ss_conf             9999686872142311565
Q gi|254780485|r  261 VARILMPKSRLRLAAGRAM  279 (328)
Q Consensus       261 i~RL~lP~~~i~i~~~~~~  279 (328)
                      .+--= -+..+++.++..+
T Consensus       239 ~~~~~-~~l~vH~Css~~K  256 (353)
T COG2108         239 WAEEN-WDLTVHYCSSKFK  256 (353)
T ss_pred             HHHCC-CCCEEEECCHHHH
T ss_conf             87515-6754897735666


No 76 
>COG1243 ELP3 Histone acetyltransferase [Transcription / Chromatin structure and dynamics]
Probab=99.02  E-value=1.3e-07  Score=70.66  Aligned_cols=210  Identities=19%  Similarity=0.247  Sum_probs=139.4

Q ss_pred             EEEECCCCCCC-CCCCCCCCCCCCCCCC------------CCCCCCHHHHHHHHHHHHHCCCE----EEEEECCCCCCCC
Q ss_conf             64530786834-2321243354777564------------10006857999999999964983----8997303688874
Q gi|254780485|r   57 LLNIKTGGCPE-NCGYCNQSVHNKSKLK------------ASKLINVDQVLKEAKNAKENGAT----RYCMGAAWREPKE  119 (328)
Q Consensus        57 ~in~~TN~C~~-~C~fCaf~~~~~~~~~------------~~~~~~~Eei~~~a~~~~~~G~~----~~~l~~~~~~~~~  119 (328)
                      .+..+--.|+. .|.||.+.-...++..            ....-+.+++....+++...|..    ++.+.+|.-+  .
T Consensus        69 aVmt~p~~CPHg~CvfCpgg~~~~spQSytg~ep~~~R~~~~~ydpY~q~~~Rl~qL~~igh~~~KvEliimGGTFt--a  146 (515)
T COG1243          69 AVMTSPHGCPHGRCVFCPGGPDKDSPQSYTGEEPAALRAIKNRYDPYEQVRARLKQLETIGHTSDKVELIIMGGTFT--A  146 (515)
T ss_pred             EEECCCCCCCCCEEEECCCCCCCCCCCCCCCCCCHHHHHHHHCCCCHHHHHHHHHHHHHCCCCCCEEEEEEECCCCC--C
T ss_conf             98438889999807758997777888554788842667776057918888888999997399864289999626566--8


Q ss_pred             CCHHHHHHHHHH----HC-------------C------CCCCEEEECCCCCHHHHHHHHCCCCCEEEEECCC-CHHHHHC
Q ss_conf             428999998876----21-------------3------6883241025699999998741576069751343-7777320
Q gi|254780485|r  120 RDLSIIVDMIKG----VK-------------S------LGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDT-SERFYPH  175 (328)
Q Consensus       120 ~~~~~~~e~i~~----i~-------------~------~~~~i~~~~g~~~~~~~~~Lk~aG~~~~~~~let-~~~~~~~  175 (328)
                      .+.+|-..-++.    +.             +      .++-+..-+....++++..|++.|+..+.++.+| .......
T Consensus       147 ~~~~yqe~Fi~~~~~amn~f~~~le~a~~~ne~~~~r~vgitiETRPD~~~ee~ld~mlkyG~TrVELGVQSiyd~Vl~~  226 (515)
T COG1243         147 LSLEYQEWFLKVALKAMNDFGYDLEEAQRKNETAELRCVGITIETRPDYIDEEHLDQMLKYGVTRVELGVQSIYDDVLER  226 (515)
T ss_pred             CCHHHHHHHHHHHHHHHHCCCHHHHHHHHHHCCCCCCEEEEEEECCCCCCCHHHHHHHHHCCCCEEEEEEEEHHHHHHHH
T ss_conf             88789999999999865312204889887400023422679983484100779999999638838998326579999998


Q ss_pred             CCCCCCHHHHHHHHHHHHHCCCCCCCEEEECC-CCCHHHHHHHHHHHHHCC-CCCCEEECCCEEECCCCCCCC------C
Q ss_conf             58888989999999999987985577078668-989999999999997408-888602054112048741244------5
Q gi|254780485|r  176 VTTTHTFEDRLQTLENVRKSGIKVCCGGILGL-GEMIDDRIDMLLTLANLS-TPPESIPINLLIPIPGSKFEE------N  247 (328)
Q Consensus       176 ~~~~~~~~~~l~~~~~a~~~G~~~~sg~l~G~-gEt~eeri~~l~~lr~l~-~~~~~v~~~~~~p~~gt~l~~------~  247 (328)
                      ...+|+.++-.++.+.+++.|++++.+||.|+ |-..+--++....+-+.. ..|+++-+-|..-.+||+|..      -
T Consensus       227 ~~RGHtvedv~~a~rLlKd~GfKv~~HiMpGLPgs~~erDl~~f~~~f~~p~f~PDmlKIYPtLVi~gT~Ly~mwk~G~Y  306 (515)
T COG1243         227 TKRGHTVEDVVEATRLLKDAGFKVGYHIMPGLPGSDFERDLESFREIFEDPRFRPDMLKIYPTLVIEGTELYEMWKRGLY  306 (515)
T ss_pred             HCCCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCCHHHHHHHHHHHHHCCCCCCCEEEEEEEEEECCCHHHHHHHCCCC
T ss_conf             33896199999999999851837999965899998867789999999718888987578840279878269999970898


Q ss_pred             CCCCHHHHHHHHHHHHHHCCC
Q ss_conf             687989999999999996868
Q gi|254780485|r  248 KKVDPIEHVRIISVARILMPK  268 (328)
Q Consensus       248 ~~~~~~e~lr~iAi~RL~lP~  268 (328)
                      .+-+.+|..-.+|-.-.++|+
T Consensus       307 kpy~~EEaVeli~~i~~~~p~  327 (515)
T COG1243         307 KPYTTEEAVELIVEIYRLEPK  327 (515)
T ss_pred             CCCCHHHHHHHHHHHHHHCCC
T ss_conf             779889999999999986677


No 77 
>COG0535 Predicted Fe-S oxidoreductases [General function prediction only]
Probab=99.00  E-value=1.9e-07  Score=69.51  Aligned_cols=173  Identities=18%  Similarity=0.288  Sum_probs=110.2

Q ss_pred             EEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCC-CEEEEEECCCCCCCCCCHHHHHHHHHHH
Q ss_conf             998645307868342321243354777564100068579999999999649-8389973036888744289999988762
Q gi|254780485|r   54 LSKLLNIKTGGCPENCGYCNQSVHNKSKLKASKLINVDQVLKEAKNAKENG-ATRYCMGAAWREPKERDLSIIVDMIKGV  132 (328)
Q Consensus        54 ~~~~in~~TN~C~~~C~fCaf~~~~~~~~~~~~~~~~Eei~~~a~~~~~~G-~~~~~l~~~~~~~~~~~~~~~~e~i~~i  132 (328)
                      ....+++ |+.|..+|.||..+...+    ....++.++..+....+.+.| ...+ +.+||++...   ..+.++++.+
T Consensus        19 ~~~~~~~-t~~Cnl~C~~C~~~~~~~----~~~el~~~~~~~~~~~~~~~g~~~~v-~~~gGEPll~---~~~~ei~~~~   89 (347)
T COG0535          19 LVVGIEL-TNRCNLACKHCYAEAGKK----LPGELSTEEDLRVIDELAELGEIPVV-IFTGGEPLLR---PDLLEIVEYA   89 (347)
T ss_pred             CEEEEEC-CCCCCCCCCCCCCCCCCC----CCCCCCHHHHHHHHHHHHHCCCEEEE-EECCCCCEEC---CCHHHHHHHH
T ss_conf             3799855-887687499877242677----67735687878999999871884499-8079873334---5799999998


Q ss_pred             CCC-CCCEEEEC-C-CCCHHHHHHHHCCCCCEEEEECCC-CHHHHHCCCC-CCCHHHHHHHHHHHHHCCCCCC-CEEEEC
Q ss_conf             136-88324102-5-699999998741576069751343-7777320588-8898999999999998798557-707866
Q gi|254780485|r  133 KSL-GLETCMTL-G-MLSFEQAQILSKAGLDYYNHNIDT-SERFYPHVTT-THTFEDRLQTLENVRKSGIKVC-CGGILG  206 (328)
Q Consensus       133 ~~~-~~~i~~~~-g-~~~~~~~~~Lk~aG~~~~~~~let-~~~~~~~~~~-~~~~~~~l~~~~~a~~~G~~~~-sg~l~G  206 (328)
                      ++. +..+.++. | .++++.+++++++|++.+.+.+|+ .++.+..... +..++..++.++.+++.|+.+. .+.+-+
T Consensus        90 ~~~~~~~~~~~TnG~~~~~~~~~~l~~~g~~~v~iSld~~~~e~hd~~rg~~g~~~~~~~~i~~~~~~g~~~~~~~~v~~  169 (347)
T COG0535          90 RKKGGIRVSLSTNGTLLTEEVLEKLKEAGLDYVSISLDGLDPETHDPIRGVKGVFKRAVEAIKNLKEAGILVVINTTVTK  169 (347)
T ss_pred             HHCCCEEEEEECCCCCCCHHHHHHHHHCCCCEEEEEEECCCCCCCCCCCCCCCHHHHHHHHHHHHHHHCCEEEEEEEEEC
T ss_conf             51387289882687545388999887668876999974588532140027762699999999999873970489999956


Q ss_pred             CCCCHHHHHHHHHHHHHCCCCCCEEECCCEEEC
Q ss_conf             898999999999999740888860205411204
Q gi|254780485|r  207 LGEMIDDRIDMLLTLANLSTPPESIPINLLIPI  239 (328)
Q Consensus       207 ~gEt~eeri~~l~~lr~l~~~~~~v~~~~~~p~  239 (328)
                        .+.++.-+....+++++..  .+.+.++.|.
T Consensus       170 --~n~~~l~~~~~~~~~~g~~--~~~~~~~~~~  198 (347)
T COG0535         170 --INYDELPEIADLAAELGVD--ELNVFPLIPV  198 (347)
T ss_pred             --CCHHHHHHHHHHHHHCCCC--CEEEEEEEEC
T ss_conf             --6346589999999865976--0576764431


No 78 
>PRK13758 anaerobic sulfatase-maturase; Provisional
Probab=98.96  E-value=2.5e-07  Score=68.79  Aligned_cols=164  Identities=11%  Similarity=0.134  Sum_probs=97.8

Q ss_pred             EEECCCCCCCCCCCCCCCC-CCCCCCCCCCCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCCC---CHHHHHHHHHHHC
Q ss_conf             4530786834232124335-47775641000685799999999996498389973036888744---2899999887621
Q gi|254780485|r   58 LNIKTGGCPENCGYCNQSV-HNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKER---DLSIIVDMIKGVK  133 (328)
Q Consensus        58 in~~TN~C~~~C~fCaf~~-~~~~~~~~~~~~~~Eei~~~a~~~~~~G~~~~~l~~~~~~~~~~---~~~~~~e~i~~i~  133 (328)
                      +.+ |+.|..+|+||-... ..+........++.|.+...++.+.+....++.+...|++|...   .++.+.+.++...
T Consensus         9 ~~~-T~~CNL~C~YCy~~~~~~~~~~~~~~~~~~e~~~~~i~~~~~~~~~~~~i~f~GGEPLL~~~~~~~~~~~~~~~~~   87 (370)
T PRK13758          9 KPA-SSGCNLKCTYCFYHSLSDNRNVKSYGIMRDEVLESMVKRVLNEAEGHCSFAFQGGEPTLAGLEFFEELMELQRKHN   87 (370)
T ss_pred             ECC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCCEEEEEECCCCCCCCCHHHHHHHHHHHHHC
T ss_conf             668-7884889976688376886666664548299999999999863689538999772220698369999999999855


Q ss_pred             CCCCC----EEEECCCCCHHHHHHHHCCCCCEEEEECCCCHHHHHCCC----CCCCHHHHHHHHHHHHHCCCCCCCEEEE
Q ss_conf             36883----241025699999998741576069751343777732058----8889899999999999879855770786
Q gi|254780485|r  134 SLGLE----TCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVT----TTHTFEDRLQTLENVRKSGIKVCCGGIL  205 (328)
Q Consensus       134 ~~~~~----i~~~~g~~~~~~~~~Lk~aG~~~~~~~let~~~~~~~~~----~~~~~~~~l~~~~~a~~~G~~~~sg~l~  205 (328)
                      ..+..    +..+.-.++++.++.|++.++ .+.+.+|..++++.+.+    .+.||+.-++.++.+++.|+..+.-+.+
T Consensus        88 ~~~~~i~~~i~TNGtLL~~e~~~~l~~~~~-~I~ISlDG~~~~HD~~R~~~~G~Gsf~~v~~~i~~l~~~~~~~~i~~~i  166 (370)
T PRK13758         88 YKNLKIYNSLQTNGTLIDESWAKFLSENKF-LVGLSMDGPKEIHNLNRKDCCGLDTFSKVERAAELFKKYKVEFNILCVV  166 (370)
T ss_pred             CCCCEEEEEEEECCEECCHHHHHHHHHCCE-EEEEECCCCHHHHHHHCCCCCCCCHHHHHHHHHHHHHHCCCCEEEEEEE
T ss_conf             689769999851887668999999997694-8999646888887400688899705999999999999739970089999


Q ss_pred             C--CCCCHHHHHHHHHHHHHCCC
Q ss_conf             6--89899999999999974088
Q gi|254780485|r  206 G--LGEMIDDRIDMLLTLANLST  226 (328)
Q Consensus       206 G--~gEt~eeri~~l~~lr~l~~  226 (328)
                      -  -....++.+++   +.+++.
T Consensus       167 ~~~~~~~~~~i~~~---~~~~g~  186 (370)
T PRK13758        167 TSNTARHVNKIYKY---FKEKDF  186 (370)
T ss_pred             ECCCCCCHHHHHHH---HHHCCC
T ss_conf             18731189999999---997699


No 79 
>COG4277 Predicted DNA-binding protein with the Helix-hairpin-helix motif [General function prediction only]
Probab=98.95  E-value=8.7e-08  Score=71.85  Aligned_cols=190  Identities=14%  Similarity=0.174  Sum_probs=119.4

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCC-CEEEEEECCCCCCCCCCHHHHHHHHHHHCCC---CC
Q ss_conf             7868342321243354777564100068579999999999649-8389973036888744289999988762136---88
Q gi|254780485|r   62 TGGCPENCGYCNQSVHNKSKLKASKLINVDQVLKEAKNAKENG-ATRYCMGAAWREPKERDLSIIVDMIKGVKSL---GL  137 (328)
Q Consensus        62 TN~C~~~C~fCaf~~~~~~~~~~~~~~~~Eei~~~a~~~~~~G-~~~~~l~~~~~~~~~~~~~~~~e~i~~i~~~---~~  137 (328)
                      ||.|-++|+||--+..+.  .++. .+++|||.......+... +..+.+.+|.-..++...|..++..|.++-.   .=
T Consensus        61 TN~CiyDC~YCINr~s~~--~pra-~ftp~Eiv~ltlnfYrRnYIeGLFLSSGvi~~~DyTmE~mi~var~LRle~~f~G  137 (404)
T COG4277          61 TNFCIYDCAYCINRSSND--TPRA-RFTPEEIVDLTLNFYRRNYIEGLFLSSGVIKNPDYTMEEMIEVARILRLEHKFRG  137 (404)
T ss_pred             HHHHHHHHHHHHCCCCCC--CCCC-CCCHHHHHHHHHHHHHHHHHHHHEECCCCCCCCCHHHHHHHHHHHHHHHCCCCCC
T ss_conf             625777638875555578--8543-0589999999998988742433000246336861479999999998832045575


Q ss_pred             CEEEECCCCCHHHHHHHHCCC--CCEEEEECCCC-HHHHHCCCCCCCHHHHHHHHHHHHH---------C------CC-C
Q ss_conf             324102569999999874157--60697513437-7773205888898999999999998---------7------98-5
Q gi|254780485|r  138 ETCMTLGMLSFEQAQILSKAG--LDYYNHNIDTS-ERFYPHVTTTHTFEDRLQTLENVRK---------S------GI-K  198 (328)
Q Consensus       138 ~i~~~~g~~~~~~~~~Lk~aG--~~~~~~~let~-~~~~~~~~~~~~~~~~l~~~~~a~~---------~------G~-~  198 (328)
                      -||+.+-+  ...-...+++|  +|++.+|+|.. +.-.+..-|.+++.+.+..|.+.|.         .      -+ +
T Consensus       138 YIHlK~IP--gas~~li~eaglyadRvSiNIElp~~~~lk~lap~K~p~dI~r~Mg~ir~~i~e~~e~~~r~r~tp~fap  215 (404)
T COG4277         138 YIHLKIIP--GASPDLIKEAGLYADRVSINIELPTDDGLKLLAPEKDPTDILRSMGWIRLKILENAEDKRRKRHTPEFAP  215 (404)
T ss_pred             EEEEEECC--CCCHHHHHHHHHHHHEEEEEEECCCCCHHHHHCCCCCHHHHHHHHHHHHHHHHHCCCCHHHHCCCCCCCC
T ss_conf             79987569--9998999998653410577674488644666188888378888989999877651550222104723367


Q ss_pred             --CCCEEEECC-CCCHHHHHHHHHHHHHCCCCCCEEECCCEEECCCCCCCCCCCCCHHHHHH
Q ss_conf             --577078668-98999999999999740888860205411204874124456879899999
Q gi|254780485|r  199 --VCCGGILGL-GEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEHVR  257 (328)
Q Consensus       199 --~~sg~l~G~-gEt~eeri~~l~~lr~l~~~~~~v~~~~~~p~~gt~l~~~~~~~~~e~lr  257 (328)
                        -++-||+|- +||.++++..-..|..--. -.-|.++.|.|.+++|+.....+....-.|
T Consensus       216 aGQSTQmivGA~~~tD~~Ilsrs~~ly~~y~-lkRVyySaf~Pv~~s~~lp~~~pplmRehR  276 (404)
T COG4277         216 AGQSTQMIVGADGETDEDILSRSENLYGRYS-LKRVYYSAFSPVPSSPLLPDDKPPLMREHR  276 (404)
T ss_pred             CCCCEEEEEECCCCCHHHHHHHHHHHHHCCC-EEEEEEECCCCCCCCCCCCCCCCCHHHHHH
T ss_conf             7873278871588744889988887753243-148986213336889888666785367777


No 80 
>TIGR02109 PQQ_syn_pqqE coenzyme PQQ biosynthesis protein E; InterPro: IPR011843    This entry describes coenzyme PQQ biosynthesis protein E, a gene required for the biosynthesis of pyrrolo-quinoline-quinone (coenzyme PQQ). PQQ is required for some glucose dehydrogenases and alcohol dehydrogenases.; GO: 0051539 4 iron 4 sulfur cluster binding, 0018189 pyrroloquinoline quinone biosynthetic process.
Probab=98.88  E-value=2e-08  Score=76.15  Aligned_cols=196  Identities=18%  Similarity=0.248  Sum_probs=123.1

Q ss_pred             EEECCCCCCCCCCCCCCCCCCCCC-CCCCCCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCCCCHHHHHHHHHHHCCCC
Q ss_conf             453078683423212433547775-6410006857999999999964983899730368887442899999887621368
Q gi|254780485|r   58 LNIKTGGCPENCGYCNQSVHNKSK-LKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLG  136 (328)
Q Consensus        58 in~~TN~C~~~C~fCaf~~~~~~~-~~~~~~~~~Eei~~~a~~~~~~G~~~~~l~~~~~~~~~~~~~~~~e~i~~i~~~~  136 (328)
                      +++ |=.|+..|-||+    |+-+ .....-||-|+=.+...++.++|.-++++ +||++....|+.   |+++..++.+
T Consensus        11 aEL-ThRCPL~CPYCS----NPLel~R~~~EL~T~~W~~Vl~qAa~lGvlqlHf-SGGEP~aR~DL~---eLv~~A~~LG   81 (363)
T TIGR02109        11 AEL-THRCPLQCPYCS----NPLELARRKAELTTEEWTDVLTQAAELGVLQLHF-SGGEPLARPDLV---ELVAHARRLG   81 (363)
T ss_pred             HHH-HHCCCCCCCCCC----CCHHHHHHHCCCCHHHHHHHHHHHHHCCCEEEEC-CCCCCCCCCCHH---HHHHHHHHCC
T ss_conf             998-725888777989----7068885114688889999999998539067513-077666335779---9999997758


Q ss_pred             C--CEEEECCCCCHHHHHHHHCCCCCEEEEEC-CCCHHHHHCCCC-CCCHHHHHHHHHHHHHCCCCCCCEEEECCCCCHH
Q ss_conf             8--32410256999999987415760697513-437777320588-8898999999999998798557707866898999
Q gi|254780485|r  137 L--ETCMTLGMLSFEQAQILSKAGLDYYNHNI-DTSERFYPHVTT-THTFEDRLQTLENVRKSGIKVCCGGILGLGEMID  212 (328)
Q Consensus       137 ~--~i~~~~g~~~~~~~~~Lk~aG~~~~~~~l-et~~~~~~~~~~-~~~~~~~l~~~~~a~~~G~~~~sg~l~G~gEt~e  212 (328)
                      .  ++..|-=-++++-+..|+++|+|.+=+.+ ++.+..-..+-. |+.+.+.+++-+.++++|+|.+-.+++ |=+...
T Consensus        82 lYtNLITSGvGLt~~rl~~L~~aGLDHvQlSfQ~vd~~~a~~iaG~k~A~~~Kl~~A~~v~~~g~PltLN~V~-HR~Ni~  160 (363)
T TIGR02109        82 LYTNLITSGVGLTEARLDALADAGLDHVQLSFQGVDEALADRIAGLKNAFEQKLAVARAVKAAGLPLTLNFVL-HRHNID  160 (363)
T ss_pred             CCHHHHHHHHHHHHHHHHHHHHCCCCEEEEEEECCCHHHHHHHCCHHHHHHHHHHHHHHHHHCCCCEEEEHCC-CCCHHH
T ss_conf             7014677634567999999975798578876414787888641250258999999999999618981760200-242021


Q ss_pred             HHHHHHHHHHHCCCCCCEEECCCEEECCCCCCCCC--CCCCH---HHHHHHHHHHHHHC
Q ss_conf             99999999974088886020541120487412445--68798---99999999999968
Q gi|254780485|r  213 DRIDMLLTLANLSTPPESIPINLLIPIPGSKFEEN--KKVDP---IEHVRIISVARILM  266 (328)
Q Consensus       213 eri~~l~~lr~l~~~~~~v~~~~~~p~~gt~l~~~--~~~~~---~e~lr~iAi~RL~l  266 (328)
                      ++=+.+..-.+|+...-.|..  -.++-+- +.++  -.||-   ++.-|+|+-+|==+
T Consensus       161 ~i~~~i~La~~L~AdrvE~A~--~QyYGWA-~~NR~aLlPt~~Ql~~a~r~V~~aRer~  216 (363)
T TIGR02109       161 QIPEIIELAIELGADRVELAT--TQYYGWA-LLNRAALLPTREQLEEATRIVEEARERL  216 (363)
T ss_pred             HHHHHHHHHHHCCCCEEEEEE--ECCHHHH-HHHHHHCCCCHHHHHHHHHHHHHHHHHH
T ss_conf             367899999863898488874--0202256-7745424898899999999999999998


No 81 
>TIGR00538 hemN oxygen-independent coproporphyrinogen III oxidase; InterPro: IPR004558   This family represents HemN, the oxygen-independent coproporphyrinogen III oxidase that replaces HemF function under anaerobic conditions. HemN catalyses the anaerobic transformation of coproporhyrinogen-III into protoporphyrinogen-IX during porphyrin biosynthesis. Several species, including Escherichia coli, Helicobacter pylori, and Aquifex aeolicus, have both a member of this family and a member of another, closely related family for which there is no evidence of coproporphyrinogen III oxidase activity, IPR004559 from INTERPRO. Members of this family have a perfectly conserved motif PYRT[SC]YP in a region N-terminal to the region of homology with the related uncharacterised protein.; GO: 0004109 coproporphyrinogen oxidase activity, 0006779 porphyrin biosynthetic process, 0005737 cytoplasm.
Probab=98.85  E-value=1.7e-07  Score=69.85  Aligned_cols=239  Identities=18%  Similarity=0.256  Sum_probs=142.0

Q ss_pred             EEEEEEEEEECCCCCCCCCCCCCCCC---CCCCCCCCCCCCCH-HHHHHHHHHHH-HCCCEEEEEECCCCCCCCCCHHHH
Q ss_conf             56999864530786834232124335---47775641000685-79999999999-649838997303688874428999
Q gi|254780485|r   51 HIQLSKLLNIKTGGCPENCGYCNQSV---HNKSKLKASKLINV-DQVLKEAKNAK-ENGATRYCMGAAWREPKERDLSII  125 (328)
Q Consensus        51 ~V~~~~~in~~TN~C~~~C~fCaf~~---~~~~~~~~~~~~~~-Eei~~~a~~~~-~~G~~~~~l~~~~~~~~~~~~~~~  125 (328)
                      .-++..+|-+    |...|-|||=+.   +.+.....| +... .||.-.+-... ++-+..+|-  ||++|.....+.+
T Consensus        51 PLSLY~HiPF----C~~~CyFCgCn~I~t~~~~~~~~Y-L~~l~ke~~l~~~~~d~~R~V~QLHw--GGGTP~YL~~~Q~  123 (462)
T TIGR00538        51 PLSLYVHIPF----CEKACYFCGCNVIITRRKEKKDPY-LEALKKEIALVAPLLDKDREVAQLHW--GGGTPTYLSPEQI  123 (462)
T ss_pred             CCCCCCCCHH----HHCCCCCCCCCEEECCCCCCHHHH-HHHHHHHHHHHHHHHHCCCCEEEEEC--CCCCCCCCCHHHH
T ss_conf             8411245523----412132014661130556510167-99999999998777524894688762--7898333788999


Q ss_pred             HHHHHHHCCC------CCCEEEE--CCCCCHHHHHHHHCCCCCEEEEECCC-CHHHHHCCCCCCCHHHHHHHHHHHHHCC
Q ss_conf             9988762136------8832410--25699999998741576069751343-7777320588889899999999999879
Q gi|254780485|r  126 VDMIKGVKSL------GLETCMT--LGMLSFEQAQILSKAGLDYYNHNIDT-SERFYPHVTTTHTFEDRLQTLENVRKSG  196 (328)
Q Consensus       126 ~e~i~~i~~~------~~~i~~~--~g~~~~~~~~~Lk~aG~~~~~~~let-~~~~~~~~~~~~~~~~~l~~~~~a~~~G  196 (328)
                      -.+...|++.      +.++.+.  +-.++.+.+..|++.|.+++..++.- .++.-..+..=.+++=--+.|+.|+++|
T Consensus       124 ~~l~~~i~~~F~nf~~daEiSiEidPR~~~~e~~~~L~~~GFNRlS~GvQDfd~~VQ~avnR~QP~e~i~~~~~~~R~~G  203 (462)
T TIGR00538       124 EELMKEIREAFPNFSEDAEISIEIDPRYLTKEVIKALRDEGFNRLSFGVQDFDKEVQQAVNRIQPEEMIFELMEKAREAG  203 (462)
T ss_pred             HHHHHHHHHHHHHHCCCCEEEEEECCCCCCHHHHHHHHHCCCCEEECCEECCCHHHHHHHCCCCCHHHHHHHHHHHHHCC
T ss_conf             99999999873201158447765237413788999999758966423521078555444313486899999999998669


Q ss_pred             CC-CCCEEEECC-CCCHHHHHHHHHHHHHCCCCCCEEECCCEEECC-----CCCCCCCCCCCHHHHHHHHH--HHHHH--
Q ss_conf             85-577078668-989999999999997408888602054112048-----74124456879899999999--99996--
Q gi|254780485|r  197 IK-VCCGGILGL-GEMIDDRIDMLLTLANLSTPPESIPINLLIPIP-----GSKFEENKKVDPIEHVRIIS--VARIL--  265 (328)
Q Consensus       197 ~~-~~sg~l~G~-gEt~eeri~~l~~lr~l~~~~~~v~~~~~~p~~-----gt~l~~~~~~~~~e~lr~iA--i~RL~--  265 (328)
                      +. ++.=.|||+ -.|.|--...|.+..+|+.  +=++++.|-..|     --.+....-||++|=|+++-  |+-|-  
T Consensus       204 f~SiN~DLIYGLP~Qt~esF~~Tl~~v~~LnP--DRlAvFnyAyvP~vk~~q~k~~~~~LPS~~~KL~Il~~~I~~L~~~  281 (462)
T TIGR00538       204 FESINLDLIYGLPKQTKESFEKTLEKVAELNP--DRLAVFNYAYVPWVKPAQRKIPEEALPSAEEKLEILEETIAFLTEA  281 (462)
T ss_pred             CCEEEEEEECCCCCCCHHHHHHHHHHHHHCCC--CEEHHHHHHHHCCHHHHHCCCCHHCCCCHHHHHHHHHHHHHHHHHC
T ss_conf             82787420138888786789999999853187--7001210222101577850276200588789999999999999757


Q ss_pred             -----------CCCCCC-----------EEEEHHHHHCHHHHHHHHHHCCCEE-EECCEE
Q ss_conf             -----------868721-----------4231156516568999998099889-977866
Q gi|254780485|r  266 -----------MPKSRL-----------RLAAGRAMMSDELQALCFFSGANSI-FVGDTL  302 (328)
Q Consensus       266 -----------lP~~~i-----------~i~~~~~~~~~~~~~~~L~~GaN~~-~~g~~~  302 (328)
                                 -|+..+           ++|++--  -++.  -.|-.|+.|| |.||++
T Consensus       282 gY~fIGMDHFAkpddELavAqr~geL~RNFQGYTT--~~~~--~lLG~GvtSIsm~~D~Y  337 (462)
T TIGR00538       282 GYVFIGMDHFAKPDDELAVAQRKGELHRNFQGYTT--KKET--DLLGFGVTSISMLGDVY  337 (462)
T ss_pred             CCEEECCCCCCCCCHHHHHHHHCCCCCCCCCCCCC--CCCC--EEEEECHHHHHHHCCCC
T ss_conf             97585144577971389999850530005765224--8972--15630110211200212


No 82 
>PRK11145 pflA pyruvate formate lyase-activating enzyme 1; Provisional
Probab=98.82  E-value=3.3e-06  Score=61.28  Aligned_cols=194  Identities=14%  Similarity=0.172  Sum_probs=125.9

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHH---HCCCEEEEEECCCCCCCCCCHHHHHHHHHHHCCCCCC
Q ss_conf             7868342321243354777564100068579999999999---6498389973036888744289999988762136883
Q gi|254780485|r   62 TGGCPENCGYCNQSVHNKSKLKASKLINVDQVLKEAKNAK---ENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLGLE  138 (328)
Q Consensus        62 TN~C~~~C~fCaf~~~~~~~~~~~~~~~~Eei~~~a~~~~---~~G~~~~~l~~~~~~~~~~~~~~~~e~i~~i~~~~~~  138 (328)
                      .-.|+..|.||.-.-...  ......++.||+.+++....   +.....+.+ +||+ | .-..+++.+.++..|+.+++
T Consensus        27 l~GC~lrC~~ChNpet~~--~~~g~~~t~~el~~~i~~~~~f~~~sgGGVT~-SGGE-P-llq~ef~~~l~~~~k~~gi~  101 (246)
T PRK11145         27 MQGCLMRCLYCHNRDTWD--THGGKEVTVEELMKEVVTYRHFMNASGGGVTA-SGGE-A-ILQAEFVRDWFRACKKEGIH  101 (246)
T ss_pred             ECCCCCCCCCCCCHHHHC--CCCCEECCHHHHHHHHHHHHHHHHHCCCEEEE-ECCC-E-ECCHHHHHHHHHHHHHCCCC
T ss_conf             068778899897967848--67998755999999999879998605963898-6995-1-26899999999999887998


Q ss_pred             EEE-ECCCCC--HHHHHHHHCCCCCEEEEECCC-CHHHHHCCCCCCCHHHHHHHHHHHHHCCCCCCCEE--EECCCCCHH
Q ss_conf             241-025699--999998741576069751343-77773205888898999999999998798557707--866898999
Q gi|254780485|r  139 TCM-TLGMLS--FEQAQILSKAGLDYYNHNIDT-SERFYPHVTTTHTFEDRLQTLENVRKSGIKVCCGG--ILGLGEMID  212 (328)
Q Consensus       139 i~~-~~g~~~--~~~~~~Lk~aG~~~~~~~let-~~~~~~~~~~~~~~~~~l~~~~~a~~~G~~~~sg~--l~G~gEt~e  212 (328)
                      .++ +.|..+  .+.+.++... +|.+++.+.. .++.|.++ ++.+.+..|+.++.+++.|.++-..+  |=|...+.+
T Consensus       102 taidTnG~~~~~~~~~~~ll~~-~D~vl~DiK~~d~~~h~~~-tG~~n~~iL~nl~~l~~~~~~~~iR~pvIPg~nD~~e  179 (246)
T PRK11145        102 TCLDTNGFVRRYDPVIDELLDV-TDLVMLDLKQMNDEIHQNL-VGVSNHRTLEFARYLAKRNQKTWIRYVVVPGWTDDDD  179 (246)
T ss_pred             EEEECCCCCCCCHHHHHHHHHH-CCEEEECCCCCCHHHHHHH-HCCCCHHHHHHHHHHHHCCCCEEEEEEEECCCCCCHH
T ss_conf             9998999987557999998863-2345764666898999999-8889189999999999789978998867799889999


Q ss_pred             HHHHHHHHHHHCCCCCCEEECCCEEE---C------CCCCCCCCCCCCHHHHHHHHHHHH
Q ss_conf             99999999974088886020541120---4------874124456879899999999999
Q gi|254780485|r  213 DRIDMLLTLANLSTPPESIPINLLIP---I------PGSKFEENKKVDPIEHVRIISVAR  263 (328)
Q Consensus       213 eri~~l~~lr~l~~~~~~v~~~~~~p---~------~gt~l~~~~~~~~~e~lr~iAi~R  263 (328)
                      ++-.....++++.. ...|-+-|+++   .      ..-+|.+.++++.++..+...+++
T Consensus       180 ~i~~~a~fl~~l~~-v~~v~lLPyH~~G~~Ky~~lg~~Y~~~~~~~~~~e~l~~~~~i~~  238 (246)
T PRK11145        180 SAHRLGEFIKDMGN-IEKVELLPYHELGKHKWEAMGEEYKLDGVKPPSKETMERIKGILE  238 (246)
T ss_pred             HHHHHHHHHHHCCC-CCEEEECCCCCCCHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHHH
T ss_conf             99999999997699-763665788756654799839998888989979999999999999


No 83 
>COG1180 PflA Pyruvate-formate lyase-activating enzyme [Posttranslational modification, protein turnover, chaperones]
Probab=98.77  E-value=1.8e-06  Score=63.11  Aligned_cols=194  Identities=19%  Similarity=0.286  Sum_probs=125.2

Q ss_pred             CCCCCCCCCCCCCCCCCCC-CCCCCCCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCCCCHHHHHHHHHHHCCCCCCEE
Q ss_conf             7868342321243354777-564100068579999999999649838997303688874428999998876213688324
Q gi|254780485|r   62 TGGCPENCGYCNQSVHNKS-KLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLGLETC  140 (328)
Q Consensus        62 TN~C~~~C~fCaf~~~~~~-~~~~~~~~~~Eei~~~a~~~~~~G~~~~~l~~~~~~~~~~~~~~~~e~i~~i~~~~~~i~  140 (328)
                      +-.|...|.||--...... .......+++|++.+.+..  ..++.-++. +|++ |. -..+++.+.++..|+.++.++
T Consensus        42 ~~GCnlrC~~C~N~~~~~~~~~~~~~~~~~e~l~~~~~~--~~~~~gvt~-SGGE-P~-~q~e~~~~~~~~ake~Gl~~~  116 (260)
T COG1180          42 LQGCNLRCPYCQNPEISQRGREVSGEEVSPEVLVDKAFY--SESGGGVTF-SGGE-PT-LQAEFALDLLRAAKERGLHVA  116 (260)
T ss_pred             ECCCCCCCCCCCCHHHHHCCCCCCHHHCCHHHHHHHHHH--CCCCCEEEE-ECCH-HH-HHHHHHHHHHHHHHHCCCEEE
T ss_conf             789899899897946760656565645789899998743--169988999-8960-44-439999999999998799089


Q ss_pred             E-ECCCCCHHHHHHHHCCCCCEEEEECCC-CHHHHHCCCCCCCHHHHHHHHHHHHHCCCCCCCEEEE--CCCCCHHHHHH
Q ss_conf             1-025699999998741576069751343-7777320588889899999999999879855770786--68989999999
Q gi|254780485|r  141 M-TLGMLSFEQAQILSKAGLDYYNHNIDT-SERFYPHVTTTHTFEDRLQTLENVRKSGIKVCCGGIL--GLGEMIDDRID  216 (328)
Q Consensus       141 ~-~~g~~~~~~~~~Lk~aG~~~~~~~let-~~~~~~~~~~~~~~~~~l~~~~~a~~~G~~~~sg~l~--G~gEt~eeri~  216 (328)
                      + +.|..+.+...+|.+. +|.+++.+.. +++.|.+++ +.+.+.-++.++.+.+.|..+-.+.++  |..+..+|..+
T Consensus       117 l~TnG~~~~~~~~~l~~~-~D~v~~DlK~~~~~~yr~~t-g~~~~~vl~~~~~l~~~g~~ve~r~lviPg~~d~~e~i~~  194 (260)
T COG1180         117 LDTNGFLPPEALEELLPL-LDAVLLDLKAFDDELYRKLT-GADNEPVLENLELLADLGVHVEIRTLVIPGYNDDEEEIRE  194 (260)
T ss_pred             EECCCCCCHHHHHHHHHH-CCCEEEECCCCCHHHHHHHH-CCCHHHHHHHHHHHHHCCCEEEEEEEECCCCCCCHHHHHH
T ss_conf             976899882689999974-23148840668878889875-6871688999999861798399988733898899999999


Q ss_pred             HHHHHHHCCCCCCEEECCCEEECCCCCCCCCCCCCHHHHHHHHHHHHHH
Q ss_conf             9999974088886020541120487412445687989999999999996
Q gi|254780485|r  217 MLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEHVRIISVARIL  265 (328)
Q Consensus       217 ~l~~lr~l~~~~~~v~~~~~~p~~gt~l~~~~~~~~~e~lr~iAi~RL~  265 (328)
                      ....++++..   .+|+-++..+|.-.+...++....+.-+...+++-.
T Consensus       195 i~~~i~~~~~---~~p~~~l~fhp~~~~~~~p~~~~~~le~~~~~a~~~  240 (260)
T COG1180         195 LAEFIADLGP---EIPIHLLRFHPDYKLKDLPPTPVETLEEAKKLAKEE  240 (260)
T ss_pred             HHHHHHHCCC---CCCEEEECCCCCHHCCCCCCCCHHHHHHHHHHHHHH
T ss_conf             9999973086---665587566874011357999288899888778999


No 84 
>COG0641 AslB Arylsulfatase regulator (Fe-S oxidoreductase) [General function prediction only]
Probab=98.71  E-value=1.2e-05  Score=57.52  Aligned_cols=191  Identities=15%  Similarity=0.158  Sum_probs=114.4

Q ss_pred             EEEEC-CCC-CCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHC-CCEEEEEECCCCCCCCCCHHHHHHHHH---
Q ss_conf             64530-786-834232124335477756410006857999999999964-983899730368887442899999887---
Q gi|254780485|r   57 LLNIK-TGG-CPENCGYCNQSVHNKSKLKASKLINVDQVLKEAKNAKEN-GATRYCMGAAWREPKERDLSIIVDMIK---  130 (328)
Q Consensus        57 ~in~~-TN~-C~~~C~fCaf~~~~~~~~~~~~~~~~Eei~~~a~~~~~~-G~~~~~l~~~~~~~~~~~~~~~~e~i~---  130 (328)
                      ++-+. |+. |..+|.||-+..+.+.    ...++.|...+.++.+.+. +...+.+...|.+|..-..+.+-.++.   
T Consensus         8 ~~~~kpt~~~CNL~C~YC~~~~~~~~----~~~Ms~etle~~i~~~~~~~~~~~v~~~w~GGEPlL~~~~f~~~~~~l~~   83 (378)
T COG0641           8 HVMAKPTGFECNLDCKYCFYLEKESL----QRIMSDETLEEYVRQYIAASNGDKVTFTWQGGEPLLAGLDFYRKAVALQQ   83 (378)
T ss_pred             EEEECCCCCCCCCCCCEECCCCCCCC----CCCCCHHHHHHHHHHHHHCCCCCEEEEEEECCCCCCCHHHHHHHHHHHHH
T ss_conf             34546666766998885076177777----78789999999999999608987479999788640340879999999999


Q ss_pred             HHCCCCCCEE----EECCCCCHHHHHHHHCCCCCEEEEECCCCHHHHHCCC----CCCCHHHHHHHHHHHHHCCCCCCCE
Q ss_conf             6213688324----1025699999998741576069751343777732058----8889899999999999879855770
Q gi|254780485|r  131 GVKSLGLETC----MTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVT----TTHTFEDRLQTLENVRKSGIKVCCG  202 (328)
Q Consensus       131 ~i~~~~~~i~----~~~g~~~~~~~~~Lk~aG~~~~~~~let~~~~~~~~~----~~~~~~~~l~~~~~a~~~G~~~~sg  202 (328)
                      .-+. +..++    .|.-.++++-..-|++.++ .+.+.+|..++++.+.+    .+.|++.-++.++.+++.+++....
T Consensus        84 k~~~-~~~i~~siqTNg~LL~~e~~e~l~~~~~-~IgISiDGp~eihD~~R~~~~GkgTfd~i~~~i~~L~~~~v~~~~~  161 (378)
T COG0641          84 KYAN-GKTISNALQTNGTLLNDEWAEFLAEHDF-LIGISIDGPEEIHDKYRVTKSGKGTFDRVMKGLELLQAHGVDFNTL  161 (378)
T ss_pred             HHCC-CCCEEEEEEECCCCCCHHHHHHHHHCCC-EEEEECCCCHHHHCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEEE
T ss_conf             8605-8825789987603257999999985296-6999666817761110357899856999999999999758846999


Q ss_pred             EEECCCCCHHHHHHHHHHHHHCCCCCCEEECCCEEECCCCC--CCCCCCCCHHHHHH
Q ss_conf             78668989999999999997408888602054112048741--24456879899999
Q gi|254780485|r  203 GILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSK--FEENKKVDPIEHVR  257 (328)
Q Consensus       203 ~l~G~gEt~eeri~~l~~lr~l~~~~~~v~~~~~~p~~gt~--l~~~~~~~~~e~lr  257 (328)
                      +.+. -+...+..+....|.+.+.  ..+.+.+.++..++.  +. ....++.++-+
T Consensus       162 ~vv~-~~n~~~~~ei~~~l~~~g~--~~i~fip~~~~~~~~~~~~-~~~~~~~~~~~  214 (378)
T COG0641         162 TVVN-RQNVLHPEEIYHFLKSEGS--KFIQFIPLVESDNRGDSLL-EFSVTAEEYGQ  214 (378)
T ss_pred             EEEC-HHHHHCHHHHHHHHHHCCC--CEEEEEECCCCCCCCCCCC-CCCCCHHHHHH
T ss_conf             9976-4453079999999997376--6389885116888775322-12346667999


No 85 
>COG0731 Fe-S oxidoreductases [Energy production and conversion]
Probab=98.70  E-value=4.5e-06  Score=60.39  Aligned_cols=169  Identities=18%  Similarity=0.266  Sum_probs=106.0

Q ss_pred             ECCC-CCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHC------CCEEEEEECCCCCCCCCCHHHHHHHHHHH
Q ss_conf             3078-6834232124335477756410006857999999999964------98389973036888744289999988762
Q gi|254780485|r   60 IKTG-GCPENCGYCNQSVHNKSKLKASKLINVDQVLKEAKNAKEN------GATRYCMGAAWREPKERDLSIIVDMIKGV  132 (328)
Q Consensus        60 ~~TN-~C~~~C~fCaf~~~~~~~~~~~~~~~~Eei~~~a~~~~~~------G~~~~~l~~~~~~~~~~~~~~~~e~i~~i  132 (328)
                      +.+- .|..+|.||--....+....+-.....+.|.+..+.....      ...++-+++.|++...-.+   -++|+.+
T Consensus        28 tP~~~~Cs~~CvyC~~G~~~~~~~~~~efi~~~~I~~~~~~~~~~~g~ea~~pd~vtis~~GEPTLy~~L---~elI~~~  104 (296)
T COG0731          28 TPSKKWCSYNCVYCWRGRTKKGTPERPEFIVEESILEELKLLLGYKGDEATEPDHVTISLSGEPTLYPNL---GELIEEI  104 (296)
T ss_pred             CCCHHHHCCCCEEEECCCCCCCCCCCCCEECHHHHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCCH---HHHHHHH
T ss_conf             6606543577758966677777777872415899999999984225665678877999379883346488---9999999


Q ss_pred             CCCC--CCEEEECCCCCHHHHHHHHCCCCCEEEEECCC-CHHHHHCCCCC---CCHHHHHHHHHHHHHC--CCCCCCEEE
Q ss_conf             1368--83241025699999998741576069751343-77773205888---8989999999999987--985577078
Q gi|254780485|r  133 KSLG--LETCMTLGMLSFEQAQILSKAGLDYYNHNIDT-SERFYPHVTTT---HTFEDRLQTLENVRKS--GIKVCCGGI  204 (328)
Q Consensus       133 ~~~~--~~i~~~~g~~~~~~~~~Lk~aG~~~~~~~let-~~~~~~~~~~~---~~~~~~l~~~~~a~~~--G~~~~sg~l  204 (328)
                      ++.+  ....++.|.+ ++..+.|.  -+|.+...+++ .+..|.+++..   .+|+..++.++..++.  |-.+.=+|+
T Consensus       105 k~~g~~~tflvTNgsl-pdv~~~L~--~~dql~~sLdA~~~~~~~~InRP~~~~~~e~ile~L~~~~~~~~~~~vir~tl  181 (296)
T COG0731         105 KKRGKKTTFLVTNGSL-PDVLEELK--LPDQLYVSLDAPDEKTFRRINRPHKKDSWEKILEGLEIFRSEYKGRTVIRTTL  181 (296)
T ss_pred             HHCCCCEEEEEECCCH-HHHHHHHC--CCCEEEEEECCCCHHHHHHHCCCCCCCHHHHHHHHHHHHHHCCCCCEEEEEEE
T ss_conf             8607950899938976-99998740--58879998146888899983488874529999999997401278748999998


Q ss_pred             E-CCCCCHHHHHHHHHHHHHCCCCCCEEECCCE
Q ss_conf             6-6898999999999999740888860205411
Q gi|254780485|r  205 L-GLGEMIDDRIDMLLTLANLSTPPESIPINLL  236 (328)
Q Consensus       205 ~-G~gEt~eeri~~l~~lr~l~~~~~~v~~~~~  236 (328)
                      + |...+.++.-+....|+.+.  |+.|-++..
T Consensus       182 vkg~N~~~e~~~~~a~ll~~~~--Pd~velk~~  212 (296)
T COG0731         182 VKGINDDEEELEEYAELLERIN--PDFVELKTY  212 (296)
T ss_pred             ECCCCCCHHHHHHHHHHHHHCC--CCEEEEECC
T ss_conf             5264687088999999998539--976998347


No 86 
>TIGR02493 PFLA pyruvate formate-lyase 1-activating enzyme; InterPro: IPR012838    Members of this family are iron-sulphur proteins with a radical-SAM domain. A single glycine residue in 2.3.1.54 from EC, formate C-acetyltransferase (formate-pyruvate lyase), is oxidized to the corresponding radical by transfer of a proton from its CH2 to AdoMet with concomitant cleavage of the latter. The reaction requires Fe2+. The first stage is reduction of the AdoMet to give methionine and the 5'-deoxyadenosin-5-yl radical, which then abstracts a hydrogen radical from the glycine residue .; GO: 0043365 [formate-C-acetyltransferase]-activating enzyme activity.
Probab=98.68  E-value=4.2e-06  Score=60.58  Aligned_cols=193  Identities=22%  Similarity=0.331  Sum_probs=132.1

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCC-CC-CCCCHHHHHHHHHHHHH----C-CCEEEEEECCCCCCCCCCHHHHHHHHHHHCC
Q ss_conf             7868342321243354777564-10-00685799999999996----4-9838997303688874428999998876213
Q gi|254780485|r   62 TGGCPENCGYCNQSVHNKSKLK-AS-KLINVDQVLKEAKNAKE----N-GATRYCMGAAWREPKERDLSIIVDMIKGVKS  134 (328)
Q Consensus        62 TN~C~~~C~fCaf~~~~~~~~~-~~-~~~~~Eei~~~a~~~~~----~-G~~~~~l~~~~~~~~~~~~~~~~e~i~~i~~  134 (328)
                      =+.|..+|.||.-.   .+... .. +-.+.||+++++...+.    . |.-.   ++||++.  ...+.+.+.+++.|+
T Consensus        22 mqGC~lRC~YChNP---DTW~~~~~G~~~t~~el~~e~~~yk~f~~~sGGGvT---~SGGEPl--lQ~~F~~~~f~~cK~   93 (243)
T TIGR02493        22 MQGCPLRCQYCHNP---DTWDLKKGGTEVTVEELIKEVKSYKDFFKASGGGVT---VSGGEPL--LQPEFVLELFKACKK   93 (243)
T ss_pred             ECCHHHHHHHCCCC---CCCCCCCCCCEECHHHHHHHHHHHHHHHHCCCCCEE---EECCCCC--CCHHHHHHHHHHHHH
T ss_conf             43536775305898---743358878120789999999989988720799589---8689502--016999999999998


Q ss_pred             -CCCCEEE-ECC----CCC--HHHHHHHHCCCCCEEEEECCC-CHHHHHCCCCCCCHHHHHHHHHHHHHCCCCCCCE-EE
Q ss_conf             -6883241-025----699--999998741576069751343-7777320588889899999999999879855770-78
Q gi|254780485|r  135 -LGLETCM-TLG----MLS--FEQAQILSKAGLDYYNHNIDT-SERFYPHVTTTHTFEDRLQTLENVRKSGIKVCCG-GI  204 (328)
Q Consensus       135 -~~~~i~~-~~g----~~~--~~~~~~Lk~aG~~~~~~~let-~~~~~~~~~~~~~~~~~l~~~~~a~~~G~~~~sg-~l  204 (328)
                       .++|.|+ +.|    .+.  .+.+.+|-+. .|-+++.+.. .++.|.++-...+.+.-|+..+.+.+.|.|+-.= .+
T Consensus        94 ~~GiHTclDT~GGCftf~~~~~~~~~~lLe~-TDLvLLDiK~~~~~~y~~LTg~~~~~ptl~Fa~~L~~~~kP~WiRYVl  172 (243)
T TIGR02493        94 ELGIHTCLDTSGGCFTFLGGFTEAADELLEV-TDLVLLDIKHIDPEKYKKLTGVKSLEPTLEFAKYLAKRNKPIWIRYVL  172 (243)
T ss_pred             HCCCEEEEECCCCHHHHHCCHHHHHHHHHHC-CCEEEEECCCCCHHHCCCCCCCCCCHHHHHHHHHHHHCCCCEEEEEEE
T ss_conf             5698388744883433412124899975100-587886234368124000145677524589999999658988999986


Q ss_pred             E-CCCCCHHHHHHHHHHHHHCCCCCCEE---ECCCEEECC------CCCCCCCCCCCHHHHHHHHHHHH
Q ss_conf             6-68989999999999997408888602---054112048------74124456879899999999999
Q gi|254780485|r  205 L-GLGEMIDDRIDMLLTLANLSTPPESI---PINLLIPIP------GSKFEENKKVDPIEHVRIISVAR  263 (328)
Q Consensus       205 ~-G~gEt~eeri~~l~~lr~l~~~~~~v---~~~~~~p~~------gt~l~~~~~~~~~e~lr~iAi~R  263 (328)
                      + |.-+..||+-.....+..+...-+-|   |+.-+--++      .=+|++.++++.+..-++=-+.|
T Consensus       173 VPGyTD~~eDi~~l~~fv~~~~~averVe~LPYH~LG~~KWe~~g~~Y~L~~~~~p~~e~~~~~~~~~~  241 (243)
T TIGR02493       173 VPGYTDSEEDIEALAEFVKTLPNAVERVEVLPYHQLGVYKWEALGIEYKLEGVKPPNKEQLERIKEIFK  241 (243)
T ss_pred             CCCCCCCHHHHHHHHHHHHHCCCCEEEEEECCCCCCCCCHHHHCCCCCCCCCCCCCCHHHHHHHHHHHH
T ss_conf             588779989999999999746992799865688602110387668975888889879899999999973


No 87 
>TIGR01290 nifB nitrogenase cofactor biosynthesis protein NifB; InterPro: IPR005980    NifB is a protein required for the biosynthesis of the iron-molybdenum (or iron-vanadium) cofactor used by the nitrogen-fixing enzyme nitrogenase. Archaeal homologs lack most of the C-terminal region and are excluded from this model.; GO: 0009108 coenzyme biosynthetic process, 0009399 nitrogen fixation.
Probab=98.62  E-value=3.3e-06  Score=61.31  Aligned_cols=196  Identities=20%  Similarity=0.286  Sum_probs=133.1

Q ss_pred             EEEEEEECCCCCCCCCCCCC--CCCCCCC-CCCCCCCCCHHHHHHHHHHHHHCCCEEEEEEC-CCCCCCCCCHHHHHHHH
Q ss_conf             99864530786834232124--3354777-56410006857999999999964983899730-36888744289999988
Q gi|254780485|r   54 LSKLLNIKTGGCPENCGYCN--QSVHNKS-KLKASKLINVDQVLKEAKNAKENGATRYCMGA-AWREPKERDLSIIVDMI  129 (328)
Q Consensus        54 ~~~~in~~TN~C~~~C~fCa--f~~~~~~-~~~~~~~~~~Eei~~~a~~~~~~G~~~~~l~~-~~~~~~~~~~~~~~e~i  129 (328)
                      -+-++-+ --.|.-.|.||.  |-..|.+ +.-...+|++|+.+.+|+..... +..+..++ .|.+++......-...+
T Consensus        24 ARMH~AV-ApACNiQCNYCNRKyDC~NESRPGV~S~~LtP~qA~~k~~~VA~~-i~QLSVvGIAGPGDpLan~~~Tf~Tl  101 (461)
T TIGR01290        24 ARMHLAV-APACNIQCNYCNRKYDCANESRPGVVSELLTPEQALAKVKAVAAE-IPQLSVVGIAGPGDPLANIKKTFQTL  101 (461)
T ss_pred             HHCCCCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHH-CCCCEEEEECCCCCCCCCCCCCHHHH
T ss_conf             1113421-443345545568641667888876201346848999999999850-67531563257886245750008999


Q ss_pred             HHHCC--CCCCEEEE-CCCCCHHHHHHHHCCCCCEEEEECCC-CHHHHHCCCCCCCHH---------------HHHHHHH
Q ss_conf             76213--68832410-25699999998741576069751343-777732058888989---------------9999999
Q gi|254780485|r  130 KGVKS--LGLETCMT-LGMLSFEQAQILSKAGLDYYNHNIDT-SERFYPHVTTTHTFE---------------DRLQTLE  190 (328)
Q Consensus       130 ~~i~~--~~~~i~~~-~g~~~~~~~~~Lk~aG~~~~~~~let-~~~~~~~~~~~~~~~---------------~~l~~~~  190 (328)
                      ..++.  .++.+|+| .|..-.+..-+|.+.|+|.+.+=+.. .|+...+|=|+..|+               +=++-++
T Consensus       102 ~~v~~~~PDvklCLSTNGL~LP~~vDrlvdlgvdHVTiTiN~iDP~vG~~IYpWv~y~G~RY~Gr~Aa~lL~erQl~G~~  181 (461)
T TIGR01290       102 ELVAREVPDVKLCLSTNGLALPEHVDRLVDLGVDHVTITINAIDPEVGEKIYPWVAYEGKRYTGREAAKLLIERQLEGLE  181 (461)
T ss_pred             HHHHHHCCCEEEECCCCCCCCHHHHHHHHHCCCCCEEEEECCCCHHHHCEECCCEEECCCCCCHHHHHHHHHHHHHHHHH
T ss_conf             99985178214200126563134652464238881798831406355103065233267333548999998999999999


Q ss_pred             HHHHCCC--CCCCEEEECCCCCHHHHHHHHHHHHHCCCCCCEEECCCEEECC--CCCCCC--CCCCCHHHH
Q ss_conf             9998798--5577078668989999999999997408888602054112048--741244--568798999
Q gi|254780485|r  191 NVRKSGI--KVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIP--GSKFEE--NKKVDPIEH  255 (328)
Q Consensus       191 ~a~~~G~--~~~sg~l~G~gEt~eeri~~l~~lr~l~~~~~~v~~~~~~p~~--gt~l~~--~~~~~~~e~  255 (328)
                      .+-|-|+  |++|=||=|.  ..+|.++.-...++++.+=|=|  +||+..|  ||-+.-  ...|++.|.
T Consensus       182 ~L~ergiL~KvNSvlIPGi--ND~HL~eVsk~vk~~GAfLHNv--mPLis~PeHGt~ygl~Gq~~P~~~el  248 (461)
T TIGR01290       182 KLTERGILVKVNSVLIPGI--NDEHLVEVSKKVKELGAFLHNV--MPLISAPEHGTVYGLNGQRAPAPSEL  248 (461)
T ss_pred             HHHHCCCEEEECCEECCCC--CCHHHHHHHHHHHCCCCHHCCC--CCCEECCCCCCCCCCCCCCCCCHHHH
T ss_conf             9973885488800643898--8178999877751046400054--42101489883116787888898999


No 88 
>KOG4355 consensus
Probab=98.52  E-value=9.8e-06  Score=58.11  Aligned_cols=210  Identities=20%  Similarity=0.328  Sum_probs=117.3

Q ss_pred             EEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCCCC----HHHHH-HH
Q ss_conf             99864530786834232124335477756410006857999999999964983899730368887442----89999-98
Q gi|254780485|r   54 LSKLLNIKTGGCPENCGYCNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERD----LSIIV-DM  128 (328)
Q Consensus        54 ~~~~in~~TN~C~~~C~fCaf~~~~~~~~~~~~~~~~Eei~~~a~~~~~~G~~~~~l~~~~~~~~~~~----~~~~~-e~  128 (328)
                      +-.++.||| .|-+.|.||- ++|.+....-   .+.+++++.++...+.|..++-+.+-.-....++    .-.++ ..
T Consensus       187 lieIi~int-gclgaCtyck-Tkharg~l~s---y~~dslvervrt~f~egv~eIwltsedTgaygrdig~slp~ll~kl  261 (547)
T KOG4355         187 LIEIISINT-GCLGACTYCK-TKHARGLLAS---YPKDSLVERVRTSFEEGVCEIWLTSEDTGAYGRDIGKSLPKLLWKL  261 (547)
T ss_pred             CEEEEEECC-CCCCCCCCCC-CCCCCCCCCC---CCHHHHHHHHHHHHHCCCEEEEECCCCCCHHHHHHHHHHHHHHHHH
T ss_conf             658999624-5541115556-5012433254---7889999999998851747998124543035544300069999999


Q ss_pred             HHHHCCC-CCCEEEECCCCCHHHHH----HHHCCCCCEEEEE-CCC-CHHHHHCCCCCCCHHHHHHHHHHHHHC--CCCC
Q ss_conf             8762136-88324102569999999----8741576069751-343-777732058888989999999999987--9855
Q gi|254780485|r  129 IKGVKSL-GLETCMTLGMLSFEQAQ----ILSKAGLDYYNHN-IDT-SERFYPHVTTTHTFEDRLQTLENVRKS--GIKV  199 (328)
Q Consensus       129 i~~i~~~-~~~i~~~~g~~~~~~~~----~Lk~aG~~~~~~~-let-~~~~~~~~~~~~~~~~~l~~~~~a~~~--G~~~  199 (328)
                      ++.|.+. .+.+.+..-+.--+++.    .|+---+-++.+. ..+ +....-.........+.-.+.+.+.+.  |+.+
T Consensus       262 v~~iPe~cmlr~gmTnpP~ilehl~e~a~vlrhp~vYsflhvpvqsgsdsvl~emkreyc~~dfk~Vvd~LterVPgi~I  341 (547)
T KOG4355         262 VEVIPESCMLRAGMTNPPYILEHLEEAAFVLRHPRVYSFLHVPVQSGSDSVLTEMKREYCNFDFKIVVDFLTERVPGITI  341 (547)
T ss_pred             HHHCCHHHHHHHCCCCCCHHHHHHHHHHHHHCCCEEEEEEECCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEE
T ss_conf             98653666443158788159988999998764870799983243357436888877787645678899888754798188


Q ss_pred             CCEEEECC-CCCHHHHHHHHHHHHHCCCCCCEEECCCEEECCCCCCCCCCCCCHHHH-HHHHHHHHHHC---CCCC
Q ss_conf             77078668-989999999999997408888602054112048741244568798999-99999999968---6872
Q gi|254780485|r  200 CCGGILGL-GEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEH-VRIISVARILM---PKSR  270 (328)
Q Consensus       200 ~sg~l~G~-gEt~eeri~~l~~lr~l~~~~~~v~~~~~~p~~gt~l~~~~~~~~~e~-lr~iAi~RL~l---P~~~  270 (328)
                      -+-||.|. +||.+|.-+.+..+++.. +| ++.+|-|.|.||||-+........+. -|+-++++++-   |.+.
T Consensus       342 ATDiIcgFPtETdeDFeeTmeLv~kYK-FP-slfInQfyPRpGTPAAkmkki~a~~vkkRTk~ls~lF~sy~pYtd  415 (547)
T KOG4355         342 ATDIICGFPTETDEDFEETMELVRKYK-FP-SLFINQFYPRPGTPAAKMKKIPAVEVKKRTKALSELFRSYTPYTD  415 (547)
T ss_pred             EEEEEECCCCCCHHHHHHHHHHHHHCC-CC-HHHHHHCCCCCCCHHHHHHCCCHHHHHHHHHHHHHHHHHCCCCCC
T ss_conf             621242488871677999999999716-85-403530479998817865224379999888999999874187655


No 89 
>PRK11194 hypothetical protein; Provisional
Probab=98.52  E-value=3.3e-05  Score=54.59  Aligned_cols=223  Identities=14%  Similarity=0.201  Sum_probs=125.6

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHH-------CC---CEEEEEECCCCCCCCCCHHHHHHHHHHHC
Q ss_conf             683423212433547775641000685799999999996-------49---83899730368887442899999887621
Q gi|254780485|r   64 GCPENCGYCNQSVHNKSKLKASKLINVDQVLKEAKNAKE-------NG---ATRYCMGAAWREPKERDLSIIVDMIKGVK  133 (328)
Q Consensus        64 ~C~~~C~fCaf~~~~~~~~~~~~~~~~Eei~~~a~~~~~-------~G---~~~~~l~~~~~~~~~~~~~~~~e~i~~i~  133 (328)
                      .|..+|.||+=.   +.+..  +-++..||+..+-.+..       .|   ++.+++.+.|++..  -++.+...++.+.
T Consensus       112 GC~m~C~FCaTG---~~Gl~--RNLt~~EIv~Qv~~~~~~l~~~~~~~~~~i~NiVfMGMGEPL~--NydnV~~ai~il~  184 (372)
T PRK11194        112 GCALECKFCSTA---QQGFN--RNLRVSEIIGQVWRAAKIIGAAKVTGQRPITNVVMMGMGEPLL--NLNNVVPAMEIML  184 (372)
T ss_pred             CCCCCCCCCCCC---CCHHH--CCCCHHHHHHHHHHHHHHHHHCCCCCCCCCCEEEEECCCCHHH--HHHHHHHHHHHHC
T ss_conf             636899844588---64430--4878899999999999985320123666532167843784255--3999999999864


Q ss_pred             CC-CC-----CEEEE-CCCCCHHHHHHHHCCCCCEEEEECCC-CHHHHHCCCC---CCCHHHHHHHHHHHH-HCCC---C
Q ss_conf             36-88-----32410-25699999998741576069751343-7777320588---889899999999999-8798---5
Q gi|254780485|r  134 SL-GL-----ETCMT-LGMLSFEQAQILSKAGLDYYNHNIDT-SERFYPHVTT---THTFEDRLQTLENVR-KSGI---K  198 (328)
Q Consensus       134 ~~-~~-----~i~~~-~g~~~~~~~~~Lk~aG~~~~~~~let-~~~~~~~~~~---~~~~~~~l~~~~~a~-~~G~---~  198 (328)
                      +. +.     .|.+| .|....  +.+|.+.---...+.|-+ ..+++.++.|   +.+.++-++.++.-- +.+-   +
T Consensus       185 ~~~g~~~s~R~ITvST~Givp~--I~~l~e~~~v~LAiSLHA~~de~R~~lmPin~~ypl~~L~~a~~~y~~~t~~~~~r  262 (372)
T PRK11194        185 DDFGFGLSKRRVTLSTSGVVPA--LDKLGDMIDVALAISLHAPNDELRDEIVPINKKYNIETFLAAVRRYLEKSNANQGR  262 (372)
T ss_pred             CCCCCCCCCCEEEEECCCCCHH--HHHHHHHCCCCEEEEECCCCHHHHHHHHCHHCCCCHHHHHHHHHHHHHHHCCCCCE
T ss_conf             8546677778589977787269--99998631565698715898688987711031589899999999999970678852


Q ss_pred             C--CCEEEECCCCCHHHHHHHHHHHHHCCCCCCEEECCCEEECCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCEEEEH
Q ss_conf             5--77078668989999999999997408888602054112048741244568798999999999999686872142311
Q gi|254780485|r  199 V--CCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEHVRIISVARILMPKSRLRLAAG  276 (328)
Q Consensus       199 ~--~sg~l~G~gEt~eeri~~l~~lr~l~~~~~~v~~~~~~p~~gt~l~~~~~~~~~e~lr~iAi~RL~lP~~~i~i~~~  276 (328)
                      +  --.+|=|..++.+|.-+....++.+..   .|-+-+|.|++|+++..   ++.....+...+.+    +..|..+- 
T Consensus       263 vt~EYvLi~gvNDs~e~A~~L~~llk~~~~---~VNLIp~Np~~~~~~~~---p~~~~i~~F~~~L~----~~gi~vtv-  331 (372)
T PRK11194        263 VTVEYVMLDHVNDSTEHAHQLAELLKDTPC---KINLIPWNPFPGAPYGR---SSNSRIDRFSKVLM----EYGFTVIV-  331 (372)
T ss_pred             EEEEEEEECCCCCCHHHHHHHHHHHCCCCC---CEEEECCCCCCCCCCCC---CCHHHHHHHHHHHH----HCCCCEEE-
T ss_conf             899999836878999999999999759986---07745689989988879---99999999999999----78991797-


Q ss_pred             HHHHCHHHHHHHHHHCCCEEEECCEEECCCCCCHHHHHHH
Q ss_conf             5651656899999809988997786651588898999999
Q gi|254780485|r  277 RAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTIL  316 (328)
Q Consensus       277 ~~~~~~~~~~~~L~~GaN~~~~g~~~~t~~g~~~~~~~~~  316 (328)
                      |.+.|.|.     .| |=|.+.|+++    +++...+++-
T Consensus       332 R~s~G~DI-----~A-ACGQLa~~~~----~~~~~~~~~~  361 (372)
T PRK11194        332 RKTRGDDI-----DA-ACGQLAGDVI----DRTKRTLKKR  361 (372)
T ss_pred             ECCCCCCH-----HH-HHHCCHHHHH----CCCHHHHHHH
T ss_conf             58998533-----35-4042625452----6005889988


No 90 
>COG1031 Uncharacterized Fe-S oxidoreductase [Energy production and conversion]
Probab=98.49  E-value=7.3e-05  Score=52.27  Aligned_cols=201  Identities=17%  Similarity=0.273  Sum_probs=113.7

Q ss_pred             HHHHHHHHHCCCCEEEEEEEEEEC-CCCCCCC----CCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCEEEEEEC
Q ss_conf             999998886289856999864530-7868342----32124335477756410006857999999999964983899730
Q gi|254780485|r   38 WSHTVHRKNFEPNHIQLSKLLNIK-TGGCPEN----CGYCNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGA  112 (328)
Q Consensus        38 ~Aa~~~r~~~~g~~V~~~~~in~~-TN~C~~~----C~fCaf~~~~~~~~~~~~~~~~Eei~~~a~~~~~~G~~~~~l~~  112 (328)
                      .-|.+.+++ ++-.-++  ++.+- +-.|...    |+||.=-..   +..  ...+.|.|+++++..++.|+++|-++-
T Consensus       168 ~GA~vv~qH-P~yp~~v--i~EiETyRGC~r~~~ggCSFCtEp~~---g~~--~~R~~e~Vv~EVkaLY~~GvrhFRlGR  239 (560)
T COG1031         168 LGAEVVKQH-PNYPEYV--ICEIETYRGCPRRVSGGCSFCTEPVR---GRP--EFRPPEDVVEEVKALYRAGVRHFRLGR  239 (560)
T ss_pred             CCCHHHHHC-CCCCCEE--EEEEEECCCCCCCCCCCCCCCCCCCC---CCC--CCCCHHHHHHHHHHHHHHCCCEEEECC
T ss_conf             433587738-8995307--99985136873203688754167576---884--658989999999999970603056156


Q ss_pred             CC-----------C-CCCCCCHHHHHHHHHHHCCCCCCE---E---EECCCC------CHHHHHHHHCC--CCCEEEEEC
Q ss_conf             36-----------8-887442899999887621368832---4---102569------99999987415--760697513
Q gi|254780485|r  113 AW-----------R-EPKERDLSIIVDMIKGVKSLGLET---C---MTLGML------SFEQAQILSKA--GLDYYNHNI  166 (328)
Q Consensus       113 ~~-----------~-~~~~~~~~~~~e~i~~i~~~~~~i---~---~~~g~~------~~~~~~~Lk~a--G~~~~~~~l  166 (328)
                      ..           . -|.+ ..+-+.+.++.|++.-+.+   |   +|++.+      +++.++.+.+-  .-+-....+
T Consensus       240 Q~difsy~~~~~g~e~P~P-nPealekL~~Gir~~AP~l~tLHiDNaNP~tIa~yp~eSr~i~K~ivky~TpGnVaAfGl  318 (560)
T COG1031         240 QADIFSYGADDNGGEVPRP-NPEALEKLFRGIRNVAPNLKTLHIDNANPATIARYPEESREIAKVIVKYGTPGNVAAFGL  318 (560)
T ss_pred             CCCEEEECCCCCCCCCCCC-CHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHCCHHHHHHHHHHHHHHCCCCCEEEEEC
T ss_conf             5410112156568879999-989999999999861898726654589956441584889999999986479875543304


Q ss_pred             CCC-HHHHHCCCCCCCHHHHHHHHHHHHHCCC-------C---CCCEEEECC-CCCHHHHHHHHHHHHHCCCCCCEE---
Q ss_conf             437-7773205888898999999999998798-------5---577078668-989999999999997408888602---
Q gi|254780485|r  167 DTS-ERFYPHVTTTHTFEDRLQTLENVRKSGI-------K---VCCGGILGL-GEMIDDRIDMLLTLANLSTPPESI---  231 (328)
Q Consensus       167 et~-~~~~~~~~~~~~~~~~l~~~~~a~~~G~-------~---~~sg~l~G~-gEt~eeri~~l~~lr~l~~~~~~v---  231 (328)
                      ||+ |...++-.-..|.++-++.++..-+.|-       +   -+..+++|+ |||.|----.-..|+++-...-.+   
T Consensus       319 EsaDp~V~r~NnL~~spEEvl~AV~ivn~vG~~rg~nGlP~lLPGINfv~GL~GEtkeT~~ln~efL~~ild~gllvRRI  398 (560)
T COG1031         319 ESADPRVARKNNLNASPEEVLEAVEIVNEVGGGRGYNGLPYLLPGINFVFGLPGETKETYELNYEFLKEILDEGLLVRRI  398 (560)
T ss_pred             CCCCHHHHHHCCCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCEEEECCCCCCHHHHHHHHHHHHHHHHCCCEEEEE
T ss_conf             54687787640566998999999999998647667689842046620673388762777886499999997467468985


Q ss_pred             ECCCEEECCCCCCCCC
Q ss_conf             0541120487412445
Q gi|254780485|r  232 PINLLIPIPGSKFEEN  247 (328)
Q Consensus       232 ~~~~~~p~~gt~l~~~  247 (328)
                      -+--..+.|||||...
T Consensus       399 NIRqV~~fpgT~~~~~  414 (560)
T COG1031         399 NIRQVVVFPGTPMWER  414 (560)
T ss_pred             EEEEEEECCCCCHHHH
T ss_conf             2036763279724665


No 91 
>PRK08195 4-hydroxy-2-ketovalerate aldolase; Validated
Probab=98.45  E-value=0.0002  Score=49.26  Aligned_cols=214  Identities=14%  Similarity=0.114  Sum_probs=139.7

Q ss_pred             CCCCHHHHHHHHHHHHHCCCEEEEEECCC---------CCCCCCCHHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHC
Q ss_conf             00685799999999996498389973036---------888744289999988762136883241025699999998741
Q gi|254780485|r   86 KLINVDQVLKEAKNAKENGATRYCMGAAW---------REPKERDLSIIVDMIKGVKSLGLETCMTLGMLSFEQAQILSK  156 (328)
Q Consensus        86 ~~~~~Eei~~~a~~~~~~G~~~~~l~~~~---------~~~~~~~~~~~~e~i~~i~~~~~~i~~~~g~~~~~~~~~Lk~  156 (328)
                      ..++.|++++.++.+.+.|+..+-++-+.         ..+...+.+++..+...++...+...+.+|.-+.+.++.-++
T Consensus        20 ~~fs~e~k~~ia~~Ld~aGVd~IEVghg~gl~~ss~~~g~~~~~d~e~i~~~~~~~~~aki~~l~~pg~~~~~dl~~A~~   99 (337)
T PRK08195         20 HQYTLEQVRAIARALDAAGVPVIEVTHGDGLGGSSFNYGFGAHTDEEYIEAAADVVKQAKLATLLLPGIGTIEDLKMAYD   99 (337)
T ss_pred             CCCCHHHHHHHHHHHHHCCCCEEEECCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCEEEEEECCCCCCHHHHHHHHH
T ss_conf             98899999999999998098999944788877753346787798399999999974328378996356555888999995


Q ss_pred             CCCCEEEEECCCCHHHHHCCCCCCCHHHHHHHHHHHHHCCCCCCCEEEECCCCCHHHHHHHHHHHHHCCCCCCEEECCCE
Q ss_conf             57606975134377773205888898999999999998798557707866898999999999999740888860205411
Q gi|254780485|r  157 AGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLL  236 (328)
Q Consensus       157 aG~~~~~~~let~~~~~~~~~~~~~~~~~l~~~~~a~~~G~~~~sg~l~G~gEt~eeri~~l~~lr~l~~~~~~v~~~~~  236 (328)
                      .|++.+.+.....+           .+-..+.++.|+++|+.+....|..+--++++.++....+.+.+.  +.|.    
T Consensus       100 ~gv~~vria~~~te-----------ad~~~~~i~~ar~~G~~v~~~lm~s~~~~~e~l~~~a~~~~~~Ga--d~I~----  162 (337)
T PRK08195        100 AGVRVVRVATHCTE-----------ADVSEQHIGLARELGMDTVGFLMMSHMASPEKLAEQAKLMESYGA--QCVY----  162 (337)
T ss_pred             CCCCEEEEEEECCH-----------HHHHHHHHHHHHHCCCEEEEEEHHCCCCCHHHHHHHHHHHHHCCC--CEEE----
T ss_conf             79897999863148-----------877999999999779939997511024899999999999986599--9999----


Q ss_pred             EECCCCCCCCCCCCCHHHHHHHHHHHHHHC-CCCCCEEEEHHHHHCH--HHHHHHHHHCCC---EEE--ECCEEECCCCC
Q ss_conf             204874124456879899999999999968-6872142311565165--689999980998---899--77866515888
Q gi|254780485|r  237 IPIPGSKFEENKKVDPIEHVRIISVARILM-PKSRLRLAAGRAMMSD--ELQALCFFSGAN---SIF--VGDTLLTAKNP  308 (328)
Q Consensus       237 ~p~~gt~l~~~~~~~~~e~lr~iAi~RL~l-P~~~i~i~~~~~~~~~--~~~~~~L~~GaN---~~~--~g~~~~t~~g~  308 (328)
                        ..+|    .....|.+..+.+...|=.+ |+..+-+-+ -.++|-  -..-.|+.+||+   +++  +|+   -++|.
T Consensus       163 --l~DT----~G~~~P~~v~~~v~~l~~~l~~~i~igfH~-HNnlGlAvANslaAveaGA~~ID~Ti~GlGe---gAGNa  232 (337)
T PRK08195        163 --VVDS----AGALLPDDVRARVRALRAALKPDTQVGFHG-HHNLGLGVANSLAAVEAGADRIDASLAGFGA---GAGNA  232 (337)
T ss_pred             --ECCC----CCCCCHHHHHHHHHHHHHHCCCCCEEEEEE-CCCCCHHHHHHHHHHHCCCCEEEEECCCCCC---CCCCH
T ss_conf             --7898----766799999999999998649985499985-3886759999999998099999850534488---87873


Q ss_pred             CHHHHHHHHHHCCCCCCC
Q ss_conf             989999999982985324
Q gi|254780485|r  309 SYNKDTILFNRLGLIPDL  326 (328)
Q Consensus       309 ~~~~~~~~i~~~G~~P~~  326 (328)
                      +.|..+..++++|+.+-.
T Consensus       233 ~lE~lva~l~r~g~~~g~  250 (337)
T PRK08195        233 PLEVLVAVLDRMGWETGV  250 (337)
T ss_pred             HHHHHHHHHHHCCCCCCC
T ss_conf             899999999746986587


No 92 
>PRK13745 anaerobic sulfatase-maturase; Provisional
Probab=98.44  E-value=3.4e-05  Score=54.44  Aligned_cols=162  Identities=14%  Similarity=0.138  Sum_probs=99.7

Q ss_pred             CCCCCCCCCCCCCCCCCCC-CCCCCCCCCHHHHHHHHHHHHH-CCCEEEEEECCCCCCCCCCHHHHHHHHHHHCCC--CC
Q ss_conf             7868342321243354777-5641000685799999999996-498389973036888744289999988762136--88
Q gi|254780485|r   62 TGGCPENCGYCNQSVHNKS-KLKASKLINVDQVLKEAKNAKE-NGATRYCMGAAWREPKERDLSIIVDMIKGVKSL--GL  137 (328)
Q Consensus        62 TN~C~~~C~fCaf~~~~~~-~~~~~~~~~~Eei~~~a~~~~~-~G~~~~~l~~~~~~~~~~~~~~~~e~i~~i~~~--~~  137 (328)
                      |-.|..+|.||-+...... .......++.|.+...++...+ ....++.+...|++|....++++..+++..+..  +.
T Consensus        21 s~~CNL~C~YCyy~~~~~~~~~~~~~~Ms~e~l~~~I~~~~~~~~~~~v~f~~~GGEPlL~gl~f~~~~v~l~~~~~~g~  100 (412)
T PRK13745         21 GAVCNLACDYCYYLEKSKLYQENPKHVMSDELLEKFIKEYINSQTMPQVLFTWHGGETLMRPLSFYKKAMELQKKYARGR  100 (412)
T ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCCEEEEEEECCCCCCCCHHHHHHHHHHHHHHCCCC
T ss_conf             58758899867881614356567757898999999999999648998589998685445654789999999999853898


Q ss_pred             C----EEEECCCCCHHHHHHHHCCCCCEEEEECCCCHHHHHCCCC----CCCHHHHHHHHHHHHHCCCCCCCEEEECC--
Q ss_conf             3----2410256999999987415760697513437777320588----88989999999999987985577078668--
Q gi|254780485|r  138 E----TCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTT----THTFEDRLQTLENVRKSGIKVCCGGILGL--  207 (328)
Q Consensus       138 ~----i~~~~g~~~~~~~~~Lk~aG~~~~~~~let~~~~~~~~~~----~~~~~~~l~~~~~a~~~G~~~~sg~l~G~--  207 (328)
                      .    +..|.-.++++..+-|++.++ .+.+.+|-.++++...++    +.|++.-++.++.+++.|+..+.=..+--  
T Consensus       101 ~i~~siQTNGtLL~dew~~ff~~~~f-~VgiSiDGp~~~HD~~R~~~~G~gs~~~v~~~i~lL~~~~v~fn~L~vv~~~n  179 (412)
T PRK13745        101 TIDNCIQTNGTLLTDEWCEFFRENNW-LVGVSIDGPQEFHDEYRKNKMGKPSFVKVMKGINLLKKHGVEWNAMAVVNDFN  179 (412)
T ss_pred             EEEEEEEECCEECCHHHHHHHHHCCC-EEEEECCCCHHHHHHCCCCCCCCCHHHHHHHHHHHHHHCCCCEEEEEEEECHH
T ss_conf             46899987787549999999998596-79996258878874027988998779999999999998499646999981115


Q ss_pred             CCCHHHHHHHHHHHHHCCCC
Q ss_conf             98999999999999740888
Q gi|254780485|r  208 GEMIDDRIDMLLTLANLSTP  227 (328)
Q Consensus       208 gEt~eeri~~l~~lr~l~~~  227 (328)
                      .+..+++.   ..+++++.+
T Consensus       180 ~~~p~~iY---~f~k~lg~~  196 (412)
T PRK13745        180 ADYPLDFY---NFFKELDCH  196 (412)
T ss_pred             HHCHHHHH---HHHHHCCCC
T ss_conf             45889999---999975996


No 93 
>TIGR03217 4OH_2_O_val_ald 4-hydroxy-2-oxovalerate aldolase. Members of this protein family are 4-hydroxy-2-oxovalerate aldolase, also called 4-hydroxy-2-ketovalerate aldolase and 2-oxo-4-hydroxypentanoate aldolase. This enzyme, part of the pathway for the meta-cleavage of catechol, produces pyruvate and acetaldehyde. Acetaldehyde is then converted by acetaldehyde dehydrogenase (acylating) (DmpF; EC 1.2.1.10) to acetyl-CoA. The two enzymes are tightly associated.
Probab=98.42  E-value=0.00024  Score=48.83  Aligned_cols=213  Identities=15%  Similarity=0.125  Sum_probs=142.7

Q ss_pred             CCCCHHHHHHHHHHHHHCCCEEEEEECCC---------CCCCCCCHHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHC
Q ss_conf             00685799999999996498389973036---------888744289999988762136883241025699999998741
Q gi|254780485|r   86 KLINVDQVLKEAKNAKENGATRYCMGAAW---------REPKERDLSIIVDMIKGVKSLGLETCMTLGMLSFEQAQILSK  156 (328)
Q Consensus        86 ~~~~~Eei~~~a~~~~~~G~~~~~l~~~~---------~~~~~~~~~~~~e~i~~i~~~~~~i~~~~g~~~~~~~~~Lk~  156 (328)
                      ..++.|++++.++.+.+.|+..+-+..+.         ..+...+.+++..+...++........-+|..+.+.++...+
T Consensus        19 ~~fs~e~k~~ia~~Ld~aGVd~IEvg~g~g~~~ss~~~g~~~~~d~e~i~~~~~~~~~ak~~~l~~pg~~~~~dl~~a~~   98 (333)
T TIGR03217        19 HQFTIEQVRAIAAALDEAGVDAIEVTHGDGLGGSSFNYGFSAHTDLEYIEAAADVVKRAKVAVLLLPGIGTVHDLKAAYD   98 (333)
T ss_pred             CCCCHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCHHHHHHHHHHHCCCCEEEEECCCCCCHHHHHHHHH
T ss_conf             99899999999999997198989960688888874335788899499999999874248056996478666999999996


Q ss_pred             CCCCEEEEECCCCHHHHHCCCCCCCHHHHHHHHHHHHHCCCCCCCEEEECCCCCHHHHHHHHHHHHHCCCCCCEEECCCE
Q ss_conf             57606975134377773205888898999999999998798557707866898999999999999740888860205411
Q gi|254780485|r  157 AGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLL  236 (328)
Q Consensus       157 aG~~~~~~~let~~~~~~~~~~~~~~~~~l~~~~~a~~~G~~~~sg~l~G~gEt~eeri~~l~~lr~l~~~~~~v~~~~~  236 (328)
                      .|++.+.+.....+.           +--.+.++.|+++|+.+....+..+.-+++..++....+.+.+.  +.|.    
T Consensus        99 ~gv~~vri~~~~te~-----------d~~~~~i~~ak~~G~~v~~~~~~s~~~~~e~l~~~a~~~~~~Ga--d~I~----  161 (333)
T TIGR03217        99 AGARTVRVATHCTEA-----------DVSEQHIGMARELGMDTVGFLMMSHMTPPEKLAEQAKLMESYGA--DCVY----  161 (333)
T ss_pred             CCCCEEEEEECCCHH-----------HHHHHHHHHHHHCCCEEEEEEEECCCCCHHHHHHHHHHHHHCCC--CEEE----
T ss_conf             699978986316678-----------88999999999769809999750568999999999999985699--9999----


Q ss_pred             EECCCCCCCCCCCCCHHHHHHHHHHHHHHC-CCCCCEEEEHHHHHC--HHHHHHHHHHCCC---EEE--ECCEEECCCCC
Q ss_conf             204874124456879899999999999968-687214231156516--5689999980998---899--77866515888
Q gi|254780485|r  237 IPIPGSKFEENKKVDPIEHVRIISVARILM-PKSRLRLAAGRAMMS--DELQALCFFSGAN---SIF--VGDTLLTAKNP  308 (328)
Q Consensus       237 ~p~~gt~l~~~~~~~~~e~lr~iAi~RL~l-P~~~i~i~~~~~~~~--~~~~~~~L~~GaN---~~~--~g~~~~t~~g~  308 (328)
                        ..+|    .....|.+.-+.+...|=.+ |+..+-+=+ =.++|  .-....|+.+||+   +++  +|+   .+++.
T Consensus       162 --i~DT----~G~~~P~~v~~~v~~l~~~~~~~i~ig~H~-HNnlGlAvANslaAi~aGa~~VD~Ti~GlGe---~aGNa  231 (333)
T TIGR03217       162 --IVDS----AGAMLPDDVRDRVRALKAVLKPETQVGFHA-HHNLSLAVANSIAAIEAGATRIDASLRGLGA---GAGNA  231 (333)
T ss_pred             --ECCC----CCCCCHHHHHHHHHHHHHHCCCCCEEEEEE-ECCCCHHHHHHHHHHHCCCCEEEECCCCCCC---CCCCC
T ss_conf             --7596----446899999999999998629975488986-1787729999999998199999762744889---88873


Q ss_pred             CHHHHHHHHHHCCCCCC
Q ss_conf             98999999998298532
Q gi|254780485|r  309 SYNKDTILFNRLGLIPD  325 (328)
Q Consensus       309 ~~~~~~~~i~~~G~~P~  325 (328)
                      +.|..+.++++.|+..-
T Consensus       232 ~lE~lVa~l~~~g~~tg  248 (333)
T TIGR03217       232 PLEVFVAVLDRLGWNTG  248 (333)
T ss_pred             HHHHHHHHHHCCCCCCC
T ss_conf             49999999961798658


No 94 
>COG1509 KamA Lysine 2,3-aminomutase [Amino acid transport and metabolism]
Probab=98.42  E-value=0.00013  Score=50.54  Aligned_cols=193  Identities=13%  Similarity=0.160  Sum_probs=109.1

Q ss_pred             EEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCC-CEEEEEECCCCCCCCC--CHHHHHHHHHHHC
Q ss_conf             645307868342321243354777564100068579999999999649-8389973036888744--2899999887621
Q gi|254780485|r   57 LLNIKTGGCPENCGYCNQSVHNKSKLKASKLINVDQVLKEAKNAKENG-ATRYCMGAAWREPKER--DLSIIVDMIKGVK  133 (328)
Q Consensus        57 ~in~~TN~C~~~C~fCaf~~~~~~~~~~~~~~~~Eei~~~a~~~~~~G-~~~~~l~~~~~~~~~~--~~~~~~e~i~~i~  133 (328)
                      .+.+ |+.|..+|+|| |+++.-......  ++.+++......+.+.. +.++ +.+||.+...+  .+++++..++.|.
T Consensus       114 Lll~-t~~C~vyCRyC-fRr~~~~~~~~~--~~~~~~~~al~YIa~hPeI~eV-llSGGDPL~ls~~~L~~ll~~L~~Ip  188 (369)
T COG1509         114 LLLV-TGVCAVYCRYC-FRRRFVGQDNQG--FNKEEWDKALDYIAAHPEIREV-LLSGGDPLSLSDKKLEWLLKRLRAIP  188 (369)
T ss_pred             EEEE-CCCCCCEEEEC-CCCCCCCCCCCC--CCHHHHHHHHHHHHCCCHHHEE-EECCCCCCCCCHHHHHHHHHHHHCCC
T ss_conf             9996-48664521000-134555666566--7889999999999739516517-74078756368899999999875489


Q ss_pred             CC-CCCEE-----EECCCCCHHHHHHHHCCCCCEEEE-ECCCCHHHHHCCCCCCCHHHHHHHHHHHHHCCCCC-CCEE-E
Q ss_conf             36-88324-----102569999999874157606975-13437777320588889899999999999879855-7707-8
Q gi|254780485|r  134 SL-GLETC-----MTLGMLSFEQAQILSKAGLDYYNH-NIDTSERFYPHVTTTHTFEDRLQTLENVRKSGIKV-CCGG-I  204 (328)
Q Consensus       134 ~~-~~~i~-----~~~g~~~~~~~~~Lk~aG~~~~~~-~let~~~~~~~~~~~~~~~~~l~~~~~a~~~G~~~-~sg~-l  204 (328)
                      .. .+.++     +.+.-.+.+-...|++.+...+.. -+....++         ..+-.++++..+.+|+.+ +-+. +
T Consensus       189 Hv~iiRi~TR~pvv~P~RIt~~L~~~l~~~~~~v~~~tH~NHp~Ei---------t~e~~~A~~~L~~aGv~l~NQsVLL  259 (369)
T COG1509         189 HVKIIRIGTRLPVVLPQRITDELCEILGKSRKPVWLVTHFNHPNEI---------TPEAREACAKLRDAGVPLLNQSVLL  259 (369)
T ss_pred             CEEEEEEECCCCEECHHHHCHHHHHHHHCCCCEEEEECCCCCHHHC---------CHHHHHHHHHHHHCCCEEECCHHEE
T ss_conf             6469986246743154440699999872358607998035883546---------8999999999997595653241011


Q ss_pred             ECCCCCHHHHHHHHHHHHHCCCCCCEEECCCEEECCCCCCCCCCCCCHHHHHHHHHHHHHHCCC
Q ss_conf             6689899999999999974088886020541120487412445687989999999999996868
Q gi|254780485|r  205 LGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEHVRIISVARILMPK  268 (328)
Q Consensus       205 ~G~gEt~eeri~~l~~lr~l~~~~~~v~~~~~~p~~gt~l~~~~~~~~~e~lr~iAi~RL~lP~  268 (328)
                      =|..++.+-..+.+..|-+++..|--+.  -.-+.+|+   ..-..+..+.++++.-.|=-+..
T Consensus       260 rGVND~~evl~~L~~~L~~~gV~PYYl~--~~D~~~G~---~hfr~~i~~~~~i~~~lr~~~SG  318 (369)
T COG1509         260 RGVNDDPEVLKELSRALFDAGVKPYYLH--QLDLVQGA---AHFRVPIAEGLQIVEELRGRTSG  318 (369)
T ss_pred             CCCCCCHHHHHHHHHHHHHCCCCCEEEE--CCCCCCCC---CCEECCHHHHHHHHHHHHHHCCC
T ss_conf             4667999999999999997488621785--16766772---33514099999999999975777


No 95 
>PRK01254 hypothetical protein; Provisional
Probab=98.36  E-value=2.5e-05  Score=55.43  Aligned_cols=203  Identities=15%  Similarity=0.206  Sum_probs=111.6

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHH--CCCEEEEEECCCCC-----------------------
Q ss_conf             78683423212433547775641000685799999999996--49838997303688-----------------------
Q gi|254780485|r   62 TGGCPENCGYCNQSVHNKSKLKASKLINVDQVLKEAKNAKE--NGATRYCMGAAWRE-----------------------  116 (328)
Q Consensus        62 TN~C~~~C~fCaf~~~~~~~~~~~~~~~~Eei~~~a~~~~~--~G~~~~~l~~~~~~-----------------------  116 (328)
                      --.|--+|+||+...|-.   +.-...|.|.|+++++.+.+  -|++...--.||..                       
T Consensus       379 ~RGCfGgCsFCaIt~HQG---R~IqSRS~eSIl~E~~~i~~k~p~FkG~IsDvGGPTANMy~~~C~~~~~~~~C~r~sCl  455 (742)
T PRK01254        379 MRGCFGGCSFCSITEHEG---RIIQSRSEESIINEIEAIRDKVPGFTGVISDLGGPTANMYRLGCKSPKAEQTCRRLSCV  455 (742)
T ss_pred             CCCCCCCCCEEEEEECCC---CEEEECCHHHHHHHHHHHHHHCCCCCEEECCCCCCCHHHCCCCCCCCHHCCCCCCCCCC
T ss_conf             485445784132230168---63343278999999999996489986776358871365431547981100789997789


Q ss_pred             ------CCCCCHHHHHHHHHHHCCC-CC-CEEEECC------CCCHHHHHHHHCCCCCEEE-EECC-CCHHHHHCCC-C-
Q ss_conf             ------8744289999988762136-88-3241025------6999999987415760697-5134-3777732058-8-
Q gi|254780485|r  117 ------PKERDLSIIVDMIKGVKSL-GL-ETCMTLG------MLSFEQAQILSKAGLDYYN-HNID-TSERFYPHVT-T-  178 (328)
Q Consensus       117 ------~~~~~~~~~~e~i~~i~~~-~~-~i~~~~g------~~~~~~~~~Lk~aG~~~~~-~~le-t~~~~~~~~~-~-  178 (328)
                            ....+...++++++.+++. ++ .|.+.-|      ..+.+.+++|-+.-+..++ +.-| +++....... | 
T Consensus       456 ~P~iC~nL~~dH~~~i~Llrk~R~lpGVKkVfI~SGiRyDLa~~d~eylkELv~hHVsGqLKVAPEH~~~~vL~~M~KP~  535 (742)
T PRK01254        456 YPDICPHLDTDHSPTIDLYRRARDLKGIKKILIASGVRYDLAVEDPEYVKELVTHHVGGYLKIAPEHTEEGPLSKMMKPG  535 (742)
T ss_pred             CCCCCCCCCCCHHHHHHHHHHHHCCCCCCEEEECCCHHHHHHHCCHHHHHHHHHHHCCCCEEECCCCCCHHHHHHHCCCC
T ss_conf             98778888788099999999986289865555312054555533889999999873687066576546858999862998


Q ss_pred             CCCHHHHHHHH-HHHHHCCCC--CCCEEEECC-CCCHHHHHHHHHHHHHCCCCCCEEECCCEEECCCCC-----------
Q ss_conf             88989999999-999987985--577078668-989999999999997408888602054112048741-----------
Q gi|254780485|r  179 THTFEDRLQTL-ENVRKSGIK--VCCGGILGL-GEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSK-----------  243 (328)
Q Consensus       179 ~~~~~~~l~~~-~~a~~~G~~--~~sg~l~G~-gEt~eeri~~l~~lr~l~~~~~~v~~~~~~p~~gt~-----------  243 (328)
                      ...|++..+.. +..+++|.+  +..-+|-+| |-|.+|.+++..+|++.+..++.|  +-|.|.|+|.           
T Consensus       536 ~~~y~rF~~~F~~~sk~~GK~QyLiPYfisaHPG~t~~Dm~~LA~~lk~~~~~peQV--QdF~PTP~t~sT~MYyTg~dP  613 (742)
T PRK01254        536 MGSYDRFKELFDKYSKEAGKEQYLIPYFISAHPGTTDEDMVNLALWLKKNRFRLDQV--QNFYPSPMANATTMYYTGKNP  613 (742)
T ss_pred             HHHHHHHHHHHHHHHHHHCCCCEEEEEEECCCCCCCHHHHHHHHHHHHHCCCCHHHC--EEEECCCCHHHHHHHHCCCCC
T ss_conf             689999999999999985897036877870689989999999999999739997563--120278617888788707786


Q ss_pred             C-------CCCCCC-CHHHHHHHHHHHHHHCCCC
Q ss_conf             2-------445687-9899999999999968687
Q gi|254780485|r  244 F-------EENKKV-DPIEHVRIISVARILMPKS  269 (328)
Q Consensus       244 l-------~~~~~~-~~~e~lr~iAi~RL~lP~~  269 (328)
                      |       +....+ ++.|-.--=|+.|.--|..
T Consensus       614 l~~v~~t~e~V~v~k~~~ek~lqrAll~y~~P~N  647 (742)
T PRK01254        614 LKKVKYKSEDVPVPKGDRQRRLHKALLRYHDPAN  647 (742)
T ss_pred             CCCCCCCCCEECCCCCHHHHHHHHHHHHHCCCCC
T ss_conf             6455667886236788889999999986348233


No 96 
>pfam00682 HMGL-like HMGL-like. This family contains a diverse set of enzymes. These include various aldolases and a region of pyruvate carboxylase.
Probab=98.30  E-value=0.00044  Score=47.00  Aligned_cols=217  Identities=16%  Similarity=0.151  Sum_probs=138.3

Q ss_pred             CCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCCCCHHHHHHHHHHHCCCCCCEEEECCC-CCHHHHHHHHCCCCCEEEEE
Q ss_conf             06857999999999964983899730368887442899999887621368832410256-99999998741576069751
Q gi|254780485|r   87 LINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLGLETCMTLGM-LSFEQAQILSKAGLDYYNHN  165 (328)
Q Consensus        87 ~~~~Eei~~~a~~~~~~G~~~~~l~~~~~~~~~~~~~~~~e~i~~i~~~~~~i~~~~g~-~~~~~~~~Lk~aG~~~~~~~  165 (328)
                      .++.|+-++.++.+.+.|+.++-+....  ..+.+++++.++.+..+............ ..+..++..+++|++.+.+.
T Consensus        10 ~~~~e~K~~i~~~L~~~Gv~~IEvg~~~--~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~e~~~~~g~~~i~i~   87 (237)
T pfam00682        10 AFSVEEKLAIARALDEAGVDEIEVGFPF--MSPTDFESVRAIAEVLKKAKIQALLRPVEHDIDAAVEAAKGAGADRVHVF   87 (237)
T ss_pred             CCCHHHHHHHHHHHHHCCCCEEEEECCC--CCCCHHHHHHHHHHHCCCCCCCCEEECCCHHHHHHHHHHHHCCCCEEEEE
T ss_conf             9899999999999998498989995775--89735999997765025875101000341049999999996799999996


Q ss_pred             CCCCHHHHHCCC---CCCCHHHHHHHHHHHHHCCCCCCCEEEECCCCCHHHHHHHHHHHHHCCCCCCEEECCCEEECCCC
Q ss_conf             343777732058---88898999999999998798557707866898999999999999740888860205411204874
Q gi|254780485|r  166 IDTSERFYPHVT---TTHTFEDRLQTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGS  242 (328)
Q Consensus       166 let~~~~~~~~~---~~~~~~~~l~~~~~a~~~G~~~~sg~l~G~gEt~eeri~~l~~lr~l~~~~~~v~~~~~~p~~gt  242 (328)
                      +-+++.....-.   .....+...++++.|++.|+++..+..++.--+.+..++.+..+.+.+.  +.|.      .++|
T Consensus        88 ~~~se~~~~~n~~~s~~~~l~~~~~~i~~a~~~g~~v~f~~~~~~~~~~~~~~~~~~~~~~~G~--~~i~------l~DT  159 (237)
T pfam00682        88 IATSDLHRKYKLNKDREEVADRAVAAVEAARSAGIDVELGCEDAGRTDLAFLIEVVEVAQEAGA--TRIN------IADT  159 (237)
T ss_pred             EECCHHHHHHHHCCCHHHHHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHHHHHHHHCCC--CEEE------ECCC
T ss_conf             1057878998857899999999999999999869905884051232478899999999986198--5797------3686


Q ss_pred             CCCCCCCCCHHHHHHHHHHHHHHCCCCCCEEEEHHHHH--CHHHHHHHHHHCCC---EEE--ECCEEECCCCCCHHHHHH
Q ss_conf             12445687989999999999996868721423115651--65689999980998---899--778665158889899999
Q gi|254780485|r  243 KFEENKKVDPIEHVRIISVARILMPKSRLRLAAGRAMM--SDELQALCFFSGAN---SIF--VGDTLLTAKNPSYNKDTI  315 (328)
Q Consensus       243 ~l~~~~~~~~~e~lr~iAi~RL~lP~~~i~i~~~~~~~--~~~~~~~~L~~GaN---~~~--~g~~~~t~~g~~~~~~~~  315 (328)
                          ....+|.+.-.++...|=.+|+..+.+=. --+.  +.-....|+.+||+   +++  +|+   .+++.+.|+.+.
T Consensus       160 ----~G~~~P~~v~~lv~~l~~~~~~~~i~~H~-Hn~~Gla~aN~l~A~~aG~~~id~si~GlG~---~~Gn~~te~lv~  231 (237)
T pfam00682       160 ----VGVLTPNEAADLISALKDRVPPVIIEVHC-HNDLGMAVANSLAAVEAGADRVDGTVNGLGE---RAGNAALEELVA  231 (237)
T ss_pred             ----CCCCCHHHHHHHHHHHHHCCCCCCEEEEE-CCCCCHHHHHHHHHHHHCCCEEEECCCCCCC---CCCCHHHHHHHH
T ss_conf             ----45579899999999999708987158874-4886729999999999689999877503155---426764999999


Q ss_pred             HHHHCC
Q ss_conf             999829
Q gi|254780485|r  316 LFNRLG  321 (328)
Q Consensus       316 ~i~~~G  321 (328)
                      +++.+|
T Consensus       232 ~L~~~G  237 (237)
T pfam00682       232 ALEVLG  237 (237)
T ss_pred             HHHHCC
T ss_conf             998577


No 97 
>KOG2876 consensus
Probab=98.27  E-value=2.3e-06  Score=62.28  Aligned_cols=190  Identities=22%  Similarity=0.299  Sum_probs=124.1

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCCCCHHHHHHHHHHHCCC-CCCEE
Q ss_conf             78683423212433547775641000685799999999996498389973036888744289999988762136-88324
Q gi|254780485|r   62 TGGCPENCGYCNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSL-GLETC  140 (328)
Q Consensus        62 TN~C~~~C~fCaf~~~~~~~~~~~~~~~~Eei~~~a~~~~~~G~~~~~l~~~~~~~~~~~~~~~~e~i~~i~~~-~~~i~  140 (328)
                      |-.|...|.||.-+..-+. .+...+++.++++..+.....+|....-+. ++.+.-..++..+..-+....+. ...| 
T Consensus        18 te~cnlrc~ycMpseg~~l-~pk~~~lav~eilrl~~lF~~qgv~knrLt-ggeptIr~d~~~i~~g~~~l~gLks~~I-   94 (323)
T KOG2876          18 TEKCNLRCQYCMPSEGVPL-KPKRKLLAVSEILRLAGLFAPQGVDKNRLT-GGEPLIRQDIVPIVAGLSSLPGLKSIGI-   94 (323)
T ss_pred             HHCCCCCCCCCCHHCCCCC-CCCHHHHHHHHHHHHHHHHHHHHHHHHHCC-CCCCCCCCCCCCCCHHHHCCCHHHHHCE-
T ss_conf             5200731212012007757-641000002446776435667550155405-7887410464310144412300144150-


Q ss_pred             EECCCCCHHHHHHHHCCCCCEEEEECCC-CHHHHHCCCCCCCHHHHHHHHHHHHHCCCC---CCCEEEECCCCCHHHHHH
Q ss_conf             1025699999998741576069751343-777732058888989999999999987985---577078668989999999
Q gi|254780485|r  141 MTLGMLSFEQAQILSKAGLDYYNHNIDT-SERFYPHVTTTHTFEDRLQTLENVRKSGIK---VCCGGILGLGEMIDDRID  216 (328)
Q Consensus       141 ~~~g~~~~~~~~~Lk~aG~~~~~~~let-~~~~~~~~~~~~~~~~~l~~~~~a~~~G~~---~~sg~l~G~gEt~eeri~  216 (328)
                      .+.|......+-+++++|.+..++.++| .+..|+....+..++.-+.-++.|.++|+.   +++-.|=|+.|..  +.+
T Consensus        95 Ttng~vl~R~lp~lhkaglssiNiSldtl~~aKfa~~~rr~g~v~V~~~iq~a~~lgy~pvkvn~v~~k~~n~~e--i~D  172 (323)
T KOG2876          95 TTNGLVLARLLPQLHKAGLSSINISLDTLVRAKFAKLTRRKGFVKVWASIQLAIELGYNPVKVNCVVMKGLNEDE--VFD  172 (323)
T ss_pred             ECCCHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHCCCCCCEEEEEEECCCCCC--CCC
T ss_conf             126226776617877724340003566555777777763112999998876776507787412256763367870--232


Q ss_pred             HHHHHHHCCCCCCEEECCCEEECCCCCCCCCCCCCHHHHHHHH
Q ss_conf             9999974088886020541120487412445687989999999
Q gi|254780485|r  217 MLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEHVRII  259 (328)
Q Consensus       217 ~l~~lr~l~~~~~~v~~~~~~p~~gt~l~~~~~~~~~e~lr~i  259 (328)
                      ....-|   ..+.-|-+--|.|..|+......-.+-.|.+.++
T Consensus       173 fv~~tr---~~p~DVrfIe~mpf~gn~~~t~slipy~e~l~li  212 (323)
T KOG2876         173 FVLLTR---MRPLDVRFIEFMPFDGNKWNTKSLIPYKEMLDLI  212 (323)
T ss_pred             EEEECC---CCCCCEEEEEECCCCCCCCCHHCCCCHHHHHHHH
T ss_conf             133068---9875468899425678721110134488998877


No 98 
>PRK00955 hypothetical protein; Provisional
Probab=98.24  E-value=8.3e-05  Score=51.89  Aligned_cols=202  Identities=18%  Similarity=0.260  Sum_probs=108.4

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHC-CCEEEE-EECCCC------------------------
Q ss_conf             786834232124335477756410006857999999999964-983899-730368------------------------
Q gi|254780485|r   62 TGGCPENCGYCNQSVHNKSKLKASKLINVDQVLKEAKNAKEN-GATRYC-MGAAWR------------------------  115 (328)
Q Consensus        62 TN~C~~~C~fCaf~~~~~~~~~~~~~~~~Eei~~~a~~~~~~-G~~~~~-l~~~~~------------------------  115 (328)
                      --.|--+|+|||...|-.-   .-...|.|.|+++|+..... +++... -++|.-                        
T Consensus       298 hRGCfGgCsFCaIt~HQGr---~I~sRS~~SIl~E~~~~~~~p~FkG~IsDvGGPTANmy~~~C~~~~~~g~C~~~~Cl~  374 (599)
T PRK00955        298 HRGCFGGCSFCAITFHQGR---FIQSRSKESILREAKELTQMPDFKGYIHDVGGPTANFRKMACKKQEKCGACKNKQCLF  374 (599)
T ss_pred             CCCCCCCCCCCCCCCCCCC---CEEECCHHHHHHHHHHHHHCCCCCEEECCCCCCCHHHCCCCCCCHHHCCCCCCCCCCC
T ss_conf             4762567821022011787---0344488999999999973889877871389824654306479802028899967899


Q ss_pred             ----CCCCCCHHHHHHHHHHHCCC-C-CCEEEECCC--------CCHHHHHHHHCCCCCEE-EEECC-CCHHHHHCCC-C
Q ss_conf             ----88744289999988762136-8-832410256--------99999998741576069-75134-3777732058-8
Q gi|254780485|r  116 ----EPKERDLSIIVDMIKGVKSL-G-LETCMTLGM--------LSFEQAQILSKAGLDYY-NHNID-TSERFYPHVT-T  178 (328)
Q Consensus       116 ----~~~~~~~~~~~e~i~~i~~~-~-~~i~~~~g~--------~~~~~~~~Lk~aG~~~~-~~~le-t~~~~~~~~~-~  178 (328)
                          +....+...++++++.+++. + -++.+.-|.        .+.+.+++|-+.-+... .+.-| +++....... |
T Consensus       375 P~~C~nL~~dh~~~~~LLrk~r~lpgVKkvfi~SGiRyDl~l~d~~~~yl~eL~~~HvsGqLKVAPEH~~~~VL~~M~KP  454 (599)
T PRK00955        375 PKPCKNLDVDHTEYLDLLRKVRKLPGVKKVFIRSGIRYDYLLHDKNDEFFKELCEHHVSGQLKVAPEHISDRVLKYMGKP  454 (599)
T ss_pred             CCCCCCCCCCCHHHHHHHHHHHCCCCCCEEEECCHHHHHHHCCCCCHHHHHHHHHHHCCCEEEECCCCCCHHHHHHHCCC
T ss_conf             98888987883899999999854899767774122655555136886999999977078706757754683788974799


Q ss_pred             -CCCHHHHHHHH-HHHHHCCCC--CCCEEEECC-CCCHHHHHHHHHHHHHCCCCCCEEECCCEEECCCCC----------
Q ss_conf             -88989999999-999987985--577078668-989999999999997408888602054112048741----------
Q gi|254780485|r  179 -THTFEDRLQTL-ENVRKSGIK--VCCGGILGL-GEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSK----------  243 (328)
Q Consensus       179 -~~~~~~~l~~~-~~a~~~G~~--~~sg~l~G~-gEt~eeri~~l~~lr~l~~~~~~v~~~~~~p~~gt~----------  243 (328)
                       ...|++..+.. +..+++|.+  +..-+|-+| |-|.+|.++....|++++..++.|  +-|+|.|+|.          
T Consensus       455 ~~~~~~~F~~~F~~~~k~~Gk~QylvPY~issHPGct~~dm~~La~~lk~~~~~peQV--QdF~PTP~T~sT~MYyTG~d  532 (599)
T PRK00955        455 SREVYDKFVKKFDRINKKLGKKQFLVPYLMSSHPGSTLEDAIELAEYLKDLGYQPEQV--QDFYPTPGTLSTTMYYTGLD  532 (599)
T ss_pred             CHHHHHHHHHHHHHHHHHHCCCCEEEEEEECCCCCCCHHHHHHHHHHHHHCCCCHHHC--EEEECCCCHHHHHHHHHCCC
T ss_conf             8189999999999999985897304777881699989999999999999739997773--11007851898889882788


Q ss_pred             -CCCCC---CCCHHHHHHHHHHHHHHCCC
Q ss_conf             -24456---87989999999999996868
Q gi|254780485|r  244 -FEENK---KVDPIEHVRIISVARILMPK  268 (328)
Q Consensus       244 -l~~~~---~~~~~e~lr~iAi~RL~lP~  268 (328)
                       +...+   +-++.|-..--|+.+...|.
T Consensus       533 P~t~~~V~V~k~~~ek~~Qrall~y~~p~  561 (599)
T PRK00955        533 PLTMEPVYVPKTKEEKAMQRALLQYRNPK  561 (599)
T ss_pred             CCCCCCCCCCCCHHHHHHHHHHHHHCCCC
T ss_conf             88798502469988999999998404800


No 99 
>TIGR02495 NrdG2 anaerobic ribonucleoside-triphosphate reductase activating protein; InterPro: IPR012840    This enzyme is a member of the radical-SAM family. It is often gene clustered with the class III (anaerobic) ribonucleotide triphosphate reductase (NrdD, IPR009161 from INTERPRO) and presumably fulfils the identical function as NrdG , , which utilises S-adenosyl methionine, an iron-sulphur cluster and a reductant (dihydroflavodoxin) to produce a glycine-centred radical in NrdD..
Probab=98.21  E-value=4.1e-05  Score=53.95  Aligned_cols=158  Identities=20%  Similarity=0.316  Sum_probs=111.3

Q ss_pred             EEEECCCCCCCCCCCCCCCCCCCCC---CCCCCCCCHHHHHHHHHHHHHCCC-EEEEEECCCCCCCCCCHHH-HHHHHHH
Q ss_conf             6453078683423212433547775---641000685799999999996498-3899730368887442899-9998876
Q gi|254780485|r   57 LLNIKTGGCPENCGYCNQSVHNKSK---LKASKLINVDQVLKEAKNAKENGA-TRYCMGAAWREPKERDLSI-IVDMIKG  131 (328)
Q Consensus        57 ~in~~TN~C~~~C~fCaf~~~~~~~---~~~~~~~~~Eei~~~a~~~~~~G~-~~~~l~~~~~~~~~~~~~~-~~e~i~~  131 (328)
                      .|.  +-.|..+|.||    ||...   .......+.|++++..+.  ++|. .-|++ +||++..   .+. +.+.++.
T Consensus        20 ~iF--~~GCn~~CpyC----HN~~~~~~~~~~~~~~~e~~~~~L~~--R~~ll~gVVi-tGGEptl---Q~~eL~d~~~~   87 (220)
T TIGR02495        20 TIF--FQGCNLKCPYC----HNSELLIPRKGSGEIELEELLEFLRR--RQGLLDGVVI-TGGEPTL---QAGELGDFLRE   87 (220)
T ss_pred             EEE--ECCCCCCCCCC----CCCCCHHHHCCCCCCCHHHHHHHHHH--CCCCEEEEEE-ECCCHHH---HHHHHHHHHHH
T ss_conf             887--02788998788----88764002005761027779999873--1342105787-2875323---67778999999


Q ss_pred             HCC-CCCCEEEECCCCCHHHHHHHHCCC-CCEEEEECCCCHHHHHCCCCC--------------CC----HHHHHHHHHH
Q ss_conf             213-688324102569999999874157-606975134377773205888--------------89----8999999999
Q gi|254780485|r  132 VKS-LGLETCMTLGMLSFEQAQILSKAG-LDYYNHNIDTSERFYPHVTTT--------------HT----FEDRLQTLEN  191 (328)
Q Consensus       132 i~~-~~~~i~~~~g~~~~~~~~~Lk~aG-~~~~~~~let~~~~~~~~~~~--------------~~----~~~~l~~~~~  191 (328)
                      +++ .+..|.++..-...+.+++|-+.| +|.+.+.+.+.++.|+.+...              .+    ++..++.++.
T Consensus        88 v~~nlGf~vkLdTNG~~P~~L~~ll~~gLvD~va~D~Kap~~~y~~~~G~~~~~~~~~tnisPsrtPe~l~~~~~~SlEi  167 (220)
T TIGR02495        88 VRENLGFEVKLDTNGSNPRVLEELLEEGLVDYVAMDVKAPPEKYGELYGREKNAAKKETNISPSRTPEKLLKNILKSLEI  167 (220)
T ss_pred             HHHHCCCEEEEECCCCCHHHHHHHHHCCCCCEEEEECCCCHHHCCEEECCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHH
T ss_conf             99865927856067886789999986048757875014786567400063321003532468775658999998755675


Q ss_pred             HHHCC----CC--CCCEEEECCCCCHHHHHHHHHHHHHCCC
Q ss_conf             99879----85--5770786689899999999999974088
Q gi|254780485|r  192 VRKSG----IK--VCCGGILGLGEMIDDRIDMLLTLANLST  226 (328)
Q Consensus       192 a~~~G----~~--~~sg~l~G~gEt~eeri~~l~~lr~l~~  226 (328)
                      +.+.|    ++  .=+|+.=++.+..||..+...+|++-..
T Consensus       168 l~~s~GCGGi~fE~RTTV~~~~~~Geed~~ei~~~i~~~~~  208 (220)
T TIGR02495       168 LLESGGCGGIEFELRTTVVRGLLDGEEDLAEIATRIKENGV  208 (220)
T ss_pred             HHHCCCCCCCCCEEECCCCHHHHCCCHHHHHHHHHHCCCCC
T ss_conf             54247868865324456552541652789999976322440


No 100
>KOG2492 consensus
Probab=98.19  E-value=0.00024  Score=48.76  Aligned_cols=224  Identities=14%  Similarity=0.133  Sum_probs=126.0

Q ss_pred             CCCCCCCCCCCC--CCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCCCCH-----------------
Q ss_conf             786834232124--3354777564100068579999999999649838997303688874428-----------------
Q gi|254780485|r   62 TGGCPENCGYCN--QSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDL-----------------  122 (328)
Q Consensus        62 TN~C~~~C~fCa--f~~~~~~~~~~~~~~~~Eei~~~a~~~~~~G~~~~~l~~~~~~~~~~~~-----------------  122 (328)
                      --.|.|-|.||-  |.+..    .  +-...+.|+++++.+.++|.+++-+.+ .+-...++-                 
T Consensus       227 MRGCdNMCtyCiVpftrGr----e--Rsrpi~siv~ev~~L~~qG~KeVTLLG-QNVNSyrD~s~~~~~~a~~~~~~~GF  299 (552)
T KOG2492         227 MRGCDNMCTYCIVPFTRGR----E--RSRPIESIVEEVKRLAEQGVKEVTLLG-QNVNSYRDNSAVQFSSAVPTNLSPGF  299 (552)
T ss_pred             HHCCCCCCCEEEEECCCCC----C--CCCCHHHHHHHHHHHHHCCCEEEEEEC-CCCCCCCCCHHHHHCCCCCCCCCCCC
T ss_conf             7564554455877525775----4--577468999999877654740366301-45443344426563247866668884


Q ss_pred             ----------HHHHHHHHHHCCCCCCE-----EEECCCCCHHHHHHHHCCCCC-EEEE-ECCC-CHHHHHCCCCCCCHHH
Q ss_conf             ----------99999887621368832-----410256999999987415760-6975-1343-7777320588889899
Q gi|254780485|r  123 ----------SIIVDMIKGVKSLGLET-----CMTLGMLSFEQAQILSKAGLD-YYNH-NIDT-SERFYPHVTTTHTFED  184 (328)
Q Consensus       123 ----------~~~~e~i~~i~~~~~~i-----~~~~g~~~~~~~~~Lk~aG~~-~~~~-~let-~~~~~~~~~~~~~~~~  184 (328)
                                ..+..++..+....++.     ..++-....+.+..+++...- ..++ -..+ +.+.......+.+.+.
T Consensus       300 st~yK~K~gGl~Fa~LLd~vs~~~PemR~RFTSPHPKDfpdevl~li~~rdnickqihlPAqSgds~vLE~mrRgysrea  379 (552)
T KOG2492         300 STVYKPKQGGLRFAHLLDQVSRADPEMRIRFTSPHPKDFPDEVLELIRDRDNICKQIHLPAQSGDSRVLEIMRRGYSREA  379 (552)
T ss_pred             EEEECCCCCCCCHHHHHHHHHHHCCCEEEEECCCCCCCCHHHHHHHHHHCCCHHHEEECCCCCCCHHHHHHHHCCCCHHH
T ss_conf             01211467884089999988652865078736999877739999998817531422425666885489999870578676


Q ss_pred             HHHHHHHHHHC--CCCCCCEEEECC-CCCHHHHHHHHHHHHHCCCCCCEEECCCEEECCCCCCCCCCCC------CHHHH
Q ss_conf             99999999987--985577078668-9899999999999974088886020541120487412445687------98999
Q gi|254780485|r  185 RLQTLENVRKS--GIKVCCGGILGL-GEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKV------DPIEH  255 (328)
Q Consensus       185 ~l~~~~~a~~~--G~~~~sg~l~G~-gEt~eeri~~l~~lr~l~~~~~~v~~~~~~p~~gt~l~~~~~~------~~~e~  255 (328)
                      .++-....++.  |.-.++-++-|. |||.+|-.+.+-.||..|  ++++.++......+|.-..+-..      ..+..
T Consensus       380 yl~lv~~Irs~iPgVglssdfitgfCgeTeedhq~t~sLlrqVg--Ydv~~lFaysmR~kT~ay~r~~ddvpeeVKnrrl  457 (552)
T KOG2492         380 YLELVAHIRSMIPGVGLSSDFITGFCGETEEDHQYTVSLLRQVG--YDVVFLFAYSMREKTRAYHRLKDDVPEEVKNRRL  457 (552)
T ss_pred             HHHHHHHHHHHCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHC--CCEEEEEEEEECCCCHHHHHHCCCCCHHHHHHHH
T ss_conf             53477778865888763232574056787277899999999855--3736667765314414556523665177887779


Q ss_pred             HHHHHHHHHH---CCCCCCEEEEHHHHHCHHHHHHHHHHCCC
Q ss_conf             9999999996---86872142311565165689999980998
Q gi|254780485|r  256 VRIISVARIL---MPKSRLRLAAGRAMMSDELQALCFFSGAN  294 (328)
Q Consensus       256 lr~iAi~RL~---lP~~~i~i~~~~~~~~~~~~~~~L~~GaN  294 (328)
                      ..++-++|-.   +-+..+--..-++..|..-++-.+.+|-|
T Consensus       458 ~~Li~~Fre~A~~~~d~lvgc~Qlvlveg~sKrs~t~~~gr~  499 (552)
T KOG2492         458 FELITFFREEAIKFNDGLVGCTQLVLVEGKSKRSATDLCGRN  499 (552)
T ss_pred             HHHHHHHHHHHHHHHCCCCCCCCEEEEECHHHHHHHHHHCCC
T ss_conf             999999999888875358652100011024566688872666


No 101
>COG0820 Predicted Fe-S-cluster redox enzyme [General function prediction only]
Probab=98.11  E-value=0.00041  Score=47.25  Aligned_cols=171  Identities=16%  Similarity=0.284  Sum_probs=90.0

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHH-CC------CEEEEEECCCCCCCCCCHHHHHHHHHHHCC-C
Q ss_conf             683423212433547775641000685799999999996-49------838997303688874428999998876213-6
Q gi|254780485|r   64 GCPENCGYCNQSVHNKSKLKASKLINVDQVLKEAKNAKE-NG------ATRYCMGAAWREPKERDLSIIVDMIKGVKS-L  135 (328)
Q Consensus        64 ~C~~~C~fCaf~~~~~~~~~~~~~~~~Eei~~~a~~~~~-~G------~~~~~l~~~~~~~~~~~~~~~~e~i~~i~~-~  135 (328)
                      .|..+|.||+=.   +.+  ..+-++..||+..+..+.+ .|      ++.+++.+.|++. . -++....+++.+.. .
T Consensus       110 GC~~~C~FCaTg---~~G--~~RNLs~~EIv~Qv~~~~~~~~~~~~~~i~NVV~MGMGEPl-~-N~dnV~~a~~i~~~~~  182 (349)
T COG0820         110 GCPVGCTFCATG---QGG--LNRNLSAGEIVEQVLLAAKALGEDFGRRISNVVFMGMGEPL-L-NLDNVVKALEIINDDE  182 (349)
T ss_pred             CCCCCCCEECCC---CCC--CEECCCHHHHHHHHHHHHHHCCCCCCCEEEEEEEECCCCHH-H-HHHHHHHHHHHHCCCC
T ss_conf             867888726456---666--01121799999999999986176656436469996478606-6-6999999998626766


Q ss_pred             CCC-----EEEECCCCCHHHHHHHHC-CCCCEEEEECCC-CHHHHHCCCC---CCCHHHHHHHHHHHHH-CCCCCCC--E
Q ss_conf             883-----241025699999998741-576069751343-7777320588---8898999999999998-7985577--0
Q gi|254780485|r  136 GLE-----TCMTLGMLSFEQAQILSK-AGLDYYNHNIDT-SERFYPHVTT---THTFEDRLQTLENVRK-SGIKVCC--G  202 (328)
Q Consensus       136 ~~~-----i~~~~g~~~~~~~~~Lk~-aG~~~~~~~let-~~~~~~~~~~---~~~~~~~l~~~~~a~~-~G~~~~s--g  202 (328)
                      ++.     +.+|..-+. ..+.+|.+ ..--..-+.+-+ ..++...+.|   +.+.++-++..+.-.+ .|.+++-  .
T Consensus       183 G~~ls~R~iTvSTsGi~-~~I~~l~~~~~~v~LAiSLHa~nd~lR~~L~Pink~~~~e~l~~a~r~Y~~~t~~rVt~EY~  261 (349)
T COG0820         183 GLGLSKRRITVSTSGIV-PRIRKLADEQLGVALAISLHAPNDELRDQLMPINKKYPIEELLEAIRYYPEKSGRRVTFEYV  261 (349)
T ss_pred             CCCCCCCEEEEECCCCC-HHHHHHHHHCCCEEEEEECCCCCHHHHHHHHCCCCCCCHHHHHHHHHHHHHCCCCEEEEEEE
T ss_conf             66646517999658875-76899875167758999506899899975332366798899999998622215966899866


Q ss_pred             EEECCCCCHHHHHHHHHHHHHC-CCCCCEEECCCEEECCCCCCCC
Q ss_conf             7866898999999999999740-8888602054112048741244
Q gi|254780485|r  203 GILGLGEMIDDRIDMLLTLANL-STPPESIPINLLIPIPGSKFEE  246 (328)
Q Consensus       203 ~l~G~gEt~eeri~~l~~lr~l-~~~~~~v~~~~~~p~~gt~l~~  246 (328)
                      ++=|...+.    +|...|-++ ...+..|-+-||.|.++...+.
T Consensus       262 Ll~~VND~~----e~A~~L~~ll~~~~~~VNLIP~Np~~~~~y~r  302 (349)
T COG0820         262 LLDGVNDSL----EHAKELAKLLKGIPCKVNLIPYNPVPGSDYER  302 (349)
T ss_pred             ECCCCCCCH----HHHHHHHHHHCCCCCEEEEEECCCCCCCCCCC
T ss_conf             204654888----89999999856897449986068989977447


No 102
>TIGR01211 ELP3 histone acetyltransferase, ELP3 family; InterPro: IPR005910   Histone acetylation is carried out by a class of enzymes known as histone acetyltransferases (HATs), which catalyse the transfer of an acetyl group from acetyl-CoA to the lysine E-amino groups on the N-terminal tails of histones . Early indication that HATs were involved in transcription came from the observation that in actively transcribed regions of chromatin, histones tend to be hyperacetylated, whereas in transcriptionally silent regions histones are hypoacetylated. The histone acetyltransferases are divided into five families. These include the Gcn5-related acetyltransferases (GNATs); the MYST (for 'MOZ, Ybf2/Sas3, Sas2 and Tip60)-related HATs; p300/CBP HATs; the general transcription factor HATs, which include the TFIID subunit TAF250; and the nuclear hormone-related HATs SRC1 and ACTR (SRC3). The GCN5-related N-acetyltransferase superfamily includes such enzymes as the histone acetyltransferases GCN5 and Hat1, the elongator complex subunit Elp3, the mediator-complex subunit Nut1, and Hpa2 .    Many GNATs share several functional domains, including an N-terminal region of variable length, an acetyltransferase domain that encompasses the conserved sequence motifs described above, a region that interacts with the coactivator Ada2, and a C-terminal bromodomain that is believed to interact with acetyl-lysine residues. Members of the GNAT family are important for the regulation of cell growth and development. In mice, knockouts of Gcn5L are embryonic lethal. Yeast Gcn5 is needed for normal progression through the G2M boundary and mitotic gene expression. The importance of GNATs is probably related to their role in transcription and DNA repair.   The yeast GCN5 (yGCN5) transcriptional coactivator functions as a histone acetyltransferase (HAT) to promote transcriptional activation. The crystal structure of the yeast histone acetyltransferase Hat1-acetyl coenzyme A (AcCoA) shows that Hat1 has an elongated, curved structure, and the AcCoA molecule is bound in a cleft on the concave surface of the protein, marking the active site of the enzyme. A channel of variable width and depth that runs across the protein is probably the binding site for the histone substrate . The central protein core associated with AcCoA binding that appears to be structurally conserved among a superfamily of N-acetyltransferases, including yeast histone acetyltransferase 1 and Serratia marcescens aminoglycoside 3-N-acetyltransferase .   The Saccharomyces cerevisiae member YPL086C has been characterised in vitro as an N-terminal acetyltransferase (2.3.1.48 from EC) for all four core histones. It is a component of the RNA polymerase II holoenzyme, designated Elp3p for Elongator Protein 3. Members of this family are found in eukaryotes and archaea. These proteins are part of the larger set of GNAT acetyltransferases. In vivo, ELP3 gene deletion confers typical ELP phenotypes such as slow growth adaptation, slow gene activation, and temperature sensitivity. This suggests a role for the proteins as novel, tightly RNAPII-associated histone acetyltransferases in transcription of DNA packaged in chromatin ..
Probab=98.05  E-value=0.00019  Score=49.46  Aligned_cols=262  Identities=18%  Similarity=0.267  Sum_probs=163.2

Q ss_pred             HHHCCCCCCCCHHHHHHHH----------C-CC-HHHHHHHHHHHHHHHCCC----CEE-EEEE--EEEECCC--CCC-C
Q ss_conf             4200234478999999997----------3-99-189999999998886289----856-9998--6453078--683-4
Q gi|254780485|r   10 ENPTKKPKVWTSKEVFQIY----------N-MP-FNDLLFWSHTVHRKNFEP----NHI-QLSK--LLNIKTG--GCP-E   67 (328)
Q Consensus        10 ~~~~~~~e~ls~eea~~L~----------~-~~-~~el~~~Aa~~~r~~~~g----~~V-~~~~--~in~~TN--~C~-~   67 (328)
                      .+.+.+|+..|++|+..+=          . .| +-|++..|..-.++.+-+    +.| |+++  .+=+-|-  -|+ -
T Consensus         3 ~~~~~sG~~~~k~~le~~K~~~~r~y~L~~G~Ps~seIL~~a~~~~~~~l~~~Lr~KPvRTiSGVAVVAvMTsP~~CPHG   82 (573)
T TIGR01211         3 VDKLLSGKVRDKEDLEDLKLEVSRKYGLSKGVPSNSEILNSAPDEEKKKLEDILRKKPVRTISGVAVVAVMTSPERCPHG   82 (573)
T ss_pred             HHHHHCCCCCCHHHHHHHHHHHHHHHCCCCCCCCHHHHHHHCCCHHHHHHHHHHCCCCCEEECCCCCEEEECCCCCCCCC
T ss_conf             01122256568888999999999875678898865899962480036788877516996011575200122621688885


Q ss_pred             C-----CCCCCCCCC---CCCCCC------------CCCCCCHHHHHHHHHHHHHCCCE----EEEEECCCCCCCCCCHH
Q ss_conf             2-----321243354---777564------------10006857999999999964983----89973036888744289
Q gi|254780485|r   68 N-----CGYCNQSVH---NKSKLK------------ASKLINVDQVLKEAKNAKENGAT----RYCMGAAWREPKERDLS  123 (328)
Q Consensus        68 ~-----C~fCaf~~~---~~~~~~------------~~~~~~~Eei~~~a~~~~~~G~~----~~~l~~~~~~~~~~~~~  123 (328)
                      .     |-||.=.-.   ..+...            .+..=+..++....+++.+.|..    ++.+.+|+-+  ..+.+
T Consensus        83 kytGniC~yCPGG~~s~f~~spQSYTG~EPAA~Rg~~~~YDPY~q~~~Rl~QL~~iGHpvdKVElI~MGGTFp--Ard~~  160 (573)
T TIGR01211        83 KYTGNICLYCPGGPDSDFENSPQSYTGYEPAALRGRQYDYDPYEQVTARLEQLEQIGHPVDKVELIIMGGTFP--ARDLD  160 (573)
T ss_pred             CCCCCEEEECCCCCCCCCCCCCCCCCCCCHHHHHHHHCCCCHHHHHHHHHHHHHHCCCCCCCEEEEEECCCCC--CCCHH
T ss_conf             4217876426878866667884875567658999765078856999999999987189816178883078777--88876


Q ss_pred             HH----HHHHHHHCCCC-------------------------------------------------------CC--EEEE
Q ss_conf             99----99887621368-------------------------------------------------------83--2410
Q gi|254780485|r  124 II----VDMIKGVKSLG-------------------------------------------------------LE--TCMT  142 (328)
Q Consensus       124 ~~----~e~i~~i~~~~-------------------------------------------------------~~--i~~~  142 (328)
                      |-    ..++.++...+                                                       ..  |.++
T Consensus       161 Yqe~Fv~~~l~Aln~F~yfkd~Dnleeklvr~~~~g~~~~~~e~~~fkraWert~~~~y~~LE~a~r~NE~~~~RcVG~T  240 (573)
T TIGR01211       161 YQEWFVKRCLNALNDFDYFKDIDNLEEKLVRAELKGNSTEVKEDDEFKRAWERTAEKDYVYLEEAIRKNETSKVRCVGLT  240 (573)
T ss_pred             HHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHCCCCCHHHHHHHHHCCCCCCCEEEEE
T ss_conf             77899999997316665346712467788763057654433688732346655304772136889962467686434677


Q ss_pred             ----CCCCCHHHHHHHHCCCCCEEEEECCC-CHHHHHCCCCCCCHHHHHHHHHHHHHCCCCCCCEEEECC-CCCHHHHHH
Q ss_conf             ----25699999998741576069751343-777732058888989999999999987985577078668-989999999
Q gi|254780485|r  143 ----LGMLSFEQAQILSKAGLDYYNHNIDT-SERFYPHVTTTHTFEDRLQTLENVRKSGIKVCCGGILGL-GEMIDDRID  216 (328)
Q Consensus       143 ----~g~~~~~~~~~Lk~aG~~~~~~~let-~~~~~~~~~~~~~~~~~l~~~~~a~~~G~~~~sg~l~G~-gEt~eeri~  216 (328)
                          +---.++++.+|-+-|...+.++..| ...++..+..+|+-++-+++-+.++.+|+|++.+||=|+ |=+.|--++
T Consensus       241 ~ETRPDyc~e~~id~ML~~G~TrVElGVQtiy~~i~~~~kRGH~V~~~~~at~llrDaG~KV~yH~MPGlPGs~fErDl~  320 (573)
T TIGR01211       241 IETRPDYCREEEIDRMLKLGATRVELGVQTIYNDILERIKRGHTVRDVVEATRLLRDAGLKVVYHIMPGLPGSSFERDLK  320 (573)
T ss_pred             ECCCCCCCCHHHHHHHHHCCCCEEEEEEECCHHHHHHHHCCCCCHHHHHHHHHHHHHCCCCEEEECCCCCCCCCHHHHHH
T ss_conf             21588988868899998359848997520726899998378985899999987766504622031175333566356899


Q ss_pred             HHHHHHHC-CCCCCEEECCCEEECCCCCCCC------CCCCCHHHHHHHHHHHHHHCCCCCCEEE
Q ss_conf             99999740-8888602054112048741244------5687989999999999996868721423
Q gi|254780485|r  217 MLLTLANL-STPPESIPINLLIPIPGSKFEE------NKKVDPIEHVRIISVARILMPKSRLRLA  274 (328)
Q Consensus       217 ~l~~lr~l-~~~~~~v~~~~~~p~~gt~l~~------~~~~~~~e~lr~iAi~RL~lP~~~i~i~  274 (328)
                      ....|=+= ...|+++-|-|-.=..||.|-.      -.|-+.+|.+-+||-+-=++|+. ++++
T Consensus       321 ~Fr~~Fedp~FkPDmLKIYPTLV~rGT~LY~lWk~G~Y~PY~~eEaveLiv~~~~~~P~W-vR~~  384 (573)
T TIGR01211       321 MFREIFEDPRFKPDMLKIYPTLVTRGTELYELWKRGEYKPYTTEEAVELIVEIKKIMPKW-VRIQ  384 (573)
T ss_pred             HHHHHHCCCCCCCCCEEECCEEEECCCCHHHHHHCCCCCCCCHHHHHHHHHHHHHHCCCC-EEEE
T ss_conf             998862687989786156671023476116888678998776789999999999738973-5775


No 103
>COG1533 SplB DNA repair photolyase [DNA replication, recombination, and repair]
Probab=98.03  E-value=0.0008  Score=45.28  Aligned_cols=165  Identities=16%  Similarity=0.203  Sum_probs=92.8

Q ss_pred             EEEECCCCCCCCCCCCCCCCCC-CCCCCCCCCCCHHHHHHHHHHHHH-C--CCEEEEEECCCCCCCCCCHHHHHHHHHHH
Q ss_conf             6453078683423212433547-775641000685799999999996-4--98389973036888744289999988762
Q gi|254780485|r   57 LLNIKTGGCPENCGYCNQSVHN-KSKLKASKLINVDQVLKEAKNAKE-N--GATRYCMGAAWREPKERDLSIIVDMIKGV  132 (328)
Q Consensus        57 ~in~~TN~C~~~C~fCaf~~~~-~~~~~~~~~~~~Eei~~~a~~~~~-~--G~~~~~l~~~~~~~~~~~~~~~~e~i~~i  132 (328)
                      -+|. --.|...|.||--+... .......+..-.+.+++.++.-.. .  ....+.+++..+  +..+.|.-..+.|.+
T Consensus        32 ~inp-y~GC~h~C~YCYa~~~~~~~~~~~~~v~vk~n~~e~l~~el~~~~~k~~~i~is~~TD--pyqp~E~~~~ltR~i  108 (297)
T COG1533          32 TLNP-YRGCSHGCIYCYARPMHGYLPKSPTKVNVKENLLELLERELRKPGPKRTVIAISSVTD--PYQPIEKEYRLTRKI  108 (297)
T ss_pred             ECCC-CCCCCCCCCEEECCCCCCCCCCCCCEEEEHHHHHHHHHHHHHHCCCCCEEEEEECCCC--CCCCHHHHHHHHHHH
T ss_conf             3377-4787788841336201466567860554015699999988752467855999854688--885647787899999


Q ss_pred             ----CCCCCCEEEEC-CCC---CHHHHHHHHCCCCCEEEEECCCC-HHHHHCCCCC-CCHHHHHHHHHHHHHCCCCCCCE
Q ss_conf             ----13688324102-569---99999987415760697513437-7773205888-89899999999999879855770
Q gi|254780485|r  133 ----KSLGLETCMTL-GML---SFEQAQILSKAGLDYYNHNIDTS-ERFYPHVTTT-HTFEDRLQTLENVRKSGIKVCCG  202 (328)
Q Consensus       133 ----~~~~~~i~~~~-g~~---~~~~~~~Lk~aG~~~~~~~let~-~~~~~~~~~~-~~~~~~l~~~~~a~~~G~~~~sg  202 (328)
                          ...+..+.+.. ..+   +-+.+..+..-+.-.+.+-+-|. +++.+.+=|. -+.++|+++++.+.++|++++. 
T Consensus       109 lei~~~~~~~v~I~TKS~lv~RDld~l~~~~~~~~v~V~~Sitt~d~~l~k~~EP~apsp~~Ri~al~~l~eaGi~~~v-  187 (297)
T COG1533         109 LEILLKYGFPVSIVTKSALVLRDLDLLLELAERGKVRVAVSITTLDEELAKILEPRAPSPEERLEALKELSEAGIPVGL-  187 (297)
T ss_pred             HHHHHHCCCCEEEEECCCCHHCCHHHHHHHCCCCCEEEEEEEECCCHHHHHHCCCCCCCHHHHHHHHHHHHHCCCEEEE-
T ss_conf             9998853996799977741010278998401126518999951684888986589996989999999999987984899-


Q ss_pred             EEECC---CCCHHHHHHHHHHHHHCCC
Q ss_conf             78668---9899999999999974088
Q gi|254780485|r  203 GILGL---GEMIDDRIDMLLTLANLST  226 (328)
Q Consensus       203 ~l~G~---gEt~eeri~~l~~lr~l~~  226 (328)
                       .++.   +.+++|.-+.+....+-+.
T Consensus       188 -~v~PIiP~~~d~e~e~~l~~~~~ag~  213 (297)
T COG1533         188 -FVAPIIPGLNDEELERILEAAAEAGA  213 (297)
T ss_pred             -EEECCCCCCCHHHHHHHHHHHHHCCC
T ss_conf             -98553078875889999999997577


No 104
>COG1313 PflX Uncharacterized Fe-S protein PflX, homolog of pyruvate formate lyase activating proteins [General function prediction only]
Probab=97.98  E-value=0.0011  Score=44.44  Aligned_cols=195  Identities=14%  Similarity=0.169  Sum_probs=110.5

Q ss_pred             EEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCCCCHHHHHHHHHHHCC
Q ss_conf             98645307868342321243354777564100068579999999999649838997303688874428999998876213
Q gi|254780485|r   55 SKLLNIKTGGCPENCGYCNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKS  134 (328)
Q Consensus        55 ~~~in~~TN~C~~~C~fCaf~~~~~~~~~~~~~~~~Eei~~~a~~~~~~G~~~~~l~~~~~~~~~~~~~~~~e~i~~i~~  134 (328)
                      +..|.+ | .|...|.||--.--+..+  .....++|+..+......+.|++.+-+|+|...|   .+-+++++++.+.+
T Consensus       120 SgTVFF-s-gCnfrCVfCQNwdISq~~--~g~~v~~e~La~i~~~~~~~GakNvN~Vgg~Ptp---~lp~Ile~l~~~~~  192 (335)
T COG1313         120 SGTVFF-S-GCNFRCVFCQNWDISQFG--IGKEVTPEDLAEIILELRRHGAKNVNFVGGDPTP---HLPFILEALRYASE  192 (335)
T ss_pred             CCEEEE-C-CCCEEEEEECCCCCCCCC--CCEEECHHHHHHHHHHHHHHCCCCEEECCCCCCC---CHHHHHHHHHHHHC
T ss_conf             740796-4-760589975576523367--8807569999999999998257621005899987---53899999999742


Q ss_pred             CCCCEEEECCCCCHHHHHHHHCCCCCEEEEECCC-CHHHHHCCCCCCCHHHHHHHHHHHH-----HCC-CCCCCEEEECC
Q ss_conf             6883241025699999998741576069751343-7777320588889899999999999-----879-85577078668
Q gi|254780485|r  135 LGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDT-SERFYPHVTTTHTFEDRLQTLENVR-----KSG-IKVCCGGILGL  207 (328)
Q Consensus       135 ~~~~i~~~~g~~~~~~~~~Lk~aG~~~~~~~let-~~~~~~~~~~~~~~~~~l~~~~~a~-----~~G-~~~~sg~l~G~  207 (328)
                      .-+.+.-|.+..++|.++.|... +|-|.-.+.= .++...+.-.-..|   +++..+++     +.| +-+---+|=||
T Consensus       193 ~iPvvwNSnmY~s~E~l~lL~gv-VDiyL~DfKYgNdeca~kySkvp~Y---~eVv~rn~~~~~~~~g~~iiRHLVlPgh  268 (335)
T COG1313         193 NIPVVWNSNMYMSEETLKLLDGV-VDIYLPDFKYGNDECAEKYSKVPNY---WEVVTRNILEAKEQVGGLIIRHLVLPGH  268 (335)
T ss_pred             CCCEEEECCCCCCHHHHHHHHCC-CEEEECCCCCCCHHHHHHHHCCCCH---HHHHHHHHHHHHHHCCCEEEEEEECCCC
T ss_conf             79879706874489999986260-2043043246888999986058946---8998899999997427658888734884


Q ss_pred             CCC-HHHHHHHHHHHHHCCCCCCEEECCCEEECCCCC----C-CCCCCCCHHHHHHHHHHHHHH
Q ss_conf             989-999999999997408888602054112048741----2-445687989999999999996
Q gi|254780485|r  208 GEM-IDDRIDMLLTLANLSTPPESIPINLLIPIPGSK----F-EENKKVDPIEHVRIISVARIL  265 (328)
Q Consensus       208 gEt-~eeri~~l~~lr~l~~~~~~v~~~~~~p~~gt~----l-~~~~~~~~~e~lr~iAi~RL~  265 (328)
                      .|. -..+   +.+|.+.-.  ..+.+|...+.-.+.    . +-...++.+|+.+.+-.++=+
T Consensus       269 lecCTkpI---~~wiae~~g--~~~~vNiM~QY~P~ykA~eypeI~R~lt~eE~e~a~~~a~~~  327 (335)
T COG1313         269 LECCTKPI---LRWIAENLG--NDVRVNIMFQYRPEYKAEEYPEINRRLTREEYEKALEYAEKL  327 (335)
T ss_pred             HHHCCHHH---HHHHHHHCC--CCEEEEEHHHCCCHHHHHHCHHHCCCCCHHHHHHHHHHHHHC
T ss_conf             22325899---999997589--870587532216235544244433658999999999999974


No 105
>COG1244 Predicted Fe-S oxidoreductase [General function prediction only]
Probab=97.88  E-value=0.0029  Score=41.55  Aligned_cols=181  Identities=14%  Similarity=0.158  Sum_probs=111.1

Q ss_pred             CCCCCC----CCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCC---CEE--EEEECCCCCCCC--CCHHHHHHHH
Q ss_conf             078683----42321243354777564100068579999999999649---838--997303688874--4289999988
Q gi|254780485|r   61 KTGGCP----ENCGYCNQSVHNKSKLKASKLINVDQVLKEAKNAKENG---ATR--YCMGAAWREPKE--RDLSIIVDMI  129 (328)
Q Consensus        61 ~TN~C~----~~C~fCaf~~~~~~~~~~~~~~~~Eei~~~a~~~~~~G---~~~--~~l~~~~~~~~~--~~~~~~~e~i  129 (328)
                      +|-.|.    ..|.+|++.....     ....+.|.+..+..++...-   ..+  +.+-++|--..+  -+-+-...++
T Consensus        53 rT~GC~w~~~~gC~MCgY~~d~~-----~~~vs~E~l~~qfd~~~~k~~~~~~~~~vkIFTSGSFLD~~EVP~e~R~~Il  127 (358)
T COG1244          53 RTRGCRWYREGGCYMCGYPADSA-----GEPVSEENLINQFDEAYSKYEGKFDEFVVKIFTSGSFLDPEEVPREARRYIL  127 (358)
T ss_pred             ECCCCCEECCCCCCEECCCCCCC-----CCCCCHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHCCHHHHHHHH
T ss_conf             26883222058722426554668-----8989889999999999997224478754999715665892448879999999


Q ss_pred             HHHCCCC--CCEEE--ECCCCCHHHHHHHHCC--CC-CEEEEECCCCHH-HHHC-CCCCCCHHHHHHHHHHHHHCCCCCC
Q ss_conf             7621368--83241--0256999999987415--76-069751343777-7320-5888898999999999998798557
Q gi|254780485|r  130 KGVKSLG--LETCM--TLGMLSFEQAQILSKA--GL-DYYNHNIDTSER-FYPH-VTTTHTFEDRLQTLENVRKSGIKVC  200 (328)
Q Consensus       130 ~~i~~~~--~~i~~--~~g~~~~~~~~~Lk~a--G~-~~~~~~let~~~-~~~~-~~~~~~~~~~l~~~~~a~~~G~~~~  200 (328)
                      ..+.+.+  -.+.+  -+-..+++.+..+.+.  |. -.+.++|||+.+ +... +-.+-++++.++..+.+|+.|+++-
T Consensus       128 ~~is~~~~v~~vvvESRpE~I~eE~l~e~~~il~gk~~EvaIGLETanD~ire~sINKGftF~df~~A~~~ir~~g~~vk  207 (358)
T COG1244         128 ERISENDNVKEVVVESRPEFIREERLEEITEILEGKIVEVAIGLETANDKIREDSINKGFTFEDFVRAAEIIRNYGAKVK  207 (358)
T ss_pred             HHHHHCCCEEEEEEECCCHHCCHHHHHHHHHHHCCCEEEEEEECCCCCHHHHHHHHHCCCCHHHHHHHHHHHHHCCCCEE
T ss_conf             99752366027876047101278999999986089538999712447488998765138868999999999997497515


Q ss_pred             CEEEECCC--CCHHHHHHHHHHHHHCCCCCCEEECCCEEECCCCCCCC
Q ss_conf             70786689--89999999999997408888602054112048741244
Q gi|254780485|r  201 CGGILGLG--EMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEE  246 (328)
Q Consensus       201 sg~l~G~g--Et~eeri~~l~~lr~l~~~~~~v~~~~~~p~~gt~l~~  246 (328)
                      +-.|+-+.  -..+-+.+.+..++.....++.|++++-.-++||-++.
T Consensus       208 tYlllKP~FlSE~eAI~D~i~Si~~~~~~~d~iSinptnVqKgTlvE~  255 (358)
T COG1244         208 TYLLLKPPFLSEKEAIEDVISSIVAAKPGTDTISINPTNVQKGTLVEK  255 (358)
T ss_pred             EEEEECCCCCCHHHHHHHHHHHHHHHCCCCCEEEECCCCCCHHHHHHH
T ss_conf             788831653476889999999999743678758844542213109999


No 106
>PRK05692 hydroxymethylglutaryl-CoA lyase; Provisional
Probab=97.85  E-value=0.0032  Score=41.25  Aligned_cols=219  Identities=15%  Similarity=0.158  Sum_probs=133.0

Q ss_pred             CCCCHHHHHHHHHHHHHCCCEEEEEECCCCC---CCCCCHHHHHHHHHHHCCC-CCCEEEECCCCCHHHHHHHHCCCCCE
Q ss_conf             0068579999999999649838997303688---8744289999988762136-88324102569999999874157606
Q gi|254780485|r   86 KLINVDQVLKEAKNAKENGATRYCMGAAWRE---PKERDLSIIVDMIKGVKSL-GLETCMTLGMLSFEQAQILSKAGLDY  161 (328)
Q Consensus        86 ~~~~~Eei~~~a~~~~~~G~~~~~l~~~~~~---~~~~~~~~~~e~i~~i~~~-~~~i~~~~g~~~~~~~~~Lk~aG~~~  161 (328)
                      ..++.|+-++.++.+.+.|+.++-.++-..+   |...+.+.   .++.+... +...  +.-..+...+++-.++|++.
T Consensus        21 ~~~s~e~K~~ia~~L~~~Gv~~IEvgsfvspk~vP~~~d~~e---v~~~i~~~~~~~~--~~l~~n~~g~~~A~~~g~~~   95 (287)
T PRK05692         21 RFIPTADKIALIDRLSAAGLSYIEVASFVSPKWVPQMADAAE---VMAGIQRRPGVTY--AALTPNLKGLEAALAAGADE   95 (287)
T ss_pred             CCCCHHHHHHHHHHHHHCCCCEEEECCCCCCCCCHHHCCHHH---HHHHHHCCCCCEE--EEECCCHHHHHHHHHCCCCE
T ss_conf             984999999999999984999999668778230213167999---9987640679678--66436404279999779898


Q ss_pred             EEEECCCCHHHHHC-CCCC--CCHHHHHHHHHHHHHCCCCCCC--EEEECC---CC-CHHHHHHHHHHHHHCCCCCCEEE
Q ss_conf             97513437777320-5888--8989999999999987985577--078668---98-99999999999974088886020
Q gi|254780485|r  162 YNHNIDTSERFYPH-VTTT--HTFEDRLQTLENVRKSGIKVCC--GGILGL---GE-MIDDRIDMLLTLANLSTPPESIP  232 (328)
Q Consensus       162 ~~~~let~~~~~~~-~~~~--~~~~~~l~~~~~a~~~G~~~~s--g~l~G~---gE-t~eeri~~l~~lr~l~~~~~~v~  232 (328)
                      +.+.+-+++..... ...+  ..++.-.++++.|++.|+++..  .+.||-   +. ..+..++.+..+.+.+..  .| 
T Consensus        96 i~i~~~~Sd~h~~~nl~~t~~e~l~~~~~~i~~a~~~g~~v~~~i~~afg~p~~~~~~~~~l~~~~~~~~~~Ga~--~I-  172 (287)
T PRK05692         96 VAVFASASEAFSQKNINCSIAESLARFEPVAEAAKQAGVRVRGYVSCVLGCPYEGEVPPEAVADVAERLFALGCD--EI-  172 (287)
T ss_pred             EEEEEECCHHHHHHHHCCCHHHHHHHHHHHHHHHHHCCCEEEEEEEECCCCCCCCCCCHHHHHHHHHHHHHCCCC--EE-
T ss_conf             999974179999987479999999999999999997698799987401367646864899999999999857997--85-


Q ss_pred             CCCEEECCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCEEEEHHHH--HCHHHHHHHHHHCCC---EEEE--C------
Q ss_conf             54112048741244568798999999999999686872142311565--165689999980998---8997--7------
Q gi|254780485|r  233 INLLIPIPGSKFEENKKVDPIEHVRIISVARILMPKSRLRLAAGRAM--MSDELQALCFFSGAN---SIFV--G------  299 (328)
Q Consensus       233 ~~~~~p~~gt~l~~~~~~~~~e~lr~iAi~RL~lP~~~i~i~~~~~~--~~~~~~~~~L~~GaN---~~~~--g------  299 (328)
                           -.++|    ....+|.+.-+++...|=.+|...+.+-. --+  ++.-....|+.+||+   +++-  |      
T Consensus       173 -----~laDT----~G~a~P~~v~~~i~~v~~~~~~~~i~~H~-Hnd~Gma~AN~laAv~aGa~~vd~tv~GlGgcPfap  242 (287)
T PRK05692        173 -----SLGDT----IGVGTPGQVRRVLEAVLAEFPAERLAGHF-HDTYGQALANIYASLEEGITVFDASVGGLGGCPYAP  242 (287)
T ss_pred             -----ECCCC----CCCCCHHHHHHHHHHHHHHCCCCCEEEEE-CCCCCHHHHHHHHHHHHCCCEEEEECCCCCCCCCCC
T ss_conf             -----44765----56669999999999999866887235674-487306999999999809998988554777999999


Q ss_pred             CEEECCCCCCHHHHHHHHHHCCCCCC
Q ss_conf             86651588898999999998298532
Q gi|254780485|r  300 DTLLTAKNPSYNKDTILFNRLGLIPD  325 (328)
Q Consensus       300 ~~~~t~~g~~~~~~~~~i~~~G~~P~  325 (328)
                      |   .+++.+.|+.+.+++++|+.--
T Consensus       243 ~---~aGN~~tE~lv~~l~~~G~~Tg  265 (287)
T PRK05692        243 G---ATGNVATEDVLYMLHGLGIETG  265 (287)
T ss_pred             C---CCCCHHHHHHHHHHHHCCCCCC
T ss_conf             8---7678669999999996599669


No 107
>PRK10076 pyruvate formate lyase II activase; Provisional
Probab=97.79  E-value=0.0038  Score=40.79  Aligned_cols=185  Identities=13%  Similarity=0.104  Sum_probs=122.6

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHH-----CCCEEEEEECCCCCCCCCCHHHHHHHHHHHCCCCCC
Q ss_conf             683423212433547775641000685799999999996-----498389973036888744289999988762136883
Q gi|254780485|r   64 GCPENCGYCNQSVHNKSKLKASKLINVDQVLKEAKNAKE-----NGATRYCMGAAWREPKERDLSIIVDMIKGVKSLGLE  138 (328)
Q Consensus        64 ~C~~~C~fCaf~~~~~~~~~~~~~~~~Eei~~~a~~~~~-----~G~~~~~l~~~~~~~~~~~~~~~~e~i~~i~~~~~~  138 (328)
                      .|...|..=|...       ..+.++.||+++++..-..     .|.-.  + +||+ |. ...+.+.++++..|+.+++
T Consensus         2 rca~~Cp~~A~~~-------~G~~~tveel~~~i~kd~~fy~~SgGGVT--~-SGGE-pl-~Q~~F~~ellk~~k~~gih   69 (213)
T PRK10076          2 RDADECPSGAFER-------IGRDISLDALEREVMKDDIFFRTSGGGVT--L-SGGE-VL-MQAEFATRFLQRLRLWGVS   69 (213)
T ss_pred             CCHHHCHHHHHHH-------HCEEEEHHHHHHHHHHHHHHHHCCCCEEE--E-ECCH-HH-CCHHHHHHHHHHHHHCCCC
T ss_conf             8556787788875-------26681099999999971999824798078--6-0752-63-5999999999999866998


Q ss_pred             EEE-ECCCCCHHHHHHHHCCCCCEEEEECCC-CHHHHHCCCCCCCHHHHHHHHHHHHHCCCCCCC--EEEECCCCCHHHH
Q ss_conf             241-025699999998741576069751343-777732058888989999999999987985577--0786689899999
Q gi|254780485|r  139 TCM-TLGMLSFEQAQILSKAGLDYYNHNIDT-SERFYPHVTTTHTFEDRLQTLENVRKSGIKVCC--GGILGLGEMIDDR  214 (328)
Q Consensus       139 i~~-~~g~~~~~~~~~Lk~aG~~~~~~~let-~~~~~~~~~~~~~~~~~l~~~~~a~~~G~~~~s--g~l~G~gEt~eer  214 (328)
                      .++ +.|..+.+.+.++... +|.+...+.. .++.+.+. ++.+.+..++-++.+.+.|.++-.  -+|=|.-.+.++.
T Consensus        70 taieTsG~~~~~~~~~~~~~-~Dl~L~DiK~~d~~~h~~~-TG~~n~~il~Nl~~l~~~~~~v~iR~pvIPg~nd~~e~i  147 (213)
T PRK10076         70 CAIETAGDAPASKLLPLAKL-CDEVLFDLKIMDATQARDV-VKMNLPRVLENLRLLVSEGVNVIPRLPLIPGFTLSRENM  147 (213)
T ss_pred             EEEECCCCCCHHHHHHHHHH-CCEEEEEECCCCHHHHHHH-HCCCHHHHHHHHHHHHHCCCCEEEEEEEECCCCCCHHHH
T ss_conf             89976888889999999984-5989986177984899999-799939999999999967996899886779978999999


Q ss_pred             HHHHHHHHHCCCCCCEEECCCEEECC---------CCCCCCCCCCCHHHHHHHHHHHHH
Q ss_conf             99999997408888602054112048---------741244568798999999999999
Q gi|254780485|r  215 IDMLLTLANLSTPPESIPINLLIPIP---------GSKFEENKKVDPIEHVRIISVARI  264 (328)
Q Consensus       215 i~~l~~lr~l~~~~~~v~~~~~~p~~---------gt~l~~~~~~~~~e~lr~iAi~RL  264 (328)
                      -.....+++++.  ..|-+-|+++.-         .=++++.++++.++..+..-+++-
T Consensus       148 ~~~~~f~~~l~v--~~veLLPYH~~G~~Ky~~Lg~~Y~l~~~~~p~~e~~~~~~~i~~~  204 (213)
T PRK10076        148 QQALDVLIPLNI--RQIHLLPFHQYGEPKYRLLGKTWSMKEVPAPSSADVATMREMAER  204 (213)
T ss_pred             HHHHHHHHHCCC--CEEEECCCCHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHH
T ss_conf             999999998699--779971884130799999788787789998599999999999996


No 108
>TIGR00048 TIGR00048 radical SAM enzyme, Cfr family; InterPro: IPR004383 This family of conserved hypothetical proteins groups bacterial proteins of unknown function..
Probab=97.78  E-value=0.0018  Score=42.92  Aligned_cols=195  Identities=11%  Similarity=0.263  Sum_probs=100.9

Q ss_pred             EEEEEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHH-HC---------CCEEEEEECCCCCCCCC
Q ss_conf             569998645307868342321243354777564100068579999999999-64---------98389973036888744
Q gi|254780485|r   51 HIQLSKLLNIKTGGCPENCGYCNQSVHNKSKLKASKLINVDQVLKEAKNAK-EN---------GATRYCMGAAWREPKER  120 (328)
Q Consensus        51 ~V~~~~~in~~TN~C~~~C~fCaf~~~~~~~~~~~~~~~~Eei~~~a~~~~-~~---------G~~~~~l~~~~~~~~~~  120 (328)
                      +.|+|.--=+   +|..+|.||+   ..+.+..+-  |..-||+..+-.+. ..         .++.+++.|-|+ |.. 
T Consensus       120 k~TvCVSsQv---GC~~~C~FC~---T~~gGf~RN--L~~~EIi~Qv~~~~k~~G~~~~~~erP~~nvV~MGmGE-PL~-  189 (378)
T TIGR00048       120 KATVCVSSQV---GCALGCTFCA---TAKGGFNRN--LEASEIIGQVLRVQKILGAAEETGERPVSNVVFMGMGE-PLL-  189 (378)
T ss_pred             CCCEEEEECC---CCCCCCCCCC---CCCCCCCCC--CCHHHHHHHHHHHHHHHCCCCCCCCCCEEEEEECCCCC-CCC-
T ss_conf             7626871023---5422551033---457875214--51033899999999983455777665404788746787-101-


Q ss_pred             CHHHHHHHHHHHCC-CC--C---CEEEE-CCCCCHHHHHHHHCCCCCE-EEEECCC-CHHHHHCCCC---CCCHHHHHHH
Q ss_conf             28999998876213-68--8---32410-2569999999874157606-9751343-7777320588---8898999999
Q gi|254780485|r  121 DLSIIVDMIKGVKS-LG--L---ETCMT-LGMLSFEQAQILSKAGLDY-YNHNIDT-SERFYPHVTT---THTFEDRLQT  188 (328)
Q Consensus       121 ~~~~~~e~i~~i~~-~~--~---~i~~~-~g~~~~~~~~~Lk~aG~~~-~~~~let-~~~~~~~~~~---~~~~~~~l~~  188 (328)
                      -++.++.+++.+.. .+  +   .|.+| .|....  +..|.+--++- +-+.|=. ..++...+.|   +..-++-|+.
T Consensus       190 Nl~~vv~a~ei~n~~~g~~is~r~~T~STsGv~~k--i~~Lad~~l~V~lAiSLHApn~~~R~~l~P~nk~Y~ie~ll~~  267 (378)
T TIGR00048       190 NLNEVVKALEILNDDVGLGISKRRITISTSGVVPK--IDELADKMLQVALAISLHAPNDELRSSLMPINKKYNIETLLAA  267 (378)
T ss_pred             CHHHHHHHHHHHHHHHHCCCCCCEEEEEECCHHHH--HHHHCCCCCCEEEEEEECCCCCHHHHHHCCCCCCCCHHHHHHH
T ss_conf             17999999998742220365673378873571458--8885132110334455328871124440650014786799999


Q ss_pred             HH-HHHHCCC---CCCC--EEEECCCCCHHHHHHHHHHHHHCCCCCCEEECCCEEECCCCCCCCCCCCCHHHHHHHHH
Q ss_conf             99-9998798---5577--07866898999999999999740888860205411204874124456879899999999
Q gi|254780485|r  189 LE-NVRKSGI---KVCC--GGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEHVRIIS  260 (328)
Q Consensus       189 ~~-~a~~~G~---~~~s--g~l~G~gEt~eeri~~l~~lr~l~~~~~~v~~~~~~p~~gt~l~~~~~~~~~e~lr~iA  260 (328)
                      ++ +..+.|-   +++-  .|+=|.-+..+|--+.+..|+..+-   -|-+-||.|+|+.++...+.-....|.+++.
T Consensus       268 vr~Y~~~~~~n~GRV~fEY~Ll~~vND~~~HA~~La~lL~g~~c---kvNLIP~NP~~e~~Y~R~s~~~i~~F~~~L~  342 (378)
T TIGR00048       268 VRRYLEKTGRNQGRVTFEYVLLDGVNDQVEHAEELAELLKGVKC---KVNLIPFNPFPEADYERPSNEQIDRFAKVLK  342 (378)
T ss_pred             HHHHHHHCCCCCCCEEEEEEECCCCCCCHHHHHHHHHHHCCCCC---EEEEEECCCCCCCCCCCCCHHHHHHHHHHHH
T ss_conf             98758642767772688742002468858899999998569985---0401213787988888880889999999862


No 109
>COG5014 Predicted Fe-S oxidoreductase [General function prediction only]
Probab=97.51  E-value=0.007  Score=38.96  Aligned_cols=165  Identities=15%  Similarity=0.196  Sum_probs=95.1

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHH-HHCCCEEEEEECCCCCCCCCCHHHHHHHHHHHCCCCCCE
Q ss_conf             0786834232124335477756410006857999999999-964983899730368887442899999887621368832
Q gi|254780485|r   61 KTGGCPENCGYCNQSVHNKSKLKASKLINVDQVLKEAKNA-KENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLGLET  139 (328)
Q Consensus        61 ~TN~C~~~C~fCaf~~~~~~~~~~~~~~~~Eei~~~a~~~-~~~G~~~~~l~~~~~~~~~~~~~~~~e~i~~i~~~~~~i  139 (328)
                      .+=.|...|.||--+..+.-...+..+++++++.+...++ +++|+..+-+. |.++. . --+.+++.|....+.- .+
T Consensus        47 D~VGCnl~CayCw~y~r~~~~~rag~f~~P~eVaeRL~ei~K~~g~d~vRiS-G~EP~-l-~~EHvlevIeLl~~~t-Fv  122 (228)
T COG5014          47 DTVGCNLLCAYCWNYFRNLRPKRAGDFLSPEEVAERLLEISKKRGCDLVRIS-GAEPI-L-GREHVLEVIELLVNNT-FV  122 (228)
T ss_pred             CCCCCCEEEHHHHHHHHCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCEEEEE-CCCCC-C-CHHHHHHHHHHCCCCE-EE
T ss_conf             3135331238766666038722130215979999999999885588689962-89864-4-6899999998634764-99


Q ss_pred             EEECCCC---CHHHHHHHHCCCCCEEEEECCC-CHHHHHCCCC--CCCHHHHHHHHHHHHHCCCCCCCEEEECCCCCHHH
Q ss_conf             4102569---9999998741576069751343-7777320588--88989999999999987985577078668989999
Q gi|254780485|r  140 CMTLGML---SFEQAQILSKAGLDYYNHNIDT-SERFYPHVTT--THTFEDRLQTLENVRKSGIKVCCGGILGLGEMIDD  213 (328)
Q Consensus       140 ~~~~g~~---~~~~~~~Lk~aG~~~~~~~let-~~~~~~~~~~--~~~~~~~l~~~~~a~~~G~~~~sg~l~G~gEt~ee  213 (328)
                      .-+.|.+   +..-.+.|.+.--.-+-..+.. .|+-|.++..  ..-+..-|++++..|+-|+..-.-+++++  ..||
T Consensus       123 lETNG~~~g~drslv~el~nr~nv~vRVsvKG~dpesF~kIT~asp~~F~~QL~aLr~L~~~g~rf~pA~~~~f--~~Ed  200 (228)
T COG5014         123 LETNGLMFGFDRSLVDELVNRLNVLVRVSVKGWDPESFEKITGASPEYFRYQLKALRHLHGKGHRFWPAVVYDF--FRED  200 (228)
T ss_pred             EEECCEEEECCHHHHHHHHCCCCEEEEEEECCCCHHHHHHHHCCCHHHHHHHHHHHHHHHHCCCEEEEHHHHCC--CHHH
T ss_conf             97577688358889999713786399998357988998987568927899999999999846716510143203--5136


Q ss_pred             HHH-HHHHHHHCCCCCCEE
Q ss_conf             999-999997408888602
Q gi|254780485|r  214 RID-MLLTLANLSTPPESI  231 (328)
Q Consensus       214 ri~-~l~~lr~l~~~~~~v  231 (328)
                      ... ....|-+....|+.+
T Consensus       201 ~~k~Lak~Lgehp~~P~~i  219 (228)
T COG5014         201 GLKELAKRLGEHPPIPCRI  219 (228)
T ss_pred             HHHHHHHHHCCCCCCCCCE
T ss_conf             6899998754389998524


No 110
>TIGR03278 methan_mark_10 putative methanogenesis marker protein 10. Members of this protein family, to date, are found in a completed prokaryotic genome if and only if the species is one of the archaeal methanogens. The presence of motifs with seven invariant Cys residues in the N-terminal 50 residues, including three instances of CXXC, would be consistent with function as an oxidoreductase with FeS clusters. The exact function is unknown, but likely is linked to methanogenesis. In most genomes, the member of this family is encoded by a gene next to, and divergently transcribed from, the methyl coenzyme M reductase operon.
Probab=97.38  E-value=0.014  Score=36.88  Aligned_cols=135  Identities=20%  Similarity=0.189  Sum_probs=82.3

Q ss_pred             CCCHHHHHHHHHHHHHC---CCEEEEEECCCCCCCCCCHHHHHHHHHHHCCCCCCEEEE----CCCCCHHHHHHHHCCCC
Q ss_conf             06857999999999964---983899730368887442899999887621368832410----25699999998741576
Q gi|254780485|r   87 LINVDQVLKEAKNAKEN---GATRYCMGAAWREPKERDLSIIVDMIKGVKSLGLETCMT----LGMLSFEQAQILSKAGL  159 (328)
Q Consensus        87 ~~~~Eei~~~a~~~~~~---G~~~~~l~~~~~~~~~~~~~~~~e~i~~i~~~~~~i~~~----~g~~~~~~~~~Lk~aG~  159 (328)
                      ..+...++.++......   -...+-+.+|| +++  -+-++.++++.+...++.+|+-    -|.-+.+....|-+.|+
T Consensus        53 F~pl~~v~~~v~~~L~f~~~~~~kitISgGG-D~S--cYP~l~eL~~~l~~~~lpiHLGYTSGKGfd~~~~a~~li~~Gv  129 (404)
T TIGR03278        53 FIPPQVVLGEVQTSLGFRTGRDTKVTISGGG-DVS--CYPELEELTKGLSDLGLPIHLGYTSGKGFDDPEIAEFLIDNGV  129 (404)
T ss_pred             CCCHHHHHHHHHHHHCCCCCCCEEEEEECCC-CCC--CCCCHHHHHHHHHHCCCCEEECCCCCCCCCCHHHHHHHHHCCC
T ss_conf             7697999999998634567772289980798-844--1631999999998669835741237889898799999996797


Q ss_pred             CEEEEE-CCCCHHHHHCCCCCCCHHHHHHHHHHHHHCCCCC-CCEEEE-CCCCCHHHHHHHHHHHHHCCC
Q ss_conf             069751-3437777320588889899999999999879855-770786-689899999999999974088
Q gi|254780485|r  160 DYYNHN-IDTSERFYPHVTTTHTFEDRLQTLENVRKSGIKV-CCGGIL-GLGEMIDDRIDMLLTLANLST  226 (328)
Q Consensus       160 ~~~~~~-let~~~~~~~~~~~~~~~~~l~~~~~a~~~G~~~-~sg~l~-G~gEt~eeri~~l~~lr~l~~  226 (328)
                      +.+..- +-|.|.+.++-....+++.-|++++..-+.= .+ ++.+++ |. -.-+.....+..|.+.++
T Consensus       130 ~EVtfTVFatDp~LR~ewM~D~~pE~SL~~L~~fc~~c-ev~~A~ViiPGV-NDGevL~kT~~~Le~wGa  197 (404)
T TIGR03278       130 REVSFTVFATDPELRREWMKDPTPEASLQCLRRFCESC-EVHAASVIIPGV-NDGDVLWKTCADLESWGA  197 (404)
T ss_pred             CEEEEEEEECCHHHHHHHCCCCCHHHHHHHHHHHHHHH-HHEEEEEEECCC-CCHHHHHHHHHHHHHHCC
T ss_conf             37999986089899998716998688999999998441-113789980686-856999999999998387


No 111
>pfam05853 DUF849 Prokaryotic protein of unknown function (DUF849). This family consists of several hypothetical prokaryotic proteins with no known function.
Probab=97.27  E-value=0.019  Score=36.11  Aligned_cols=231  Identities=15%  Similarity=0.155  Sum_probs=127.7

Q ss_pred             CCCCCCCCCCCHHHHHHHHHHHHHCCCEEEEEECCC--CCCCCCCHHHHHHHHHHHCCC--CCCEEEECC----CCCHHH
Q ss_conf             775641000685799999999996498389973036--888744289999988762136--883241025----699999
Q gi|254780485|r   79 KSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAW--REPKERDLSIIVDMIKGVKSL--GLETCMTLG----MLSFEQ  150 (328)
Q Consensus        79 ~~~~~~~~~~~~Eei~~~a~~~~~~G~~~~~l~~~~--~~~~~~~~~~~~e~i~~i~~~--~~~i~~~~g----~~~~~~  150 (328)
                      |++.+. --.++|||.+.|....+.|+.-+++-.-.  ..-+..+.+.|.+++..|++.  ++.++++.|    ...++.
T Consensus        15 k~~~P~-lP~Tp~Eia~~A~~c~~AGAsivH~HvRd~~dG~~s~d~~~y~e~i~~Ir~~~pd~ii~~Ttg~~~~~~~eeR   93 (274)
T pfam05853        15 PSDSPA-LPVTPEEIAEEAVAAAEAGAAIVHLHVRDPEDGRPSQDPELFREVLERIREAVPDVIINLTTGGSPGMTVEER   93 (274)
T ss_pred             CCCCCC-CCCCHHHHHHHHHHHHHCCCCEEEEEECCCCCCCCCCCHHHHHHHHHHHHHHCCCCEEEECCCCCCCCCHHHH
T ss_conf             233999-9899899999999999708738998844788899068899999999999987899689945787788988899


Q ss_pred             HHHHHCCCCCEEEEECCCCH-HHH-HCCCCCCCHHHHHHHHHHHHHCCCCCCCEEEECCCCCHHHHHHHHHHHHHCCCCC
Q ss_conf             99874157606975134377-773-2058888989999999999987985577078668989999999999997408888
Q gi|254780485|r  151 AQILSKAGLDYYNHNIDTSE-RFY-PHVTTTHTFEDRLQTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPP  228 (328)
Q Consensus       151 ~~~Lk~aG~~~~~~~let~~-~~~-~~~~~~~~~~~~l~~~~~a~~~G~~~~sg~l~G~gEt~eeri~~l~~lr~l~~~~  228 (328)
                      ++-+.....+...+++.+.. ..+ ....-..+++.-.+..+...+.|++.-. .+|-.|     -+..+..+.+.+..+
T Consensus        94 ~~~v~~~~Pd~aSl~~gs~nf~~~~~d~v~~n~~~~~~~~~~~~~~~gi~pe~-e~yd~g-----~l~~~~~l~~~G~l~  167 (274)
T pfam05853        94 LAPVEALRPEMASLNMGSMNFGLYSRDMVFPNTPADVEEFAARMQEAGVKPEF-ECFDVG-----HLRNAARLLKRGLLK  167 (274)
T ss_pred             HHHHHHCCCCEEEECCCCCCCCCCCCCCEECCCHHHHHHHHHHHHHCCCCEEE-EEECHH-----HHHHHHHHHHHCCCC
T ss_conf             99998609885774466643565677720139999999999999985991499-997799-----999999999708889


Q ss_pred             CEEECCCEEECCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCEEEEHHHHHCHHHHHHHHHHCCC-EEEECCEEECCCC
Q ss_conf             602054112048741244568798999999999999686872142311565165689999980998-8997786651588
Q gi|254780485|r  229 ESIPINLLIPIPGSKFEENKKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGAN-SIFVGDTLLTAKN  307 (328)
Q Consensus       229 ~~v~~~~~~p~~gt~l~~~~~~~~~e~lr~iAi~RL~lP~~~i~i~~~~~~~~~~~~~~~L~~GaN-~~~~g~~~~t~~g  307 (328)
                      .-..+++.   -|.+-  ..+.+++...-++.    .+|.......++.....-.....++..|.+ .+=.||++--.+|
T Consensus       168 ~p~~~~~v---lG~~~--g~~~~p~~L~~~l~----~lp~~~~w~v~~~G~~~~~~~~~A~~~GGhvRVGlEDn~~~~~G  238 (274)
T pfam05853       168 GPLFVQFV---LGVLG--GMPADPENLLHMLR----TLPRGATWSVAGIGRNQLPLAAAAAALGGHVRVGLEDNLYLDKG  238 (274)
T ss_pred             CCCEEEEE---ECCCC--CCCCCHHHHHHHHH----CCCCCCEEEEEECCHHHHHHHHHHHHHCCCEEEECCCCCCCCCC
T ss_conf             99579999---62687--89999999999996----38789718999517544499999998099648705655337899


Q ss_pred             C-------CHHHHHHHHHHCCCCCC
Q ss_conf             8-------98999999998298532
Q gi|254780485|r  308 P-------SYNKDTILFNRLGLIPD  325 (328)
Q Consensus       308 ~-------~~~~~~~~i~~~G~~P~  325 (328)
                      .       -+++..++++++|+.|.
T Consensus       239 ~~A~sNaelV~~~~~ia~~~gr~iA  263 (274)
T pfam05853       239 VLAPSNAQLVERAVRIARELGREVA  263 (274)
T ss_pred             CCCCCHHHHHHHHHHHHHHCCCCCC
T ss_conf             8896889999999999998599989


No 112
>PRK13762 tRNA-modifying enzyme; Provisional
Probab=97.24  E-value=0.02  Score=35.89  Aligned_cols=183  Identities=13%  Similarity=0.207  Sum_probs=99.9

Q ss_pred             CCCCCCCCCCCCCCCCCCCC---CCCCCCHHHHHHHHHHHHHC---CC-----------------EEEEEECCCCCCCCC
Q ss_conf             68342321243354777564---10006857999999999964---98-----------------389973036888744
Q gi|254780485|r   64 GCPENCGYCNQSVHNKSKLK---ASKLINVDQVLKEAKNAKEN---GA-----------------TRYCMGAAWREPKER  120 (328)
Q Consensus        64 ~C~~~C~fCaf~~~~~~~~~---~~~~~~~Eei~~~a~~~~~~---G~-----------------~~~~l~~~~~~~~~~  120 (328)
                      .|.+.|.||=  |+...+..   ...+-++|+|++.+...+..   |.                 +|+.|...|++..  
T Consensus        67 ~C~~~CvfCW--R~~~~~~~~~~~~~~DdPe~Ive~~i~~h~~li~g~kG~p~v~~er~~EA~~p~H~AiSL~GEPtl--  142 (321)
T PRK13762         67 WCNQRCLFCW--RPLEEDVGLLKPPEWDDPEEIVEESIKEQRKLLSGYKGNPKVDKEKFEEALEPKHVAISLSGEPTL--  142 (321)
T ss_pred             HHHCCCEEEC--CCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCCCCCHHHHHHHCCCHHEEHHHCCCCCC--
T ss_conf             7744485656--899888766677888898999999999999997305899998989998727910010220488632--


Q ss_pred             CHHHHHHHHHHHCCCCCCEE-EECCCCCHHHHHHHHCCCCCEEEEECCC-CHHHHHCCCCC---CCHHHHHHHHHHHHHC
Q ss_conf             28999998876213688324-1025699999998741576069751343-77773205888---8989999999999987
Q gi|254780485|r  121 DLSIIVDMIKGVKSLGLETC-MTLGMLSFEQAQILSKAGLDYYNHNIDT-SERFYPHVTTT---HTFEDRLQTLENVRKS  195 (328)
Q Consensus       121 ~~~~~~e~i~~i~~~~~~i~-~~~g~~~~~~~~~Lk~aG~~~~~~~let-~~~~~~~~~~~---~~~~~~l~~~~~a~~~  195 (328)
                       +.++-+.|+..++.++... ++.|.. .+.+++|... ..+..+.++. .++.|.+++..   ..|+.++++++..++.
T Consensus       143 -YP~l~eLi~~~h~r~~stFLVTNg~~-P~~l~~l~~~-PTQLYvSldAp~~e~~k~i~rPl~~d~Wer~~~sL~~L~~~  219 (321)
T PRK13762        143 -YPRLPELIEEFHKRGFTTFLVTNGTR-PDVLEKLEAE-PTQLYVSLDAPDKETYNRINRPVIPDAWERILETLELLPSK  219 (321)
T ss_pred             -CHHHHHHHHHHHHCCCCEEEEECCCC-HHHHHHCCCC-CCEEEEEEECCCHHHHHHHHCCCCHHHHHHHHHHHHHHHCC
T ss_conf             -02189999999857983799828989-8999856676-54279980069999999861655331899999999975437


Q ss_pred             CCCCC--CEEEECCCCCHHHHHHHHHHHHHCCCCCCEEECCCEEE--CCCCCCCCCCCCCHHHHHH
Q ss_conf             98557--70786689899999999999974088886020541120--4874124456879899999
Q gi|254780485|r  196 GIKVC--CGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIP--IPGSKFEENKKVDPIEHVR  257 (328)
Q Consensus       196 G~~~~--sg~l~G~gEt~eeri~~l~~lr~l~~~~~~v~~~~~~p--~~gt~l~~~~~~~~~e~lr  257 (328)
                      +=++.  .|++=|...+..+-..   .|-++. .|++|-+-.+..  ..-..|.....|.-+|...
T Consensus       220 ~~RTV~R~TLVkg~Nm~~~~~yA---~Li~~~-~P~FIEvK~ym~~G~Sr~rLt~~nmP~heEV~~  281 (321)
T PRK13762        220 KTRTVIRITLVKGLNMTDPEGYA---KLIERA-NPDFVEVKAYMHVGYSRNRLTRDNMPSHEEVRE  281 (321)
T ss_pred             CCCEEEEEEEECCCCCCCHHHHH---HHHHHC-CCCEEEEEEEEEECCCCCCCCHHHCCCHHHHHH
T ss_conf             98759999876565767989999---999854-998798711798426777677223998899999


No 113
>pfam10113 Fibrillarin_2 Fibrillarin-like archaeal protein. Members of this family of proteins include archaeal fibrillarin homologs.
Probab=97.02  E-value=0.0084  Score=38.45  Aligned_cols=105  Identities=23%  Similarity=0.347  Sum_probs=77.6

Q ss_pred             CCHHHHHHHHHHHHHCCCCCCCEEEECCCCCHHHHHHHHHHHHHCCCCCCEEECCCEEECCCCCCCCCCCCCHHHHHHHH
Q ss_conf             89899999999999879855770786689899999999999974088886020541120487412445687989999999
Q gi|254780485|r  180 HTFEDRLQTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEHVRII  259 (328)
Q Consensus       180 ~~~~~~l~~~~~a~~~G~~~~sg~l~G~gEt~eeri~~l~~lr~l~~~~~~v~~~~~~p~~gt~l~~~~~~~~~e~lr~i  259 (328)
                      .+.++--++.+.|++.|--+.+  |+=.|+..+|.+.-+..--++++..       |+ .+|.||..... ....+.|.+
T Consensus       203 Apl~Eme~Va~~A~k~gkGvEa--I~hiGDGyDdLI~G~~a~~dl~vDv-------fV-vEGgPFNrakd-rl~aFakaV  271 (505)
T pfam10113       203 APLDEMKEVAETARKYGKGVEA--IFHVGDGYDDLITGLKAALDLDVDV-------FV-VEGGPFNRAKD-RLKAFARAV  271 (505)
T ss_pred             CCHHHHHHHHHHHHHHCCCCEE--EEEECCCHHHHHHHHHHHHHCCCCE-------EE-EECCCCCCCCC-HHHHHHHHH
T ss_conf             8879999999999984878348--9971477488999999876158758-------99-80787654433-689999888


Q ss_pred             HHHHHHCCCCCCEEEEHHHHHCHHHHHHHHHHCCCEEEEC
Q ss_conf             9999968687214231156516568999998099889977
Q gi|254780485|r  260 SVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVG  299 (328)
Q Consensus       260 Ai~RL~lP~~~i~i~~~~~~~~~~~~~~~L~~GaN~~~~g  299 (328)
                      |++||+.|...+.--+..|    +-...+|.+|-|.|++|
T Consensus       272 a~sRIL~~G~VVaTNGAYE----dEcRiGLRsGLN~iitG  307 (505)
T pfam10113       272 AASRILVPGKVVATNGAYE----DECRVGLRAGLNAILTG  307 (505)
T ss_pred             HHHHEECCCCEEECCCCHH----HHHHHHHHHCCCEEECC
T ss_conf             8751000684873276107----77888776144311116


No 114
>TIGR03365 Bsubt_queE 7-cyano-7-deazaguanosine (preQ0) biosynthesis protein QueE. This uncharacterized enzyme, designated QueE, participates in the biosynthesis, from GTP, of 7-cyano-7-deazaguanosine, also called preQ0 because in many species it is a precursor of queuosine. In most Archaea, it is instead the precursor of a different tRNA modified base, archaeosine.
Probab=96.70  E-value=0.0078  Score=38.66  Aligned_cols=88  Identities=16%  Similarity=0.319  Sum_probs=50.8

Q ss_pred             EEECCCCCCCCCCCCCCC-CCCCCCCCCCCCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCCCCHHHHHHHHHHHCCCC
Q ss_conf             453078683423212433-5477756410006857999999999964983899730368887442899999887621368
Q gi|254780485|r   58 LNIKTGGCPENCGYCNQS-VHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLG  136 (328)
Q Consensus        58 in~~TN~C~~~C~fCaf~-~~~~~~~~~~~~~~~Eei~~~a~~~~~~G~~~~~l~~~~~~~~~~~~~~~~e~i~~i~~~~  136 (328)
                      +.+....|..+|.||-=. .-..........++.++|.+++.........++++ +||++....+   +.+.++.+++.+
T Consensus        25 vFvR~~GCnl~C~~CDT~y~~~~~~~~~~~~~~~~~i~~~~~~~~~~~~~~V~i-TGGEPllq~~---~~~L~~~l~~~g  100 (238)
T TIGR03365        25 MFVRTGGCDYRCSWCDSLFTWDGSAKDTWRPMTAEEVWQELKALGGGTPLHVSL-SGGNPALQKP---LGELIDLGKAKG  100 (238)
T ss_pred             EEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHCCCCCCEEEE-CCCCHHHHCC---HHHHHHHHHHCC
T ss_conf             999408989867658988761787887756378999999999834898618994-5998344418---999999998579


Q ss_pred             CCEEEE-CCCCCHH
Q ss_conf             832410-2569999
Q gi|254780485|r  137 LETCMT-LGMLSFE  149 (328)
Q Consensus       137 ~~i~~~-~g~~~~~  149 (328)
                      ..+.+. .|.+..+
T Consensus       101 ~~v~iETnGt~~~~  114 (238)
T TIGR03365       101 YRFALETQGSVWQD  114 (238)
T ss_pred             CEEEEECCCCCCCC
T ss_conf             84999789987600


No 115
>PRK00915 2-isopropylmalate synthase; Validated
Probab=96.54  E-value=0.074  Score=32.11  Aligned_cols=19  Identities=26%  Similarity=0.368  Sum_probs=8.2

Q ss_pred             HHHHCCCCCCCEEEECCCC
Q ss_conf             9998798557707866898
Q gi|254780485|r  191 NVRKSGIKVCCGGILGLGE  209 (328)
Q Consensus       191 ~a~~~G~~~~sg~l~G~gE  209 (328)
                      .|-++|-.--.|-+.|+||
T Consensus       216 aAv~AGA~~V~~TvnGiGE  234 (511)
T PRK00915        216 AAVEGGARQVECTINGIGE  234 (511)
T ss_pred             HHHHHCCCCEEEEEECCCC
T ss_conf             9998390501016960255


No 116
>COG1625 Fe-S oxidoreductase, related to NifB/MoaA family [Energy production and conversion]
Probab=96.49  E-value=0.079  Score=31.91  Aligned_cols=204  Identities=15%  Similarity=0.160  Sum_probs=115.9

Q ss_pred             CCCCCCC---CCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCEEE----EEECCCCCCCCCCHHHHHHHHHHHCC
Q ss_conf             7868342---3212433547775641000685799999999996498389----97303688874428999998876213
Q gi|254780485|r   62 TGGCPEN---CGYCNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRY----CMGAAWREPKERDLSIIVDMIKGVKS  134 (328)
Q Consensus        62 TN~C~~~---C~fCaf~~~~~~~~~~~~~~~~Eei~~~a~~~~~~G~~~~----~l~~~~~~~~~~~~~~~~e~i~~i~~  134 (328)
                      ...|...   |.||..+-.-.   .. .......+.++...  +.|...-    ..+++++++...  -.+.+.++..+.
T Consensus        34 ~~~c~~~~~~C~~cy~~v~~~---~~-~~~~~~~v~~e~~~--~lg~~~e~~~~~~~~~~~d~~c~--p~le~~~~r~~~  105 (414)
T COG1625          34 CKDCIPYRFGCDDCYLSVNEL---DT-GFIPPLMVEKEPDE--DLGLEFEEVLGAKQCGNGDTFCY--PDLEPRGRRARL  105 (414)
T ss_pred             CCCCCCCCCCCCCEEEEEECC---CC-CCCCHHHHHCCCCC--CCCCCCCCCCCEEECCCCCCCCC--CCHHHHHHHHHH
T ss_conf             876877643502100588515---67-77887674235343--32433000112011279986657--311126667876


Q ss_pred             CC----CCEEEEC--CCCCHHHHHHHHCCCCCEEEEECCC-CHHHHHCCCCCCCHHHHHHHHHHHHHCCCCCCCEEEECC
Q ss_conf             68----8324102--5699999998741576069751343-777732058888989999999999987985577078668
Q gi|254780485|r  135 LG----LETCMTL--GMLSFEQAQILSKAGLDYYNHNIDT-SERFYPHVTTTHTFEDRLQTLENVRKSGIKVCCGGILGL  207 (328)
Q Consensus       135 ~~----~~i~~~~--g~~~~~~~~~Lk~aG~~~~~~~let-~~~~~~~~~~~~~~~~~l~~~~~a~~~G~~~~sg~l~G~  207 (328)
                      ..    ..+.-..  |.......+++.++|++.+...+-| .|++.++........+.++.+++..+.++.+-+-+++=.
T Consensus       106 ~~~d~~~rL~~tsG~~~~lt~~~~~i~~~gvdev~~SVhtT~p~lR~klm~n~~A~~~le~L~~f~~~~~~v~a~iVl~P  185 (414)
T COG1625         106 YYKDDDIRLSFTSGSGFTLTNRAERIIDAGVDEVYFSVHTTNPELRAKLMKNPNAEQLLELLRRFAERCIEVHAQIVLCP  185 (414)
T ss_pred             HCCCCCCEEEEEECCCEECCCHHHHHHHCCCCEEEEEEEECCHHHHHHHHCCCCHHHHHHHHHHHHHHHHHEEEEEEECC
T ss_conf             15884403565312630154268999976998069999608989999986398677899999999975311356799857


Q ss_pred             CCC-HHHHHHHHHHHHHCCCCCCEEECCCEEECCCCCCCC--CCCCCHHHHHHHHHHHHHHCCCCC-CEEEE
Q ss_conf             989-999999999997408888602054112048741244--568798999999999999686872-14231
Q gi|254780485|r  208 GEM-IDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEE--NKKVDPIEHVRIISVARILMPKSR-LRLAA  275 (328)
Q Consensus       208 gEt-~eeri~~l~~lr~l~~~~~~v~~~~~~p~~gt~l~~--~~~~~~~e~lr~iAi~RL~lP~~~-i~i~~  275 (328)
                      |-. -++.-+.+..|.+++.  +.++++.+.|+--|....  .+++++.+..++-.+.|=+.-... +.+++
T Consensus       186 GvNdge~L~kT~~dL~~~g~--~~~~~~~~~pvGlt~~n~~~i~~~t~~~l~~~k~i~re~~~E~~~~~V~g  255 (414)
T COG1625         186 GVNDGEELEKTLEDLEEWGA--HEVILMRVVPVGLTRYNRPGIRPPTPHELEEFKEIVREFDRELGSIRVTG  255 (414)
T ss_pred             CCCCHHHHHHHHHHHHHHCC--CCEEEEEEECCEEEECCCCCCCCCCHHHHHHHHHHHHHHHHHCCCEEEEC
T ss_conf             85757779999999997286--73368986312115237777787787899999999999997538669837


No 117
>TIGR03279 cyano_FeS_chp putative FeS-containing Cyanobacterial-specific oxidoreductase. Members of this protein family are predicted FeS-containing oxidoreductases of unknown function, apparently restricted to and universal across the Cyanobacteria. The high trusted cutoff score for this model, 700 bits, excludes homologs from other lineages. This exclusion seems justified because a significant number of sequence positions are simultaneously unique to and invariant across the Cyanobacteria, suggesting a specialized, conserved function, perhaps related to photosynthesis. A distantly related protein family, TIGR03278, in universal in and restricted to archaeal methanogens, and may be linked to methanogenesis.
Probab=96.20  E-value=0.11  Score=30.84  Aligned_cols=140  Identities=14%  Similarity=0.071  Sum_probs=62.1

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCEEEE-EECCCCCCCCCCHHHHHHHHHHH-CCCCCCEE
Q ss_conf             86834232124335477756410006857999999999964983899-73036888744289999988762-13688324
Q gi|254780485|r   63 GGCPENCGYCNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYC-MGAAWREPKERDLSIIVDMIKGV-KSLGLETC  140 (328)
Q Consensus        63 N~C~~~C~fCaf~~~~~~~~~~~~~~~~Eei~~~a~~~~~~G~~~~~-l~~~~~~~~~~~~~~~~e~i~~i-~~~~~~i~  140 (328)
                      .-|.|+|-||=..--+++-.+..|..++|              .|+. +++..-+...-.-+.+..+++.. ....+.+|
T Consensus        82 r~C~N~C~FCFidQlP~GmR~sLY~KDDD--------------yRLSFL~GNfiTLTNl~e~D~~RIi~~rLSPl~ISVH  147 (433)
T TIGR03279        82 IQCNNRCPFCFIDQQPPGKRESLYLKDDD--------------YRLSFLYGSYLTLTNLPPAEWQRIEQLRLSPLYVSVH  147 (433)
T ss_pred             HHCCCCCCEEEECCCCCCCCCCEEEECCC--------------EEEEEECCCEEEEECCCHHHHHHHHHHCCCCEEEEEE
T ss_conf             33177785686466885554641462486--------------3453201525765179989999999825786389986


Q ss_pred             EECC------------CCCHHHHHHHHCCCCCEEEEECCCCHHHHHCCCCCC-CHHHHHHHHHHHHHCC------CCCCC
Q ss_conf             1025------------699999998741576069751343777732058888-9899999999999879------85577
Q gi|254780485|r  141 MTLG------------MLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTH-TFEDRLQTLENVRKSG------IKVCC  201 (328)
Q Consensus       141 ~~~g------------~~~~~~~~~Lk~aG~~~~~~~let~~~~~~~~~~~~-~~~~~l~~~~~a~~~G------~~~~s  201 (328)
                      ++-.            ...-+.+++|.++|+....=         -.+||+. +.++--+|++...++.      +.+-+
T Consensus       148 aT~pelR~~mL~n~~ag~il~~l~~L~~~gI~~h~Q---------IVLCPGiNDG~~L~rTi~DL~~~~~~~~P~v~Sva  218 (433)
T TIGR03279       148 ATEPSLRARLLKNPRAGLILEQLKWFQERRLQLHAQ---------VVVCPGINDGKHLERTLRDLAQFHDGDWPTVLSVA  218 (433)
T ss_pred             CCCHHHHHHHHCCCCHHHHHHHHHHHHHCCCEEEEE---------EEECCCCCCHHHHHHHHHHHHHHHCCCCCCEEEEE
T ss_conf             399899999876995789999999999769879847---------99879967669999899999986124688425777


Q ss_pred             EEEECCC-----------CCHHHHHHHHHHHHHCC
Q ss_conf             0786689-----------89999999999997408
Q gi|254780485|r  202 GGILGLG-----------EMIDDRIDMLLTLANLS  225 (328)
Q Consensus       202 g~l~G~g-----------Et~eeri~~l~~lr~l~  225 (328)
                      =.-+|+-           -|.++-.+.+..+...|
T Consensus       219 vVPVGlTk~R~~l~~l~~~~~e~A~~vi~~ve~~Q  253 (433)
T TIGR03279       219 VVPVGLTRFRPEEDELTPVTPECARRVIAQVEALQ  253 (433)
T ss_pred             EEECCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHH
T ss_conf             88324213578999872189999999999999999


No 118
>PRK11858 aksA trans-homoaconitate synthase; Reviewed
Probab=96.19  E-value=0.12  Score=30.81  Aligned_cols=215  Identities=14%  Similarity=0.151  Sum_probs=120.2

Q ss_pred             CCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCCCCHHHHHHHHHHHCCCCC--CEEEECCCCCHHHHHHHHCCCCCEEE
Q ss_conf             0068579999999999649838997303688874428999998876213688--32410256999999987415760697
Q gi|254780485|r   86 KLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLGL--ETCMTLGMLSFEQAQILSKAGLDYYN  163 (328)
Q Consensus        86 ~~~~~Eei~~~a~~~~~~G~~~~~l~~~~~~~~~~~~~~~~e~i~~i~~~~~--~i~~~~g~~~~~~~~~Lk~aG~~~~~  163 (328)
                      ..++.|+-++.++.+.+.|+.++-.+  .......+.    +.++.+.+.++  .+.. ......+.+....++|++.+.
T Consensus        21 ~~fs~~~K~~ia~~L~~~GV~~IEvG--~P~~~~~e~----~~~~~i~~~~l~~~i~~-~~R~~~~di~~a~~~g~~~v~   93 (378)
T PRK11858         21 VVFTNEEKLAIARMLDEIGVDQIEAG--FPAVSEDEK----EAIKAIAKLGLNASILA-WNRAVKSDIDASIDCGVDAVH   93 (378)
T ss_pred             CCCCHHHHHHHHHHHHHCCCCEEEEE--CCCCCCCHH----HHHHHHHHCCCCCEEEE-ECCCCHHHHHHHHHCCCCEEE
T ss_conf             99999999999999998198999994--777783489----99999985679845887-403578779999857969899


Q ss_pred             EECCCCHHHHHCCCCCCCHHH----HHHHHHHHHHCCCCCCCEEEECCCCCHHHHHHHHHHHHHCCCCCCEEECCCEEEC
Q ss_conf             513437777320588889899----9999999998798557707866898999999999999740888860205411204
Q gi|254780485|r  164 HNIDTSERFYPHVTTTHTFED----RLQTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPI  239 (328)
Q Consensus       164 ~~let~~~~~~~~~~~~~~~~----~l~~~~~a~~~G~~~~sg~l~G~gEt~eeri~~l~~lr~l~~~~~~v~~~~~~p~  239 (328)
                      +.+-+++......- +.+.++    -.++++.|++.|+.+..+..-+.--.++..++.+..+.+.+.  +.|      -.
T Consensus        94 i~~~~Sd~h~~~~l-~~t~~e~l~~~~~~v~~Ak~~Gl~v~f~~eD~~r~~~~~l~~~~~~a~~~Ga--d~I------~l  164 (378)
T PRK11858         94 IFIATSDIHLKYKL-KKTREEVLERLVEAVEYAKDHGLYVSFSAEDASRTDLDFLIEAAKAAEEAGA--DRV------RF  164 (378)
T ss_pred             EEECCCHHHHHHHH-CCCHHHHHHHHHHHHHHHHHCCCEEEEEEECCCCCCHHHHHHHHHHHHHCCC--CEE------EE
T ss_conf             99606799999996-8998999999999999999769869994401256899999999999997499--899------96


Q ss_pred             CCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCEEEEHHHHHC--HHHHHHHHHHCCC---EEE--ECCEEECCCCCCHHH
Q ss_conf             874124456879899999999999968687214231156516--5689999980998---899--778665158889899
Q gi|254780485|r  240 PGSKFEENKKVDPIEHVRIISVARILMPKSRLRLAAGRAMMS--DELQALCFFSGAN---SIF--VGDTLLTAKNPSYNK  312 (328)
Q Consensus       240 ~gt~l~~~~~~~~~e~lr~iAi~RL~lP~~~i~i~~~~~~~~--~~~~~~~L~~GaN---~~~--~g~~~~t~~g~~~~~  312 (328)
                      ++|    ....+|.+.-+++.-.|-..| ..+.+-+ --+.|  .-..-.|+.+||+   +++  +||   .+++.+.++
T Consensus       165 ~DT----~G~~~P~~v~~~v~~l~~~~~-~~i~~H~-HNd~GlAvANalaAv~AGa~~v~~Tv~GiGE---RaGNa~le~  235 (378)
T PRK11858        165 CDT----VGILDPFTMYELVKELVEAVD-IPIEVHC-HNDFGMATANAIAGIEAGATQVHTTVNGLGE---RAGNAALEE  235 (378)
T ss_pred             CCC----CCCCCHHHHHHHHHHHHHHCC-CCEEEEE-ECCCCHHHHHHHHHHHHCCCEEEEEEEEEEC---CCCCCCHHH
T ss_conf             365----566699999999999997269-8559997-0775559999999998099989987544654---656614999


Q ss_pred             HHHHHH-HCCCCCC
Q ss_conf             999999-8298532
Q gi|254780485|r  313 DTILFN-RLGLIPD  325 (328)
Q Consensus       313 ~~~~i~-~~G~~P~  325 (328)
                      ..--++ ..|..+.
T Consensus       236 v~~~L~~~~~~~~~  249 (378)
T PRK11858        236 VVMALKYLYGIDLG  249 (378)
T ss_pred             HHHHHHHHCCCCCC
T ss_conf             99999974497766


No 119
>TIGR02494 PFLE_PFLC glycyl-radical enzyme activating protein family; InterPro: IPR012839    This subset of the radical-SAM domain includes a number of probable activating proteins acting on different enzymes all requiring an amino-acid-centred radical. The closest relatives to this family are the pyruvate-formate lyase activating enzyme (PflA, 1.97.1.4 from EC, IPR012838 from INTERPRO) and the anaerobic ribonucleotide reductase activating enzyme (IPR012837 from INTERPRO). Included within this subfamily are activators of hydroxyphenyl acetate decarboxylase (HdpA, ), benzylsuccinate synthase (BssD, ), gycerol dehydratase (DhaB2, ) as well as enzymes annotated in Escherichia coli as activators of different isozymes of pyruvate-formate lyase (PFLC and PFLE) however, these appear to lack characterisation and may activate enzymes with distinctive functions. Most of the sequence-level variability between these forms is concentrated within an N-terminal domain, which follows a conserved group of three cysteines and contains a variable pattern of 0 to 8 additional cysteines..
Probab=95.82  E-value=0.17  Score=29.73  Aligned_cols=197  Identities=16%  Similarity=0.181  Sum_probs=120.5

Q ss_pred             EEEEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHH----HC-CCEEEEEECCCCCCCCCCHHHHH
Q ss_conf             69998645307868342321243354777564100068579999999999----64-98389973036888744289999
Q gi|254780485|r   52 IQLSKLLNIKTGGCPENCGYCNQSVHNKSKLKASKLINVDQVLKEAKNAK----EN-GATRYCMGAAWREPKERDLSIIV  126 (328)
Q Consensus        52 V~~~~~in~~TN~C~~~C~fCaf~~~~~~~~~~~~~~~~Eei~~~a~~~~----~~-G~~~~~l~~~~~~~~~~~~~~~~  126 (328)
                      ...++.-....+-|+..|..=|++-       ....+|.|||++.++.-.    .. |.-+  + +||+ | ....|...
T Consensus        81 ~~~~~~~c~~Cg~C~~~Cp~~Al~~-------~G~~~tV~ev~~~~~~D~~fY~~SGGGvT--l-SGGE-P-l~Q~eF~~  148 (305)
T TIGR02494        81 ISIRREKCTGCGKCTEACPSGALEI-------VGKEMTVEEVMRVVLRDSIFYRNSGGGVT--L-SGGE-P-LLQPEFAL  148 (305)
T ss_pred             EEECCCCCCCCCCHHHCCCCHHHHE-------ECCCCCHHHHHHHHHHHHHHHHHCCCEEE--E-CCCC-C-CCCHHHHH
T ss_conf             1000017741110110384006420-------24514889999999865566651399067--3-4871-1-40158999


Q ss_pred             HHHHHHCCCCCCEEEE-CCCCCHHHHHHHHCCCCCEEEEECCC-CHHHHHCCCCCCCHHHHHHHHHHHHHCC----CCCC
Q ss_conf             9887621368832410-25699999998741576069751343-7777320588889899999999999879----8557
Q gi|254780485|r  127 DMIKGVKSLGLETCMT-LGMLSFEQAQILSKAGLDYYNHNIDT-SERFYPHVTTTHTFEDRLQTLENVRKSG----IKVC  200 (328)
Q Consensus       127 e~i~~i~~~~~~i~~~-~g~~~~~~~~~Lk~aG~~~~~~~let-~~~~~~~~~~~~~~~~~l~~~~~a~~~G----~~~~  200 (328)
                      +++++.++.+++.++. .|..+.+.+.++... +|-++..+.. +++.+++. ++.+.+.-|+=++.+.++|    .++.
T Consensus       149 ~LL~~c~~~gihTAvET~gft~~~~~~~~~~~-~DLfL~DiK~~D~~~H~~~-tG~~N~~IL~NL~~L~~~~~~GG~~v~  226 (305)
T TIGR02494       149 ALLKACRERGIHTAVETSGFTPWETIEKVLPY-VDLFLYDIKHLDDERHKEV-TGVDNELILENLEALLAAGKDGGKNVV  226 (305)
T ss_pred             HHHHHHHHCCCCEEECCCCCCCHHHHHHHHHH-HHHHHHHHHHCCCHHHHHH-CCCCHHHHHHHHHHHHHHCCCCCCEEE
T ss_conf             99999975899467605568888999988887-7699872641180120553-389837899999999971788995589


Q ss_pred             CEE--EECCCCCHHHHHHHHHHHHHCCCC-CCEEECCCEEE---C-------CCCCCCCCCCCCHHHHHHHHHHH
Q ss_conf             707--866898999999999999740888-86020541120---4-------87412445687989999999999
Q gi|254780485|r  201 CGG--ILGLGEMIDDRIDMLLTLANLSTP-PESIPINLLIP---I-------PGSKFEENKKVDPIEHVRIISVA  262 (328)
Q Consensus       201 sg~--l~G~gEt~eeri~~l~~lr~l~~~-~~~v~~~~~~p---~-------~gt~l~~~~~~~~~e~lr~iAi~  262 (328)
                      .=|  |=|.-.+.|++-+.+..+++.+.. ...|=+-||+.   .       +..|+...+.++.+...++-++.
T Consensus       227 iR~PvIpG~Nds~~~i~a~~~f~~~~~~~N~~~i~LLPyH~lG~~KY~~LG~~~~~~~~~~~~~~e~~~~l~~~~  301 (305)
T TIGR02494       227 IRIPVIPGFNDSEENIEAIAEFLRKLLPGNVKEIDLLPYHRLGENKYRQLGREYYPDSEIPDPAEEQLLELKEIF  301 (305)
T ss_pred             EEEECCCCCCCCHHHHHHHHHHHHHHHCCCCCEEEECCCHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHHHHH
T ss_conf             987204898989899999999999851789765674486055679998558867778888886667899999999


No 120
>COG0602 NrdG Organic radical activating enzymes [Posttranslational modification, protein turnover, chaperones]
Probab=95.79  E-value=0.032  Score=34.54  Aligned_cols=87  Identities=16%  Similarity=0.289  Sum_probs=46.7

Q ss_pred             EEEECCCCCCCCCCCCCCCC-CCCCCCCCCCCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCCCCHHHHHHHHHHHCCC
Q ss_conf             64530786834232124335-47775641000685799999999996498389973036888744289999988762136
Q gi|254780485|r   57 LLNIKTGGCPENCGYCNQSV-HNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSL  135 (328)
Q Consensus        57 ~in~~TN~C~~~C~fCaf~~-~~~~~~~~~~~~~~Eei~~~a~~~~~~G~~~~~l~~~~~~~~~~~~~~~~e~i~~i~~~  135 (328)
                      -+.+.++.|..+|.||--.. ........+...+.|+|+..++... .+...+++ +||++.....+..+++   .++..
T Consensus        24 ~vFVR~~GC~l~C~~Cdt~~t~~~~~~~~~~~~~~~~I~~~i~~~~-~~~~~V~l-TGGEP~~~~~l~~Ll~---~l~~~   98 (212)
T COG0602          24 SVFVRFAGCNLRCPGCDTKYTWDFNYGKPGTPMSADEILADIKSLG-YKARGVSL-TGGEPLLQPNLLELLE---LLKRL   98 (212)
T ss_pred             EEEEECCCCCCCCCCCCCHHHCCCCCCCCCCCCCHHHHHHHHHHCC-CCCCEEEE-ECCCCCCCCCHHHHHH---HHHHC
T ss_conf             8999768978878998987660633368988258999999998508-88766998-1886466223999999---99858


Q ss_pred             CCCEEEEC-CCCCH
Q ss_conf             88324102-56999
Q gi|254780485|r  136 GLETCMTL-GMLSF  148 (328)
Q Consensus       136 ~~~i~~~~-g~~~~  148 (328)
                      +..+.+.. |.+..
T Consensus        99 g~~~~lETngti~~  112 (212)
T COG0602          99 GFRIALETNGTIPV  112 (212)
T ss_pred             CCEEEEECCCCCCC
T ss_conf             84099837997155


No 121
>COG4018 Uncharacterized protein conserved in archaea [Function unknown]
Probab=95.72  E-value=0.052  Score=33.14  Aligned_cols=104  Identities=25%  Similarity=0.320  Sum_probs=72.3

Q ss_pred             CHHHHHHHHHHHHHCCCCCCCEEEECCCCCHHHHHHHHHHHHHCCCCCCEEECCCEEECCCCCCCCCCCCCHHHHHHHHH
Q ss_conf             98999999999998798557707866898999999999999740888860205411204874124456879899999999
Q gi|254780485|r  181 TFEDRLQTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEHVRIIS  260 (328)
Q Consensus       181 ~~~~~l~~~~~a~~~G~~~~sg~l~G~gEt~eeri~~l~~lr~l~~~~~~v~~~~~~p~~gt~l~~~~~~~~~e~lr~iA  260 (328)
                      ..++--++.+.|++.|--+.+  |+-.|+...|.++-+..--++.+..       | -.+|.||.... -...-+.+.+|
T Consensus       204 PLeEmk~VaEtArk~GkGvea--I~hvgDGyDdli~G~kA~ve~~vDv-------f-vvEGgPFNrA~-dRL~AFa~Ava  272 (505)
T COG4018         204 PLEEMKRVAETARKSGKGVEA--ILHVGDGYDDLIDGLKAAVEEVVDV-------F-VVEGGPFNRAE-DRLSAFARAVA  272 (505)
T ss_pred             CHHHHHHHHHHHHHHCCCCEE--EEEECCCCHHHHHHHHHHHHHCCCE-------E-EECCCCCCHHH-HHHHHHHHHHH
T ss_conf             789999999999870888216--9882477077888999998744838-------9-98178754166-78999998787


Q ss_pred             HHHHHCCCCCCEEEEHHHHHCHHHHHHHHHHCCCEEEEC
Q ss_conf             999968687214231156516568999998099889977
Q gi|254780485|r  261 VARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVG  299 (328)
Q Consensus       261 i~RL~lP~~~i~i~~~~~~~~~~~~~~~L~~GaN~~~~g  299 (328)
                      ++|++-|...+.--+..|    +-...+|.+|-|++++|
T Consensus       273 a~Ril~pGkvVaTNGAYE----DEcrvGLRaGLN~iltG  307 (505)
T COG4018         273 ACRILAPGKVVATNGAYE----DECRVGLRAGLNGILTG  307 (505)
T ss_pred             HHEECCCCCEEEECCCCH----HHHHHHHHHCHHHHHCC
T ss_conf             640104783784067413----66787677320156507


No 122
>PRK09389 (R)-citramalate synthase; Provisional
Probab=95.70  E-value=0.19  Score=29.41  Aligned_cols=20  Identities=30%  Similarity=0.446  Sum_probs=8.5

Q ss_pred             HHHHHCCCCCCCEEEECCCC
Q ss_conf             99998798557707866898
Q gi|254780485|r  190 ENVRKSGIKVCCGGILGLGE  209 (328)
Q Consensus       190 ~~a~~~G~~~~sg~l~G~gE  209 (328)
                      ..|-.+|-.---|-+.|+||
T Consensus       204 laAv~aGA~~V~~TvnG~GE  223 (487)
T PRK09389        204 LAALAAGADQCHVTINGIGE  223 (487)
T ss_pred             HHHHHHCCCEEEEEECCCCC
T ss_conf             99999502664334204674


No 123
>cd00003 PNPsynthase Pyridoxine 5'-phosphate (PNP) synthase domain; pyridoxal 5'-phosphate is the active form of vitamin B6 that acts as an essential, ubiquitous coenzyme in amino acid metabolism. In bacteria, formation of pyridoxine 5'-phosphate is a step in the biosynthesis of vitamin B6. PNP synthase, a homooctameric enzyme, catalyzes the final step in PNP biosynthesis, the condensation of 1-amino-acetone 3-phosphate and 1-deoxy-D-xylulose 5-phosphate. PNP synthase adopts a TIM barrel topology, intersubunit contacts are mediated by three ''extra'' helices, generating a tetramer of symmetric dimers with shared active sites; the open state has been proposed to accept substrates and to release products, while most of the catalytic events are likely to occur in the closed state; a hydrophilic channel running through the center of the barrel was identified as the essential structural feature that enables PNP synthase to release water molecules produced during the reaction from the closed,
Probab=95.62  E-value=0.13  Score=30.57  Aligned_cols=117  Identities=14%  Similarity=0.148  Sum_probs=75.3

Q ss_pred             HHHHHHHHHHHHHCCCEEEEEE--------CCCCCCCCCCHHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHCCCCCE
Q ss_conf             5799999999996498389973--------03688874428999998876213688324102569999999874157606
Q gi|254780485|r   90 VDQVLKEAKNAKENGATRYCMG--------AAWREPKERDLSIIVDMIKGVKSLGLETCMTLGMLSFEQAQILSKAGLDY  161 (328)
Q Consensus        90 ~Eei~~~a~~~~~~G~~~~~l~--------~~~~~~~~~~~~~~~e~i~~i~~~~~~i~~~~g~~~~~~~~~Lk~aG~~~  161 (328)
                      .+++++.|...   --..+|+|        +.++.......+.+.+.++.+++.++.+.+=+ ..+.+++...++.|+|.
T Consensus        72 ~~emi~ia~~~---kP~~vtLVPe~r~elTTegGld~~~~~~~L~~~i~~lk~~~IrvSLFI-DPd~~qi~~a~~~Gad~  147 (234)
T cd00003          72 TEEMLEIALEV---KPHQVTLVPEKREELTTEGGLDVAGQAEKLKPIIERLKDAGIRVSLFI-DPDPEQIEAAKEVGADR  147 (234)
T ss_pred             CHHHHHHHHHC---CCCEEEECCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCEEEEEE-CCCHHHHHHHHHHCCCE
T ss_conf             38999999984---998789878887864178892665478899999999986598279972-79878999999849399


Q ss_pred             EEEECCCCHHHHHCCCCCCCHHHHHHHHHHHHHCCCCCCCEEEECCCCCHHHH
Q ss_conf             97513437777320588889899999999999879855770786689899999
Q gi|254780485|r  162 YNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSGIKVCCGGILGLGEMIDDR  214 (328)
Q Consensus       162 ~~~~let~~~~~~~~~~~~~~~~~l~~~~~a~~~G~~~~sg~l~G~gEt~eer  214 (328)
                      +.+.-+..-..+...-....++...++.+.|+++|+.+++    |||=+.+-.
T Consensus       148 VElhTG~Ya~a~~~~~~~~el~~i~~aa~~A~~lGL~VnA----GHgLn~~Nl  196 (234)
T cd00003         148 VELHTGPYANAYDKAEREAELERIAKAAKLARELGLGVNA----GHGLNYENV  196 (234)
T ss_pred             EEEECHHHHHHCCCHHHHHHHHHHHHHHHHHHHCCCEEEC----CCCCCHHHH
T ss_conf             9982478786348103999999999999999985987854----789887679


No 124
>PRK05211 consensus
Probab=95.51  E-value=0.22  Score=28.96  Aligned_cols=215  Identities=11%  Similarity=0.113  Sum_probs=115.1

Q ss_pred             HHHHHHHHHHHCCCEEEEEECCCCCCCCCCHHHHHHHHHHH-CCCCCCEEEECCCCCHHHHHHHHCCCCCEEEEECCC--
Q ss_conf             99999999996498389973036888744289999988762-136883241025699999998741576069751343--
Q gi|254780485|r   92 QVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGV-KSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDT--  168 (328)
Q Consensus        92 ei~~~a~~~~~~G~~~~~l~~~~~~~~~~~~~~~~e~i~~i-~~~~~~i~~~~g~~~~~~~~~Lk~aG~~~~~~~let--  168 (328)
                      ..++.|+...+.|+.+++++--......+.  .-.++++.+ ++.++.+.+.-|..+.++.+++.++|++.+.++--.  
T Consensus        22 DP~~~ak~~~~~gadelhivDld~a~~g~~--~n~~~I~~i~~~~~~Pl~vGGGIrs~~~i~~ll~~GadkViigs~a~~   99 (248)
T PRK05211         22 DIVPLAKRYAEEGADELVFYDITASSDGRV--VDKSWVSRVAEVIDIPFCVAGGIKSVEDAREILSFGADKISINSPALA   99 (248)
T ss_pred             CHHHHHHHHHHCCCCEEEEEECCCCCCCCC--CHHHHHHHHHHHCCCCEEEECCCCCHHHHHHHHHCCCCEEEECCHHHH
T ss_conf             999999999986999899997867767872--149999999976798589627801389999999879988998976761


Q ss_pred             CHHHHHCCCCCCCHHHHHHHHHHHHHCCCCCCCEEEECC-C------CCHHHHHHHHHHHHHCCCCCCEEECCCEEECCC
Q ss_conf             777732058888989999999999987985577078668-9------899999999999974088886020541120487
Q gi|254780485|r  169 SERFYPHVTTTHTFEDRLQTLENVRKSGIKVCCGGILGL-G------EMIDDRIDMLLTLANLSTPPESIPINLLIPIPG  241 (328)
Q Consensus       169 ~~~~~~~~~~~~~~~~~l~~~~~a~~~G~~~~sg~l~G~-g------Et~eeri~~l~~lr~l~~~~~~v~~~~~~p~~g  241 (328)
                      .|.+..++......+--.-.++ + ..+...+...+++. |      .|.-+..+.+..+.+++.  ..+-++ -+-..|
T Consensus       100 np~li~~~~~~fG~q~IvvsiD-~-~~~~~~~~~~v~~~~g~~~~~~~t~~~~~d~i~~~~~~G~--geIl~t-~IdrDG  174 (248)
T PRK05211        100 DPTLITRLADRFGVQCIVVGID-S-WFDAETGKYQVYQYTGDESRTKATQWETLDWVKEVQKRGA--GEIVLN-MMNQDG  174 (248)
T ss_pred             CCHHHHHHHHHCCCCEEEEEEE-E-ECCCCCCCEEEEEECCCCCCCCCCCCCHHHHHHHHHHCCC--CEEEEE-EECCCC
T ss_conf             9618999998579936999997-1-0255578579998258656530477369999999997598--669998-987899


Q ss_pred             CCCCCCCCCCHHHHHHHHHHHHHHCCCCCCEEEEHHHHHCHHHHHHHHHHCCCEEEECCEEECCCCCCHHHHHHHHHHCC
Q ss_conf             41244568798999999999999686872142311565165689999980998899778665158889899999999829
Q gi|254780485|r  242 SKFEENKKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTILFNRLG  321 (328)
Q Consensus       242 t~l~~~~~~~~~e~lr~iAi~RL~lP~~~i~i~~~~~~~~~~~~~~~L~~GaN~~~~g~~~~t~~g~~~~~~~~~i~~~G  321 (328)
                      | +.   .+ ..+.++-++-  .  .+..+.+++|--+ ..++....-..|+++.++|.-+ -.+.-++.+..+.+++.|
T Consensus       175 ~-~~---G~-dl~l~~~i~~--~--~~iPvIasGGv~s-~~di~~~~~~~~~~gvi~gs~~-~~~~i~l~e~k~~L~~~g  243 (248)
T PRK05211        175 V-RN---GY-DLAQLKKVRA--I--CHVPLIASGGAGT-MEHFLEAFRDADVDGALAASVF-HKQIINIGELKQYLAAQG  243 (248)
T ss_pred             C-CC---CC-CHHHHHHHHH--H--CCCCEEEECCCCC-HHHHHHHHHHCCCHHHHHHHHH-HCCCCCHHHHHHHHHHCC
T ss_conf             7-27---88-9999999997--4--6999999888899-9999999986798413304888-889999999999999878


Q ss_pred             CCC
Q ss_conf             853
Q gi|254780485|r  322 LIP  324 (328)
Q Consensus       322 ~~P  324 (328)
                      +.-
T Consensus       244 i~v  246 (248)
T PRK05211        244 IEI  246 (248)
T ss_pred             CCC
T ss_conf             952


No 125
>pfam00478 IMPDH IMP dehydrogenase / GMP reductase domain. This family is involved in biosynthesis of guanosine nucleotide. Members of this family contain a TIM barrel structure. In the inosine monophosphate dehydrogenases 2 CBS domains pfam00571 are inserted in the TIM barrel. This family is a member of the common phosphate binding site TIM barrel family.
Probab=95.36  E-value=0.24  Score=28.63  Aligned_cols=71  Identities=25%  Similarity=0.274  Sum_probs=32.6

Q ss_pred             HHHHHHHHHHHHCCCEEEEEECCCCCCCCCCHHHHHHHHHHHCCCCCCEEEECC-CCCHHHHHHHHCCCCCEEEEEC
Q ss_conf             799999999996498389973036888744289999988762136883241025-6999999987415760697513
Q gi|254780485|r   91 DQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLGLETCMTLG-MLSFEQAQILSKAGLDYYNHNI  166 (328)
Q Consensus        91 Eei~~~a~~~~~~G~~~~~l~~~~~~~~~~~~~~~~e~i~~i~~~~~~i~~~~g-~~~~~~~~~Lk~aG~~~~~~~l  166 (328)
                      ++..+.++.+.+.|+.-+++=+.+.     .-.+.+++++.+|+..+.+.+-+| ..+.+..+.|.++|+|.+.+.+
T Consensus       222 ~~~~eRa~~Lv~aGvDvivIDtAhG-----hs~~vi~~ik~ik~~~p~~~iIaGNVaT~e~a~~Li~aGAD~vKVGi  293 (467)
T pfam00478       222 DDDLERAEALVEAGVDVIVIDSAHG-----HSEYVLEMIKWIKKKYPDLDVIAGNVVTAEAARELIDAGADAVKVGI  293 (467)
T ss_pred             HHHHHHHHHHHHCCCCEEEEECCCC-----CCHHHHHHHHHHHHCCCCCCEEEEEECCHHHHHHHHHHCCCEEEECC
T ss_conf             6599999999876998899734454-----41889999999874078773785100589999999970777577556


No 126
>PRK03220 consensus
Probab=95.25  E-value=0.27  Score=28.40  Aligned_cols=200  Identities=13%  Similarity=0.165  Sum_probs=116.7

Q ss_pred             HHHHHHHHHHHCCCEEEEEECCCCCCCCCCHHHHHHHHHHH-CCCCCCEEEECCCCCHHHHHHHHCCCCCEEEEECCC--
Q ss_conf             99999999996498389973036888744289999988762-136883241025699999998741576069751343--
Q gi|254780485|r   92 QVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGV-KSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDT--  168 (328)
Q Consensus        92 ei~~~a~~~~~~G~~~~~l~~~~~~~~~~~~~~~~e~i~~i-~~~~~~i~~~~g~~~~~~~~~Lk~aG~~~~~~~let--  168 (328)
                      ..++.|+...+.|+.+++++--... .. .-....++++.+ ++.++.+.+--|..+.+..+.+.++|++.+.++-..  
T Consensus        32 dP~~~a~~~~~~G~d~lhivDld~a-~~-g~~~n~~~I~~i~~~~~~pi~vGGGIrs~e~~~~ll~~GadkVvigs~a~~  109 (257)
T PRK03220         32 DPVELAAVYDAEGADELTFLDVTAS-SS-GRATMLDVVRRTAEQVFIPLTVGGGVRTVEDVDSLLRAGADKVSVNTAAIA  109 (257)
T ss_pred             CHHHHHHHHHHCCCCEEEEEECCCC-CC-CCHHHHHHHHHHHHCCCCCEEEECCCCCHHHHHHHHHCCCCEEECHHHHHH
T ss_conf             9999999999869998999908887-56-763079999999850696489847858799999999819750872066775


Q ss_pred             CHHHHHCCCCCCCHHHHHHHHHHHHHCCCC-----------------CCCE-EEECC---CCCHHHHHHHHHHHHHCCCC
Q ss_conf             777732058888989999999999987985-----------------5770-78668---98999999999999740888
Q gi|254780485|r  169 SERFYPHVTTTHTFEDRLQTLENVRKSGIK-----------------VCCG-GILGL---GEMIDDRIDMLLTLANLSTP  227 (328)
Q Consensus       169 ~~~~~~~~~~~~~~~~~l~~~~~a~~~G~~-----------------~~sg-~l~G~---gEt~eeri~~l~~lr~l~~~  227 (328)
                      .|.+..++               +...|-+                 ...| -++=+   -+|.-+..+++..+.+++. 
T Consensus       110 ~p~~~~~~---------------~~~fG~q~Iv~siD~k~~~~~~~~~~~g~~v~~~g~~~~t~~~~~~~i~~~~~~g~-  173 (257)
T PRK03220        110 RPELLAEL---------------ARRFGSQCIVLSVDARRVPVGSAPTPSGFEVTTHGGRRGTGIDAVEWAARGAELGV-  173 (257)
T ss_pred             CCHHHHHH---------------HHHCCCEEEEEEEEEEECCCCCCCCCCCEEEEECCCEEECCCCHHHHHHHHHHCCC-
T ss_conf             94777899---------------98709866999999886256774346874999728826028759999999862698-


Q ss_pred             CCEEECCCEEECCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCEEEEHHHHHCHHHHHHHHHHCCCEEEECCEEECCCC
Q ss_conf             86020541120487412445687989999999999996868721423115651656899999809988997786651588
Q gi|254780485|r  228 PESIPINLLIPIPGSKFEENKKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKN  307 (328)
Q Consensus       228 ~~~v~~~~~~p~~gt~l~~~~~~~~~e~lr~iAi~RL~lP~~~i~i~~~~~~~~~~~~~~~L~~GaN~~~~g~~~~t~~g  307 (328)
                       ..+-+ .-+-..|| +.+   + ..+.++.++   -.. +..+.+++|--+ ..++.. ++..|++++++|.-+ ..+.
T Consensus       174 -geil~-tdI~rDGt-~~G---~-d~~l~~~i~---~~~-~~piIasGGv~s-~~di~~-l~~~g~~gv~~g~a~-~~~~  239 (257)
T PRK03220        174 -GEILL-NSMDADGT-KAG---F-DLEMLRAVR---AAV-TVPVIASGGAGA-VEHFAP-AVAAGADAVLAASVF-HFGE  239 (257)
T ss_pred             -CEEEE-EEECCCCC-CCC---C-CHHHHHHHH---HHC-CCCEEEECCCCC-HHHHHH-HHHCCCCEEEEHHHH-HCCC
T ss_conf             -88999-98868660-237---8-969999999---748-999899878999-999999-997899799874687-8899


Q ss_pred             CCHHHHHHHHHHCCCC
Q ss_conf             8989999999982985
Q gi|254780485|r  308 PSYNKDTILFNRLGLI  323 (328)
Q Consensus       308 ~~~~~~~~~i~~~G~~  323 (328)
                      -++.+..+.++..|+.
T Consensus       240 ~s~~~~k~~l~~~~i~  255 (257)
T PRK03220        240 LTIGQVKAALAAAGIT  255 (257)
T ss_pred             CCHHHHHHHHHHCCCC
T ss_conf             8899999999987597


No 127
>PRK05265 pyridoxine 5'-phosphate synthase; Provisional
Probab=95.15  E-value=0.079  Score=31.94  Aligned_cols=132  Identities=12%  Similarity=0.124  Sum_probs=80.3

Q ss_pred             HHHHHHHHHHHHHCCCEEEEEE-------CC-CCCCCCCCHHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHCCCCCE
Q ss_conf             5799999999996498389973-------03-688874428999998876213688324102569999999874157606
Q gi|254780485|r   90 VDQVLKEAKNAKENGATRYCMG-------AA-WREPKERDLSIIVDMIKGVKSLGLETCMTLGMLSFEQAQILSKAGLDY  161 (328)
Q Consensus        90 ~Eei~~~a~~~~~~G~~~~~l~-------~~-~~~~~~~~~~~~~e~i~~i~~~~~~i~~~~g~~~~~~~~~Lk~aG~~~  161 (328)
                      .+++++.|...+   -..+|+|       ++ ++.......+.+.+.++.+++.++.+.+=+ ..+.+++...++.|+|.
T Consensus        75 t~e~i~ia~~~k---P~qvtLVPe~r~e~TTegGld~~~~~~~L~~~i~~lk~~gIrvSLFi-DPd~~~i~~a~~~Gad~  150 (240)
T PRK05265         75 TEEMLDIALEIK---PHQVTLVPEKREELTTEGGLDVAGQFDKLKPAIARLKDAGIRVSLFI-DPDPEQIEAAAEVGADR  150 (240)
T ss_pred             CHHHHHHHHHCC---CCEEEECCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCEEEEEE-CCCHHHHHHHHHHCCCE
T ss_conf             188999999849---98599888998862678893776578999999999986598179972-79878999999849399


Q ss_pred             EEEECCCCHHHHHCCCCCCCHHHHHHHHHHHHHCCCCCCCEEEECCCCCHHHHHHHHHHHHHCCCCCCEEECC
Q ss_conf             9751343777732058888989999999999987985577078668989999999999997408888602054
Q gi|254780485|r  162 YNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPIN  234 (328)
Q Consensus       162 ~~~~let~~~~~~~~~~~~~~~~~l~~~~~a~~~G~~~~sg~l~G~gEt~eeri~~l~~lr~l~~~~~~v~~~  234 (328)
                      +.+.-+..-..+.........+...++.+.|+++|+.+++    |||=+.+-.-. +..+..++    .|.++
T Consensus       151 VElhTG~Ya~a~~~~~~~~el~~i~~aa~~A~~lGL~VnA----GHgLn~~Nl~~-i~~ip~i~----EvsIG  214 (240)
T PRK05265        151 IELHTGPYADAKTEAEQAAELERIAEAAALAASLGLGVNA----GHGLNYHNVKP-IAAIPGIE----ELNIG  214 (240)
T ss_pred             EEEECHHHHHHCCCCHHHHHHHHHHHHHHHHHHCCCEEEC----CCCCCHHHHHH-HHCCCCCE----EEECC
T ss_conf             9983478786357521999999999999999986987853----78988777899-84489974----88457


No 128
>PRK13597 imidazole glycerol phosphate synthase subunit HisF; Provisional
Probab=95.15  E-value=0.28  Score=28.20  Aligned_cols=202  Identities=14%  Similarity=0.156  Sum_probs=115.7

Q ss_pred             HHHHHHHHHHHCCCEEEEEECCCCCCCCCCHHHHHHHHHHH-CCCCCCEEEECCCCCHHHHHHHHCCCCCEEEEECCC--
Q ss_conf             99999999996498389973036888744289999988762-136883241025699999998741576069751343--
Q gi|254780485|r   92 QVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGV-KSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDT--  168 (328)
Q Consensus        92 ei~~~a~~~~~~G~~~~~l~~~~~~~~~~~~~~~~e~i~~i-~~~~~~i~~~~g~~~~~~~~~Lk~aG~~~~~~~let--  168 (328)
                      ..++.|+...+.|+.+++++--......  -....++++.+ ++.++.+.+.-|..+.++.+++.++|++.+.++=-.  
T Consensus        32 dP~~~a~~~~~~Gad~lhlvDld~a~~~--~~~n~~~I~~i~~~~~vpiqvGGGIrs~e~~~~ll~~GadkViigS~a~~  109 (252)
T PRK13597         32 DPVEAARAYDEAGADELVFLDISATHEE--RAILLDVVARVAERVFIPLTVGGGVRSLEDARKLLLSGADKVSVNSAAVR  109 (252)
T ss_pred             CHHHHHHHHHHCCCCEEEEEECCCCCCC--CHHHHHHHHHHHHHCCCCEEEECCCCCHHHHHHHHHCCCCEEEECHHHHH
T ss_conf             9999999999869999999956466668--66379999999862698289847713089999998569877983266674


Q ss_pred             CHHHHHCCCCCCCHHHHHHHHHHHHHCCCC-CC----------CEEEECC---CCCHHHHHHHHHHHHHCCCCCCEEECC
Q ss_conf             777732058888989999999999987985-57----------7078668---989999999999997408888602054
Q gi|254780485|r  169 SERFYPHVTTTHTFEDRLQTLENVRKSGIK-VC----------CGGILGL---GEMIDDRIDMLLTLANLSTPPESIPIN  234 (328)
Q Consensus       169 ~~~~~~~~~~~~~~~~~l~~~~~a~~~G~~-~~----------sg~l~G~---gEt~eeri~~l~~lr~l~~~~~~v~~~  234 (328)
                      .|.+..++               +...|-+ +.          .+.++-.   .++.-+.++++..+.+++.  ..+-+ 
T Consensus       110 np~~i~~~---------------~~~fG~q~Iv~~iD~~~~~~~~~v~~~~~~~~~~~~~~d~~~~~~~~G~--geil~-  171 (252)
T PRK13597        110 RPELIREL---------------ADHFGAQAVVLAIDARWRGDFPEVHVAGGRVPTGLHAVEWAVKGVELGA--GEILL-  171 (252)
T ss_pred             CCHHHHHH---------------HHHCCCCCEEEEEEEEECCCCCEEEECCCEEECCCCHHHHHHHHHHHCC--CEEEE-
T ss_conf             93789999---------------9874996529999888618974167538727569769999999996489--99999-


Q ss_pred             CEEECCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCEEEEHHHHHCHHHHHHHHHHCCCEEEECCEEECCCCCCHHHHH
Q ss_conf             11204874124456879899999999999968687214231156516568999998099889977866515888989999
Q gi|254780485|r  235 LLIPIPGSKFEENKKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDT  314 (328)
Q Consensus       235 ~~~p~~gt~l~~~~~~~~~e~lr~iAi~RL~lP~~~i~i~~~~~~~~~~~~~~~L~~GaN~~~~g~~~~t~~g~~~~~~~  314 (328)
                      .-+-..|| +.   .++ .+.++-++  +. . +..+.+++|-- -..++.+ ++..|+++.++|. ....+.-++++..
T Consensus       172 tdI~rDGt-~~---G~d-~~l~~~i~--~~-~-~~pvIasGGv~-s~~dl~~-l~~~g~~gvi~G~-al~~~~~s~~e~k  239 (252)
T PRK13597        172 TSMDRDGT-KE---GYD-LRLTRMVA--EA-V-GVPVIASGGAG-RMEHFLE-AFQAGAEAALAAS-VFHFGEIPIPELK  239 (252)
T ss_pred             EEECCCCC-CC---CCC-HHHHHHHH--HC-C-CCCEEEECCCC-CHHHHHH-HHHCCCCEEEEHH-HHHCCCCCHHHHH
T ss_conf             75737684-44---769-59999998--50-7-99899978989-9999999-9878996998712-7677999999999


Q ss_pred             HHHHHCCCCCC
Q ss_conf             99998298532
Q gi|254780485|r  315 ILFNRLGLIPD  325 (328)
Q Consensus       315 ~~i~~~G~~P~  325 (328)
                      +.+++.|+.-.
T Consensus       240 ~~L~~~~i~vr  250 (252)
T PRK13597        240 RYLAEKGVHVR  250 (252)
T ss_pred             HHHHHCCCCCC
T ss_conf             99998789554


No 129
>pfam03740 PdxJ Pyridoxal phosphate biosynthesis protein PdxJ. Members of this family belong to the PdxJ family that catalyses the condensation of 1-deoxy-d-xylulose-5-phosphate (DXP) and 1-amino-3-oxo-4-(phosphohydroxy)propan-2-one to form pyridoxine 5'-phosphate (PNP). This reaction is involved in de novo synthesis of pyridoxine (vitamin B6) and pyridoxal phosphate.
Probab=95.04  E-value=0.3  Score=28.00  Aligned_cols=118  Identities=14%  Similarity=0.088  Sum_probs=73.9

Q ss_pred             CHHHHHHHHHHHHHCCCEEEEEE--------CCCCCCCCCCHHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHCCCCC
Q ss_conf             85799999999996498389973--------0368887442899999887621368832410256999999987415760
Q gi|254780485|r   89 NVDQVLKEAKNAKENGATRYCMG--------AAWREPKERDLSIIVDMIKGVKSLGLETCMTLGMLSFEQAQILSKAGLD  160 (328)
Q Consensus        89 ~~Eei~~~a~~~~~~G~~~~~l~--------~~~~~~~~~~~~~~~e~i~~i~~~~~~i~~~~g~~~~~~~~~Lk~aG~~  160 (328)
                      ..+++++.|...+   -..+|+|        +.++.......+.+.+.++.+++.+..+.+-+ ..+.+++...++.|+|
T Consensus        72 ~~~emi~ia~~~k---P~qvtLVPE~r~elTTegGld~~~~~~~L~~~i~~lk~~girvSlFI-Dpd~~~i~~a~~~Gad  147 (239)
T pfam03740        72 PTEEMLELALKTK---PHQVTLVPEKREEITTEGGLDVVAQLEKLKPAIRRLKNAGIRVSLFI-DPDPEQIEAAKIVGAD  147 (239)
T ss_pred             CHHHHHHHHHHCC---CCEEEECCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHCCCCEEEEEE-CCCHHHHHHHHHCCCC
T ss_conf             7499999999849---98589888999873568880633406899999999860785389970-7998999999980929


Q ss_pred             EEEEECCCCHHHHHCCCCCC--CHHHHHHHHHHHHHCCCCCCCEEEECCCCCHHHH
Q ss_conf             69751343777732058888--9899999999999879855770786689899999
Q gi|254780485|r  161 YYNHNIDTSERFYPHVTTTH--TFEDRLQTLENVRKSGIKVCCGGILGLGEMIDDR  214 (328)
Q Consensus       161 ~~~~~let~~~~~~~~~~~~--~~~~~l~~~~~a~~~G~~~~sg~l~G~gEt~eer  214 (328)
                      .+.+.-...-..+.......  .++...++.+.|+++|+.+++    |||=+.+-.
T Consensus       148 ~VElhTG~YA~a~~~~~~~~~~~l~~i~~aa~~A~~lGL~VnA----GHgLn~~Nl  199 (239)
T pfam03740       148 RIELHTGPYADAHNDAEQAREELLERLAAGAALAFDLGLVVNA----GHGLTYHNV  199 (239)
T ss_pred             EEEEECHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHCCCEEEC----CCCCCHHHH
T ss_conf             9985047788775131555799999999999999874985746----789887669


No 130
>PRK00507 deoxyribose-phosphate aldolase; Provisional
Probab=94.85  E-value=0.17  Score=29.64  Aligned_cols=44  Identities=27%  Similarity=0.175  Sum_probs=17.7

Q ss_pred             CHHHHHHHHHHHHHCCCEEEEEECCCCCCCCCCHHHHHHHHHHH
Q ss_conf             85799999999996498389973036888744289999988762
Q gi|254780485|r   89 NVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGV  132 (328)
Q Consensus        89 ~~Eei~~~a~~~~~~G~~~~~l~~~~~~~~~~~~~~~~e~i~~i  132 (328)
                      +.+.-+.+++.+.+.|+.++-++.-.......+++++.+-++.+
T Consensus        72 ~~~~K~~E~~~ai~~GAdEiD~Vin~~~~~~g~~~~v~~ei~~v  115 (221)
T PRK00507         72 TTAVKAFEAKDAIANGADEIDMVINIGALKSGDWDAVEADIRAV  115 (221)
T ss_pred             CHHHHHHHHHHHHHCCCCEEEEECCHHHHHCCCHHHHHHHHHHH
T ss_conf             57689999999998599877740259999758488999999999


No 131
>PRK07028 bifunctional hexulose-6-phosphate synthase/ribonuclease regulator; Validated
Probab=94.60  E-value=0.39  Score=27.26  Aligned_cols=214  Identities=15%  Similarity=0.195  Sum_probs=100.1

Q ss_pred             CCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCC-CCCHHHHHHHHHHHCC-CCCCEEEECCCCCHHHHHHHHCCCCCEEE
Q ss_conf             006857999999999964983899730368887-4428999998876213-68832410256999999987415760697
Q gi|254780485|r   86 KLINVDQVLKEAKNAKENGATRYCMGAAWREPK-ERDLSIIVDMIKGVKS-LGLETCMTLGMLSFEQAQILSKAGLDYYN  163 (328)
Q Consensus        86 ~~~~~Eei~~~a~~~~~~G~~~~~l~~~~~~~~-~~~~~~~~e~i~~i~~-~~~~i~~~~g~~~~~~~~~Lk~aG~~~~~  163 (328)
                      .++..+...+.+++..+.|..-+++-.|...-- ..+   -++.++.+++ ....+.+ +|-++.+.......+|+|-+.
T Consensus       113 DlI~v~d~~~ra~el~~lGvd~I~vH~G~D~Q~~g~~---p~~~l~~v~~~~~~~vAV-AGGi~~~t~~~~v~~GAdIvI  188 (429)
T PRK07028        113 DLINVPDPVKRAVELEELGVDIINVHVGIDQQMLGKD---PLELLKKVSEEVSIPIAA-AGGLDAETAVKAVEAGADIVI  188 (429)
T ss_pred             EECCCCCHHHHHHHHHHCCCCEEEEEEEECHHHCCCC---HHHHHHHHHHHCCCEEEE-ECCCCHHHHHHHHHCCCCEEE
T ss_conf             8558998899999999709988999762335531798---499999999755971899-668787769999975998999


Q ss_pred             EECCCCHHHHHCCCCCCCHHHHHHHHHHHHHCCCCCCCEEEECCCCCHHHHHHHHH-HHHH------CCCCCCEEECCCE
Q ss_conf             51343777732058888989999999999987985577078668989999999999-9974------0888860205411
Q gi|254780485|r  164 HNIDTSERFYPHVTTTHTFEDRLQTLENVRKSGIKVCCGGILGLGEMIDDRIDMLL-TLAN------LSTPPESIPINLL  236 (328)
Q Consensus       164 ~~let~~~~~~~~~~~~~~~~~l~~~~~a~~~G~~~~sg~l~G~gEt~eeri~~l~-~lr~------l~~~~~~v~~~~~  236 (328)
                      ..=-        +-...+..+--.-++.|-+.+...+..    .-.+.+|-+..++ .+..      ++....+..+-++
T Consensus       189 VGga--------I~~a~dp~~aAr~ir~ai~~~~~~~~~----~~~~~~~~~~~~~~~vs~~n~sdamhr~~~~~~~~p~  256 (429)
T PRK07028        189 VGGN--------IYKSADVTGAARDIREALDSPPVPTDK----FKKSLDEEIRELFKEVSTSNISDAMHRKGAMKGLKPL  256 (429)
T ss_pred             ECCC--------CCCCCCHHHHHHHHHHHHHCCCCCCCC----CCCCHHHHHHHHHHHCCCCCCCHHHHHHCCCCCCEEC
T ss_conf             8940--------057999799999999997376767652----0022389999999851887611566640455785442


Q ss_pred             EECCCCCCCCCC---CCCHHHHHHHHHHHHHHCCCCCCEEEE-HHH-H-HCHHHHHHHHHHCCCEEEECCEEECCCCCCH
Q ss_conf             204874124456---879899999999999968687214231-156-5-1656899999809988997786651588898
Q gi|254780485|r  237 IPIPGSKFEENK---KVDPIEHVRIISVARILMPKSRLRLAA-GRA-M-MSDELQALCFFSGANSIFVGDTLLTAKNPSY  310 (328)
Q Consensus       237 ~p~~gt~l~~~~---~~~~~e~lr~iAi~RL~lP~~~i~i~~-~~~-~-~~~~~~~~~L~~GaN~~~~g~~~~t~~g~~~  310 (328)
                        ++|+.+-+..   ...+-+.++.+-..=+.-|...|-|.. |+. . .|.=+...+...|+.++++.+.         
T Consensus       257 --~~~~k~~G~avTV~t~~gD~~~~~~AiD~A~PGDViVId~~G~d~A~WGeLmt~aA~~rGIaG~VIDGa---------  325 (429)
T PRK07028        257 --VRGLKMVGPAVTVQTFAGDWAKPVEAIDVAEPGDVLVIDNCSSDIAPWGGLATLSCLNKGIAGVVIDGA---------  325 (429)
T ss_pred             --CCCCEEEEEEEEEEECCCCCCCHHHHHHCCCCCCEEEEECCCCCCEEEHHHHHHHHHHCCCEEEEEECC---------
T ss_conf             --468634666799995688740567786247999789996799975130899999999879819997015---------


Q ss_pred             HHHHHHHHHCCCCCCCC
Q ss_conf             99999999829853247
Q gi|254780485|r  311 NKDTILFNRLGLIPDLS  327 (328)
Q Consensus       311 ~~~~~~i~~~G~~P~~~  327 (328)
                      -+|.+-|+++|| |+|+
T Consensus       326 vRDv~eIr~lgf-PVFa  341 (429)
T PRK07028        326 VRDVDEIRKLGF-PVFA  341 (429)
T ss_pred             CCCHHHHHHCCC-CEEE
T ss_conf             669999984599-8698


No 132
>TIGR00676 fadh2 5,10-methylenetetrahydrofolate reductase; InterPro: IPR004620 The enzyme activities methylenetetrahydrofolate reductase (1.5.1.20 from EC) and 5,10-methylenetetrahydrofolate reductase (FADH) (1.7.99.5 from EC) differ in that the former (assigned in many eukaryotes) is defined to use NADP+ as an acceptor, while the latter (assigned in many bacteria) is flexible with respect to the acceptor. Both convert 5-methyltetrahydrofolate to 5,10-methylenetetrahydrofolate. From a larger set of proteins assigned as one or the other, this family describes the subset of proteins found in bacteria, and currently designated 5,10-methylenetetrahydrofolate reductase. This protein is an FAD-containing flavoprotein.; GO: 0009086 methionine biosynthetic process.
Probab=94.40  E-value=0.34  Score=27.65  Aligned_cols=106  Identities=14%  Similarity=0.153  Sum_probs=68.6

Q ss_pred             CCCHHHHHHHHHHHHHCCCEEEEEECCCCC------CCCCCHHHHHHHHHHHCCC--CC-----------CEEEEC----
Q ss_conf             068579999999999649838997303688------8744289999988762136--88-----------324102----
Q gi|254780485|r   87 LINVDQVLKEAKNAKENGATRYCMGAAWRE------PKERDLSIIVDMIKGVKSL--GL-----------ETCMTL----  143 (328)
Q Consensus        87 ~~~~Eei~~~a~~~~~~G~~~~~l~~~~~~------~~~~~~~~~~e~i~~i~~~--~~-----------~i~~~~----  143 (328)
                      -.|.|++.+.++...+.|+++++--=|..+      +...++.|-.|+|+-||+.  ..           .-++.+    
T Consensus        84 ~~t~~e~~~~L~~y~~~Gi~~ilALRGD~p~~~~~~~~~~~~~yA~eLV~~Ir~~~g~~GIy~~~E~V~~~F~I~VAaYP  163 (302)
T TIGR00676        84 GSTREEIEEILREYRELGIRNILALRGDPPDETDFEPAPGGFKYASELVEFIRSEHGFGGIYLDGEDVTEDFEIGVAAYP  163 (302)
T ss_pred             CCCHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCHHHHHHHHHHCCCCCCEEECCCCCCCCCEEEEEECC
T ss_conf             68989999999999874886798743768888865658876677689999998368998556477645765505564258


Q ss_pred             ----CCCCH----HHHHHHHCCCCCEEEEECCCCHHHHHCCCCCCCHHHHHHHHHHHHHCCC--CCCCEEE
Q ss_conf             ----56999----9999874157606975134377773205888898999999999998798--5577078
Q gi|254780485|r  144 ----GMLSF----EQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSGI--KVCCGGI  204 (328)
Q Consensus       144 ----g~~~~----~~~~~Lk~aG~~~~~~~let~~~~~~~~~~~~~~~~~l~~~~~a~~~G~--~~~sg~l  204 (328)
                          -..+.    ..+++=-+||+|...-     .=+|       +.++..+-.+...++|+  ++-.|+|
T Consensus       164 E~Hpea~~~~~D~~nLK~KVdAGAd~aIT-----QlFF-------dnd~y~rF~d~c~~aGI~~PI~PGIM  222 (302)
T TIGR00676       164 EKHPEAPNLEEDIENLKRKVDAGADYAIT-----QLFF-------DNDDYYRFVDRCRAAGIDVPIIPGIM  222 (302)
T ss_pred             CCCCCCCCHHHHHHHHHHHHHHCCCCEEE-----EEEC-------CHHHHHHHHHHHHHCCCCEEEECCCC
T ss_conf             87888888899999999988627780331-----1111-------56678889999998789500016723


No 133
>COG0119 LeuA Isopropylmalate/homocitrate/citramalate synthases [Amino acid transport and metabolism]
Probab=94.28  E-value=0.46  Score=26.81  Aligned_cols=220  Identities=17%  Similarity=0.174  Sum_probs=120.7

Q ss_pred             CCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCCCCHHHHHHHHHHHCCCCCCEEEEC---CCCCHHHHHHHHCCCCCEE
Q ss_conf             0068579999999999649838997303688874428999998876213688324102---5699999998741576069
Q gi|254780485|r   86 KLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLGLETCMTL---GMLSFEQAQILSKAGLDYY  162 (328)
Q Consensus        86 ~~~~~Eei~~~a~~~~~~G~~~~~l~~~~~~~~~~~~~~~~e~i~~i~~~~~~i~~~~---g~~~~~~~~~Lk~aG~~~~  162 (328)
                      ..++.|+-++.++.+.+.|...+-.+  ....+..+++..-.+..   ..+..++...   -...+..+..+.++|++.+
T Consensus        19 ~~~s~e~Ki~Ia~~Ld~lGv~~IE~g--~p~~s~~~~~~~~~i~~---~~~~~~~~~~~~~~~~~~~~~ea~~~a~~~~i   93 (409)
T COG0119          19 VSFSVEEKIRIAKALDDLGVDYIEAG--FPVASPGDFEFVRAIAE---KAGLFICALIAALARAIKRDIEALLEAGVDRI   93 (409)
T ss_pred             CCCCHHHHHHHHHHHHHCCCCEEEEE--CCCCCHHHHHHHHHHHH---HCCCCCCCHHHHHHHHHHHHHHHHHHCCCCEE
T ss_conf             95788999999999997699879972--78688546999999987---46863220223317867755999975799989


Q ss_pred             EEECCCCHHHHHCCCCCCCHHH----HHHHHHHHHHCCCCCCCEEEECCCCCHHHHHHHHHHHHHCCCCCCEEECCCEEE
Q ss_conf             7513437777320588889899----999999999879855770786689899999999999974088886020541120
Q gi|254780485|r  163 NHNIDTSERFYPHVTTTHTFED----RLQTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIP  238 (328)
Q Consensus       163 ~~~let~~~~~~~~~~~~~~~~----~l~~~~~a~~~G~~~~sg~l~G~gEt~eeri~~l~~lr~l~~~~~~v~~~~~~p  238 (328)
                      ++...|++-....... .+.++    -.++.+.|++.|+++.....-...-.++..++....+.+.+..        .+-
T Consensus        94 ~if~~tSd~h~~~~~~-~t~~e~l~~~~~~v~~a~~~g~~~~~~~Ed~~rt~~e~l~~~~~~~~~~ga~--------~i~  164 (409)
T COG0119          94 HIFIATSDLHLRYKLK-KTREEVLERAVDAVEYARDHGLEVRFSAEDATRTDPEFLAEVVKAAIEAGAD--------RIN  164 (409)
T ss_pred             EEEECCCHHHHHHHHC-CCHHHHHHHHHHHHHHHHHCCCEEEEEEECCCCCCHHHHHHHHHHHHHCCCC--------EEE
T ss_conf             9997478899998848-9999999999999999997397589875313367999999999999971994--------999


Q ss_pred             CCCCCCCCCCCCCHHHHHHHHHHHHHHCCC-CCCEEEEHHHHHCH--HHHHHHHHHCCC---EEEECCEEECCCCCCHHH
Q ss_conf             487412445687989999999999996868-72142311565165--689999980998---899778665158889899
Q gi|254780485|r  239 IPGSKFEENKKVDPIEHVRIISVARILMPK-SRLRLAAGRAMMSD--ELQALCFFSGAN---SIFVGDTLLTAKNPSYNK  312 (328)
Q Consensus       239 ~~gt~l~~~~~~~~~e~lr~iAi~RL~lP~-~~i~i~~~~~~~~~--~~~~~~L~~GaN---~~~~g~~~~t~~g~~~~~  312 (328)
                      .++|    ....+|.++..++.-.+=-+|+ +.+.+-+ -...|-  -....++.+||+   +++-|-- -.+++.+.++
T Consensus       165 l~DT----vG~~~P~~~~~~i~~l~~~v~~~~~i~~H~-HND~G~AvANslaAv~aGa~~v~~TvnGiG-ERaGna~l~~  238 (409)
T COG0119         165 LPDT----VGVATPNEVADIIEALKANVPNKVILSVHC-HNDLGMAVANSLAAVEAGADQVEGTVNGIG-ERAGNAALEE  238 (409)
T ss_pred             ECCC----CCCCCHHHHHHHHHHHHHHCCCCCEEEEEE-CCCCCHHHHHHHHHHHCCCCEEEEECCCCE-ECCCCCCHHH
T ss_conf             7787----686587999999999998378887388983-698565999999999848838999645614-3366654799


Q ss_pred             HHH---HHHHCCCCCC
Q ss_conf             999---9998298532
Q gi|254780485|r  313 DTI---LFNRLGLIPD  325 (328)
Q Consensus       313 ~~~---~i~~~G~~P~  325 (328)
                      ...   +....|..|.
T Consensus       239 v~~~l~~~~~~~~~~~  254 (409)
T COG0119         239 VVLALALRKDYGVDTG  254 (409)
T ss_pred             HHHHHHHHHHCCCCCC
T ss_conf             9999999765187568


No 134
>KOG3111 consensus
Probab=94.26  E-value=0.46  Score=26.77  Aligned_cols=195  Identities=15%  Similarity=0.179  Sum_probs=117.2

Q ss_pred             HHHHHHHHHHHCCCEEEEE-ECCCCCCCCCCH-HHHHHHHHHHCCCC--CCEEEECCCCCHHHHHHHHCCCCCEEEEECC
Q ss_conf             9999999999649838997-303688874428-99999887621368--8324102569999999874157606975134
Q gi|254780485|r   92 QVLKEAKNAKENGATRYCM-GAAWREPKERDL-SIIVDMIKGVKSLG--LETCMTLGMLSFEQAQILSKAGLDYYNHNID  167 (328)
Q Consensus        92 ei~~~a~~~~~~G~~~~~l-~~~~~~~~~~~~-~~~~e~i~~i~~~~--~~i~~~~g~~~~~~~~~Lk~aG~~~~~~~le  167 (328)
                      ..-+++....+.|+.-+++ +..++--+.-.+ .-+++.+|......  ..+|+-+ .-.++....+.++|++.+..-.|
T Consensus        18 nL~~E~~~~~~~GadwlHlDVMDg~FVpNiT~G~pvV~slr~~~~~~~ffD~HmMV-~~Peq~v~~~a~agas~~tfH~E   96 (224)
T KOG3111          18 NLAAECKKMLDAGADWLHLDVMDGHFVPNITFGPPVVESLRKHTGADPFFDVHMMV-ENPEQWVDQMAKAGASLFTFHYE   96 (224)
T ss_pred             HHHHHHHHHHHCCCCEEEEEECCCCCCCCCCCCHHHHHHHHHCCCCCCCEEEEEEE-CCHHHHHHHHHHCCCCEEEEEEE
T ss_conf             89999999997498758786014710477433618899998525888523678764-69888767998647756999864


Q ss_pred             CCHHHHHCCCCCCCHHHHHHHHHHHHHCCCCCCCEEEECCCCCHHHHHHHHHHHHHCCCCCCEEECCCEEECCCCCCCCC
Q ss_conf             37777320588889899999999999879855770786689899999999999974088886020541120487412445
Q gi|254780485|r  168 TSERFYPHVTTTHTFEDRLQTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEEN  247 (328)
Q Consensus       168 t~~~~~~~~~~~~~~~~~l~~~~~a~~~G~~~~sg~l~G~gEt~eeri~~l~~lr~l~~~~~~v~~~~~~p~~gt~l~~~  247 (328)
                      ..             ++|.++.+.+++.|++++.  -+-.|-..++...++.       +-+++-+.-.-|--|    +.
T Consensus        97 ~~-------------q~~~~lv~~ir~~gmk~G~--alkPgT~Ve~~~~~~~-------~~D~vLvMtVePGFG----GQ  150 (224)
T KOG3111          97 AT-------------QKPAELVEKIREKGMKVGL--ALKPGTPVEDLEPLAE-------HVDMVLVMTVEPGFG----GQ  150 (224)
T ss_pred             EC-------------CCHHHHHHHHHHCCCEEEE--EECCCCCHHHHHHHHH-------HCCEEEEEEECCCCC----HH
T ss_conf             32-------------5789999999974975668--7489995899997641-------025799998548975----04


Q ss_pred             CCCCHHHHHHHHHHHHHHCCCCCCEEEEHHHHHCHHHHHHHHHHCCCEEEECCEEECCCCCCHHHHHHHHHHC
Q ss_conf             6879899999999999968687214231156516568999998099889977866515888989999999982
Q gi|254780485|r  248 KKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTILFNRL  320 (328)
Q Consensus       248 ~~~~~~e~lr~iAi~RL~lP~~~i~i~~~~~~~~~~~~~~~L~~GaN~~~~g~~~~t~~g~~~~~~~~~i~~~  320 (328)
                      .  --++.+.-+--.|-=.|+..|-+-+|   ++++....+-.+|||-|..|.-+..++  .+.+.+..||..
T Consensus       151 k--Fme~mm~KV~~lR~kyp~l~ieVDGG---v~p~ti~~~a~AGAN~iVaGsavf~a~--d~~~vi~~lr~~  216 (224)
T KOG3111         151 K--FMEDMMPKVEWLREKYPNLDIEVDGG---VGPSTIDKAAEAGANMIVAGSAVFGAA--DPSDVISLLRNS  216 (224)
T ss_pred             H--HHHHHHHHHHHHHHHCCCCEEEECCC---CCCCHHHHHHHCCCCEEEECCEEECCC--CHHHHHHHHHHH
T ss_conf             5--78999899999998689843885488---682137799875888798633345279--989999999999


No 135
>TIGR01302 IMP_dehydrog inosine-5'-monophosphate dehydrogenase; InterPro: IPR005990    Synonyms: Inosine-5'-monophosphate dehydrogenase, Inosinic acid dehydrogenase     IMP dehydrogenase (1.1.1.205 from EC,IMPDH) catalyzes the rate-limiting reaction of de novo GTP biosynthesis, the NAD-dependent reduction of IMP into XMP .  Inosine 5-phosphate + NAD+ + H2O = xanthosine 5-phosphate + NADH     IMP dehydrogenase is associated with cell proliferation and is a possible target for cancer chemotherapy. Mammalian and bacterial IMPDHs are tetramers of identical chains. There are two IMP dehydrogenase isozymes in humans . IMP dehydrogenase nearly always contains a long insertion that has two CBS domains within it and adopts a TIM barrel structure.; GO: 0003938 IMP dehydrogenase activity, 0006177 GMP biosynthetic process.
Probab=94.14  E-value=0.35  Score=27.63  Aligned_cols=108  Identities=22%  Similarity=0.173  Sum_probs=72.0

Q ss_pred             CCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCCCCHHHHHHHHHHHCCCCCCEEEECC-CCCHHHHHHHHCCCCCEEEEE
Q ss_conf             0685799999999996498389973036888744289999988762136883241025-699999998741576069751
Q gi|254780485|r   87 LINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLGLETCMTLG-MLSFEQAQILSKAGLDYYNHN  165 (328)
Q Consensus        87 ~~~~Eei~~~a~~~~~~G~~~~~l~~~~~~~~~~~~~~~~e~i~~i~~~~~~i~~~~g-~~~~~~~~~Lk~aG~~~~~~~  165 (328)
                      .-+-|.-.+.|.++.+.|+-=++|=+++.+     =.+.++.||.+|+..+++-+=.| ..|.++.+-|-+||+|.+-+.
T Consensus       234 vg~r~~D~~R~~~L~~AGvDv~viDsshGh-----s~~vl~~ik~~k~~Yp~~~iiaGNVaT~~~a~~LI~AgADg~rVG  308 (476)
T TIGR01302       234 VGTREDDLERAEALVEAGVDVIVIDSSHGH-----SIYVLDSIKKIKKTYPDLDIIAGNVATAEQAKALIDAGADGLRVG  308 (476)
T ss_pred             ECCCCCCHHHHHHHHHCCCCEEEEECCCCC-----CHHHHHHHHHHHHHCCEEEEEECCCCCHHHHHHHHHCCCCEEEEC
T ss_conf             468986189999999659658998166545-----378999999998638805799434411788988985288878983


Q ss_pred             CCC-C----HHHHHCCCCCCCHHHHHHHHHHHHHCCCCCCC
Q ss_conf             343-7----77732058888989999999999987985577
Q gi|254780485|r  166 IDT-S----ERFYPHVTTTHTFEDRLQTLENVRKSGIKVCC  201 (328)
Q Consensus       166 let-~----~~~~~~~~~~~~~~~~l~~~~~a~~~G~~~~s  201 (328)
                      +.. |    +....--.|-.|.  --++.+.|++.|+++-|
T Consensus       309 iGpGSICTTr~V~gVGvPQ~TA--v~~Va~~A~~~Gi~VIA  347 (476)
T TIGR01302       309 IGPGSICTTRIVAGVGVPQITA--VYDVAEYAAQSGIPVIA  347 (476)
T ss_pred             CCCCCCCEEEEEEECCCHHHHH--HHHHHHHHHHCCCEEEE
T ss_conf             6889811001565127626889--99999999727990998


No 136
>PRK04281 consensus
Probab=94.00  E-value=0.52  Score=26.44  Aligned_cols=201  Identities=12%  Similarity=0.111  Sum_probs=114.2

Q ss_pred             HHHHHHHHHHHCCCEEEEEECCCCCCCCCCHHHHHHHHHHHC-CCCCCEEEECCCCCHHHHHHHHCCCCCEEEEECCC--
Q ss_conf             999999999964983899730368887442899999887621-36883241025699999998741576069751343--
Q gi|254780485|r   92 QVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVK-SLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDT--  168 (328)
Q Consensus        92 ei~~~a~~~~~~G~~~~~l~~~~~~~~~~~~~~~~e~i~~i~-~~~~~i~~~~g~~~~~~~~~Lk~aG~~~~~~~let--  168 (328)
                      ..++.|+...+.|+.+++++--......  -....+.++.+. +.++.+.+.-|..+.++.+++.++|++.+.++--.  
T Consensus        31 dP~~~ak~~~~~GadelhivDld~a~~~--~~~~~~~I~~i~~~~~vpi~vGGGIrs~e~~~~ll~~GadkViigs~a~~  108 (254)
T PRK04281         31 DPVEAAKRYNGEGADELTFLDITASSDN--RDTILHIIEEVAGQVFIPLTVGGGVRTVADIRRLLNAGADKVSINTAAVT  108 (254)
T ss_pred             CHHHHHHHHHHCCCCEEEEEECCCCCCC--CHHHHHHHHHHHHHCCCCEEEECCEEECHHHHHHHHCCCCEEEECHHHHH
T ss_conf             9999999999869999999968898777--53089999999850796289977754518899999769988997776764


Q ss_pred             CHHHHHCCCCCCCHHHHHHHHHHHHHCCCC-C-------------CCEEEECCC---CCHHHHHHHHHHHHHCCCCCCEE
Q ss_conf             777732058888989999999999987985-5-------------770786689---89999999999997408888602
Q gi|254780485|r  169 SERFYPHVTTTHTFEDRLQTLENVRKSGIK-V-------------CCGGILGLG---EMIDDRIDMLLTLANLSTPPESI  231 (328)
Q Consensus       169 ~~~~~~~~~~~~~~~~~l~~~~~a~~~G~~-~-------------~sg~l~G~g---Et~eeri~~l~~lr~l~~~~~~v  231 (328)
                      .|.+..++               +.+.|-+ +             .-+-++-+|   .|.-+..+.+..+.+++.  ..+
T Consensus       109 np~~l~~~---------------~~~fG~q~Iv~siD~k~~~~~~~~~~i~~~g~~~~t~~~~~~~~~~~~~~g~--gei  171 (254)
T PRK04281        109 RPDLIDEA---------------AGFFGSQAIVAAVDAKAVNPENTRWEIFTHGGRNPTGLDAVEWAVEMQKRGA--GEI  171 (254)
T ss_pred             CCHHHHHH---------------HHHCCCEEEEEEEEEEEECCCCCCEEEEECCCCCCCCCCHHHHHHHHHHCCC--CEE
T ss_conf             92676767---------------8755982179999888502468845999758864775449999999875299--899


Q ss_pred             ECCCEEECCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCEEEEHHHHHCHHHHHHHHHHC-CCEEEECCEEECCCCCCH
Q ss_conf             0541120487412445687989999999999996868721423115651656899999809-988997786651588898
Q gi|254780485|r  232 PINLLIPIPGSKFEENKKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSG-ANSIFVGDTLLTAKNPSY  310 (328)
Q Consensus       232 ~~~~~~p~~gt~l~~~~~~~~~e~lr~iAi~RL~lP~~~i~i~~~~~~~~~~~~~~~L~~G-aN~~~~g~~~~t~~g~~~  310 (328)
                      -+ --+-..|| +.    ....+.++-++  +.  .+..+.+++|--+ ..++.+ ++..| ++++.+|. +..-+.-++
T Consensus       172 l~-tdI~rDGt-~~----G~d~~l~~~i~--~~--~~iPvIasGGv~~-~~di~~-~~~~~~~~~v~~g~-~~~~~~~sl  238 (254)
T PRK04281        172 LL-TGMDRDGT-KQ----GFNLPLTRAVA--EA--VDIPVIASGGVGN-VRHLIE-GITEGKADAVLAAG-IFHFGEIAI  238 (254)
T ss_pred             EE-EEECCCCC-CC----CCCHHHHHHHH--HH--CCCCEEEECCCCC-HHHHHH-HHHHCCCCEEEEHH-HHHCCCCCH
T ss_conf             99-88857887-68----76869999998--61--6998999789899-999999-99808988897643-777799899


Q ss_pred             HHHHHHHHHCCCCC
Q ss_conf             99999999829853
Q gi|254780485|r  311 NKDTILFNRLGLIP  324 (328)
Q Consensus       311 ~~~~~~i~~~G~~P  324 (328)
                      .+..+.+++.|+.-
T Consensus       239 ~eak~~l~~~~i~v  252 (254)
T PRK04281        239 REAKRAMREAGIEV  252 (254)
T ss_pred             HHHHHHHHHCCCCC
T ss_conf             99999999867970


No 137
>PRK02747 consensus
Probab=93.82  E-value=0.56  Score=26.23  Aligned_cols=203  Identities=13%  Similarity=0.127  Sum_probs=114.0

Q ss_pred             HHHHHHHHHHHCCCEEEEEECCCCCCCCCCHHHHHHHHHHHC-CCCCCEEEECCCCCHHHHHHHHCCCCCEEEEECCC--
Q ss_conf             999999999964983899730368887442899999887621-36883241025699999998741576069751343--
Q gi|254780485|r   92 QVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVK-SLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDT--  168 (328)
Q Consensus        92 ei~~~a~~~~~~G~~~~~l~~~~~~~~~~~~~~~~e~i~~i~-~~~~~i~~~~g~~~~~~~~~Lk~aG~~~~~~~let--  168 (328)
                      ..++.|+...+.|+.+++++--......  -....+.++.+. +.++.+.+.-|..+.++.+++.++|++.+.++--.  
T Consensus        31 dP~~~ak~~~~~Gadelh~vDl~~a~~~--~~~~~~lI~~i~~~~~ipi~vGGGIrs~e~~~~ll~~GadkViigs~a~~  108 (257)
T PRK02747         31 DPVEAARAYDAAGADELCFLDITASHEN--RGTMLDVVARTAEQCFMPLTVGGGVRTVDDIRKLLLAGADKVSINSAAVA  108 (257)
T ss_pred             CHHHHHHHHHHCCCCEEEEEECCCCCCC--CHHHHHHHHHHHHHCCCCEEEECCCCCHHHHHHHHHCCCCEEEECHHHHH
T ss_conf             9999999999869998999947677567--55289999999986699889848820738878998769968983444654


Q ss_pred             CHHHHHCCCCCCCHHHHHHHHHHHHHCCCC-CCCE---------------EEECC---CCCHHHHHHHHHHHHHCCCCCC
Q ss_conf             777732058888989999999999987985-5770---------------78668---9899999999999974088886
Q gi|254780485|r  169 SERFYPHVTTTHTFEDRLQTLENVRKSGIK-VCCG---------------GILGL---GEMIDDRIDMLLTLANLSTPPE  229 (328)
Q Consensus       169 ~~~~~~~~~~~~~~~~~l~~~~~a~~~G~~-~~sg---------------~l~G~---gEt~eeri~~l~~lr~l~~~~~  229 (328)
                      .|.+..++               +.+.|=+ +...               -++=+   -.|.-+..+++..+.+++.  .
T Consensus       109 np~l~~~~---------------~~~fG~q~Iv~siD~k~~~~~~~~~~~~i~~~~~~~~t~~~~~~~~~~~~~~G~--g  171 (257)
T PRK02747        109 RPEFVAEA---------------ADKFGSQCIVVAIDAKRVSPAGENDRWEIFTHGGRKPTGIDAVEFAQKVVSLGA--G  171 (257)
T ss_pred             CCHHHHHH---------------HHHCCCEEEEEEEEEEECCCCCCCCCEEEEECCCCEECCCHHHHHHHHHHHCCC--C
T ss_conf             83477778---------------875596579999987751576778738999889846343039999999997099--8


Q ss_pred             EEECCCEEECCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCEEEEHHHHHCHHHHHHHHHHCCCEEEECCEEECCCCCC
Q ss_conf             02054112048741244568798999999999999686872142311565165689999980998899778665158889
Q gi|254780485|r  230 SIPINLLIPIPGSKFEENKKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPS  309 (328)
Q Consensus       230 ~v~~~~~~p~~gt~l~~~~~~~~~e~lr~iAi~RL~lP~~~i~i~~~~~~~~~~~~~~~L~~GaN~~~~g~~~~t~~g~~  309 (328)
                      .+-+ .-+-..|| +.   .++ .+.++-++-   ..+ ..+.+++|- .-..++.++.-..+++++++|.- ..-+.-+
T Consensus       172 eil~-tdI~rDG~-~~---G~d-l~l~~~i~~---~~~-~pvIasGGv-~~~~di~~~~~~~~~~av~~g~~-~~~~~~~  239 (257)
T PRK02747        172 EILL-TSMDRDGT-KA---GFD-LPLTRAIAD---AVR-VPVIASGGV-GTLDHLVEGVRDGHATAVLAASI-FHFGTYT  239 (257)
T ss_pred             EEEE-EEECCCCC-CC---CCC-HHHHHHHHH---CCC-CCEEEECCC-CCHHHHHHHHHHCCCCEEEEHHH-HHCCCCC
T ss_conf             8999-98835573-26---788-699999986---079-989997799-99999999998389849988326-7769989


Q ss_pred             HHHHHHHHHHCCCCCC
Q ss_conf             8999999998298532
Q gi|254780485|r  310 YNKDTILFNRLGLIPD  325 (328)
Q Consensus       310 ~~~~~~~i~~~G~~P~  325 (328)
                      +.+..+.+++.|+.-.
T Consensus       240 l~~ak~~L~~~~i~vR  255 (257)
T PRK02747        240 IGEAKAHMAAAGIPMR  255 (257)
T ss_pred             HHHHHHHHHHCCCCCC
T ss_conf             9999999998789654


No 138
>TIGR02660 nifV_homocitr homocitrate synthase; InterPro: IPR013477    Most NifV-type homocitrate synthases are encoded within operons for nitrogen fixation. They are homologous to enzymes that include 2-isopropylmalate synthase, (R)-citramalate synthase, and homocitrate synthases associated with other processes. The homocitrate made by these enzymes becomes a part of the iron-molybdenum cofactor of nitrogenase.; GO: 0004410 homocitrate synthase activity, 0051188 cofactor biosynthetic process.
Probab=93.76  E-value=0.57  Score=26.16  Aligned_cols=208  Identities=16%  Similarity=0.240  Sum_probs=122.4

Q ss_pred             CCCCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCCCCHHHHHHHHHHHCCCCCCEEEECCC-CCHHHHHHHHCCCCCEE
Q ss_conf             10006857999999999964983899730368887442899999887621368832410256-99999998741576069
Q gi|254780485|r   84 ASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLGLETCMTLGM-LSFEQAQILSKAGLDYY  162 (328)
Q Consensus        84 ~~~~~~~Eei~~~a~~~~~~G~~~~~l~~~~~~~~~~~~~~~~e~i~~i~~~~~~i~~~~g~-~~~~~~~~Lk~aG~~~~  162 (328)
                      .-.-++.+|=+++|+.+.+.|+.++-.+  ..-.-..+    .+.|+.|...++...+-... +...++..-.+.|++.+
T Consensus        16 pGVAF~~~EK~aIA~aLd~aGV~ElEvG--iPAMG~~E----~~~iraI~~~~l~a~l~~WcR~~~~Di~aa~~~G~~~V   89 (369)
T TIGR02660        16 PGVAFTAAEKLAIARALDEAGVDELEVG--IPAMGEEE----RAVIRAIVALGLKARLMAWCRARDADIEAAARCGVDAV   89 (369)
T ss_pred             CHHCCCHHHHHHHHHHHHHHCCCEEEEC--CCCCCHHH----HHHHHHHHHCCCCCEEEHHHHCCHHHHHHHHHHHHHEE
T ss_conf             2003487899999999998096247615--77687889----99999999628993031100104799999987205203


Q ss_pred             EEECCCCHH-HHHCCCCC-CCH-HHHH-HHHHHHHHCCCCCCCEEEECCCC-CHHH---HHHHHHHHHHCCCCCCEEECC
Q ss_conf             751343777-73205888-898-9999-99999998798557707866898-9999---999999997408888602054
Q gi|254780485|r  163 NHNIDTSER-FYPHVTTT-HTF-EDRL-QTLENVRKSGIKVCCGGILGLGE-MIDD---RIDMLLTLANLSTPPESIPIN  234 (328)
Q Consensus       163 ~~~let~~~-~~~~~~~~-~~~-~~~l-~~~~~a~~~G~~~~sg~l~G~gE-t~ee---ri~~l~~lr~l~~~~~~v~~~  234 (328)
                      ++.+-+|.. +..|...+ ..| .+.+ +++..|++.|+.||    +|-.+ |+.|   .++.+...++.+.       .
T Consensus        90 ~iS~PvSd~~~~~KL~~~Cr~w~~~~~~~~V~~A~~~Gl~Vs----VG~EDASRAd~~FL~~~~~~A~~aGA-------~  158 (369)
T TIGR02660        90 DISIPVSDLQIEAKLRKDCRAWVLERLARLVSFARDRGLEVS----VGGEDASRADPEFLVELAEVAQEAGA-------D  158 (369)
T ss_pred             ECCCCHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHCCCCEE----ECCCCCCCCCHHHHHHHHHHHHHCCC-------C
T ss_conf             100277799999974885789999999999999876442031----05625545888899999999987063-------1


Q ss_pred             CEEECCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCEEEEHHHHH-CHHHHH------HHHHHCCC---EEE--ECCEE
Q ss_conf             1120487412445687989999999999996868721423115651-656899------99980998---899--77866
Q gi|254780485|r  235 LLIPIPGSKFEENKKVDPIEHVRIISVARILMPKSRLRLAAGRAMM-SDELQA------LCFFSGAN---SIF--VGDTL  302 (328)
Q Consensus       235 ~~~p~~gt~l~~~~~~~~~e~lr~iAi~RL~lP~~~i~i~~~~~~~-~~~~~~------~~L~~GaN---~~~--~g~~~  302 (328)
                      +|++ -+|    ..-++|.-....++..|=-+|=       .+|-. ..|++.      -++++||.   .|.  .||  
T Consensus       159 RfRf-ADT----vG~LDPF~~~~~~~~Lr~~~~l-------~lE~HaHnDlGmATANtLAAv~AGA~~vntTV~GLGE--  224 (369)
T TIGR02660       159 RFRF-ADT----VGILDPFSTYELVRALRQAVDL-------PLEFHAHNDLGMATANTLAAVRAGATHVNTTVNGLGE--  224 (369)
T ss_pred             CCCH-HHH----CCCCCHHHHHHHHHHHHHCCCC-------CEEEEEECCHHHHHHHHHHHHHHCCEEEEEEECCHHH--
T ss_conf             1014-312----0225727899999998721799-------6258504763479999999886085776335433011--


Q ss_pred             ECCCCCCHHHHHHHHHH-CCCC
Q ss_conf             51588898999999998-2985
Q gi|254780485|r  303 LTAKNPSYNKDTILFNR-LGLI  323 (328)
Q Consensus       303 ~t~~g~~~~~~~~~i~~-~G~~  323 (328)
                       -++|...||..--++. .|+.
T Consensus       225 -RAGNAaLEEV~~AL~~~~G~d  245 (369)
T TIGR02660       225 -RAGNAALEEVAMALKRLLGRD  245 (369)
T ss_pred             -HHCCCHHHHHHHHHHHHCCCC
T ss_conf             -001222489999999857988


No 139
>PRK09140 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; Reviewed
Probab=93.65  E-value=0.6  Score=26.03  Aligned_cols=178  Identities=19%  Similarity=0.224  Sum_probs=112.1

Q ss_pred             CCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCCCCHHHHHHHHHHHCCCCC-CEEEECC-CCCHHHHHHHHCCCCCEEEE
Q ss_conf             068579999999999649838997303688874428999998876213688-3241025-69999999874157606975
Q gi|254780485|r   87 LINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLGL-ETCMTLG-MLSFEQAQILSKAGLDYYNH  164 (328)
Q Consensus        87 ~~~~Eei~~~a~~~~~~G~~~~~l~~~~~~~~~~~~~~~~e~i~~i~~~~~-~i~~~~g-~~~~~~~~~Lk~aG~~~~~~  164 (328)
                      ..+.|+.+..++.+.+.|++-+-+..  +.|.      ..+.|+.+++..+ .+.+-+| .++.++.++..++|++.+. 
T Consensus        18 ~~~~~~a~~~~~al~~~Gi~~iEVTl--~tp~------a~~~I~~l~~~~~~~~~iGAGTVlt~e~~~~ai~aGA~FiV-   88 (206)
T PRK09140         18 GITPDEALAHVGALIEAGFRAIEIPL--NSPD------PFDSIAALVKALGDDALIGAGTVLSPEQVDRLADAGGRLIV-   88 (206)
T ss_pred             CCCHHHHHHHHHHHHHCCCCEEEEEC--CCCC------HHHHHHHHHHHCCCCEEEEEEECCCHHHHHHHHHCCCCEEE-
T ss_conf             89999999999999986998899917--9976------99999999996798659986204679999999985999999-


Q ss_pred             ECCCCHHHHHCCCCCCCHHHHHHHHHHHHHCCCCCCCEEEECCCCCHHHHHHHHHHHHHCCCCCCEEECCCEEECCCCCC
Q ss_conf             13437777320588889899999999999879855770786689899999999999974088886020541120487412
Q gi|254780485|r  165 NIDTSERFYPHVTTTHTFEDRLQTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKF  244 (328)
Q Consensus       165 ~let~~~~~~~~~~~~~~~~~l~~~~~a~~~G~~~~sg~l~G~gEt~eeri~~l~~lr~l~~~~~~v~~~~~~p~~gt~l  244 (328)
                          +|        ..+    -++++.+++.|++.-.|.+     |+-|...-+    +.+.  ..+-   ++|-     
T Consensus        89 ----SP--------~~~----~~vi~~a~~~~i~~iPG~~-----TPsEi~~A~----~~Ga--~~vK---lFPA-----  133 (206)
T PRK09140         89 ----TP--------NID----PEVIRRAVAYGMTVMPGVA-----TPTEAFAAL----RAGA--DALK---LFPA-----  133 (206)
T ss_pred             ----CC--------CCC----HHHHHHHHHCCCCCCCCCC-----CHHHHHHHH----HCCC--CEEE---ECCH-----
T ss_conf             ----99--------998----9999999982996527859-----999999999----8598--7156---5751-----


Q ss_pred             CCCCCCCHHHHHHHHHHHHHHCC-CCCCEEEEHHHHHCHHHHHHHHHHCCCEEEECCEEECCCCCCHHHHHHHHHH
Q ss_conf             44568798999999999999686-8721423115651656899999809988997786651588898999999998
Q gi|254780485|r  245 EENKKVDPIEHVRIISVARILMP-KSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTILFNR  319 (328)
Q Consensus       245 ~~~~~~~~~e~lr~iAi~RL~lP-~~~i~i~~~~~~~~~~~~~~~L~~GaN~~~~g~~~~t~~g~~~~~~~~~i~~  319 (328)
                         ....+ .++|.+   |=.+| +..+ +.+|=  +..+.....|.+||...-+|.++ +.+|.+.++..+.-++
T Consensus       134 ---~~~Gp-~~ikal---~~p~P~~~~~-~ptGG--V~~~N~~~~l~aGa~avG~Gs~L-~~~~~~~~~i~~~a~~  198 (206)
T PRK09140        134 ---SQLGP-AGIKAL---RAVLPPDVPV-FAVGG--VTPENLAPYLAAGAAGFGLGSAL-YRPGQSAEEVAERARA  198 (206)
T ss_pred             ---HCCCH-HHHHHH---HCCCCCCCEE-EECCC--CCHHHHHHHHHCCCCEEEECHHC-CCCCCCHHHHHHHHHH
T ss_conf             ---10599-999998---6438999989-95379--88888999998699199960651-5999999999999999


No 140
>cd04739 DHOD_like Dihydroorotate dehydrogenase (DHOD) like proteins.  DHOD catalyzes the oxidation of (S)-dihydroorotate to orotate. This is the fourth step and the only redox reaction in the de novo biosynthesis of UMP, the precursor of all pyrimidine nucleotides. DHOD requires FMN as co-factor. DHOD divides into class 1 and class 2 based on their amino acid sequences and cellular location. Members of class 1 are cytosolic enzymes and multimers while class 2 enzymes are membrane associated and monomeric. The class 1 enzymes can be further divided into subtypes 1A and 1B which are homodimers and heterotetrameric proteins, respectively.  This subgroup has the conserved FMN binding site, but lacks some catalytic residues and may therefore be inactive.
Probab=93.63  E-value=0.6  Score=26.01  Aligned_cols=189  Identities=16%  Similarity=0.204  Sum_probs=92.8

Q ss_pred             CHHHHHHHHHHHCC-CCCCEEEECCCCCHHH----HHHHHCCCCCEEEEECCCCHHHHHCCCCCCCHHHHHHHHHHHHHC
Q ss_conf             28999998876213-6883241025699999----998741576069751343777732058888989999999999987
Q gi|254780485|r  121 DLSIIVDMIKGVKS-LGLETCMTLGMLSFEQ----AQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKS  195 (328)
Q Consensus       121 ~~~~~~e~i~~i~~-~~~~i~~~~g~~~~~~----~~~Lk~aG~~~~~~~let~~~~~~~~~~~~~~~~~l~~~~~a~~~  195 (328)
                      .++.+++.++..++ .+..+.+|+.-.+.++    .+++.++|+|.+.+|+-. +...+........++-.++++..++.
T Consensus        83 g~e~~l~~i~~~~~~~~~pvI~Si~g~s~ee~~~~a~~~~~~gad~lElNls~-~~~~~~~~~~~~~~~~~~iv~~Vk~~  161 (325)
T cd04739          83 GPEEYLELIRRAKRAVSIPVIASLNGVSAGGWVDYARQIEEAGADALELNIYA-LPTDPDISGAEVEQRYLDILRAVKSA  161 (325)
T ss_pred             CHHHHHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHCCCCEEEEECCC-CCCCCCCCCCHHHHHHHHHHHHHHHC
T ss_conf             89999999999875359875987168998999999999976499879996566-78885544210688999999999860


Q ss_pred             -CCCCCCEEEECCCCCHHHHHHHHHHHHHCCCCCCEEE-CCCE----------EECCCCCCCCCCCCCHHHHHHHHHHHH
Q ss_conf             -9855770786689899999999999974088886020-5411----------204874124456879899999999999
Q gi|254780485|r  196 -GIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIP-INLL----------IPIPGSKFEENKKVDPIEHVRIISVAR  263 (328)
Q Consensus       196 -G~~~~sg~l~G~gEt~eeri~~l~~lr~l~~~~~~v~-~~~~----------~p~~gt~l~~~~~~~~~e~lr~iAi~R  263 (328)
                       .+++    ++=+.-...+..+....+.+-+.  +++. +|.+          .|.++..+.. +... --.||+++..|
T Consensus       162 ~~~Pv----~vKLsP~~~di~~ia~aa~~~GA--dgi~liNT~~~~~id~~~~~~~~~~~lSg-~~~~-~~alr~v~~~~  233 (325)
T cd04739         162 VTIPV----AVKLSPFFSALAHMAKQLDAAGA--DGLVLFNRFYQPDIDLETLEVVPNLLLSS-PAEI-RLPLRWIAILS  233 (325)
T ss_pred             CCCCE----EEECCCCCCHHHHHHHHHHHCCC--CEEEEECCCCCCCCCCCCCEEECCCCCCC-CCCC-HHHHHHHHHHH
T ss_conf             78866----99539983009999999997599--88997357665642167641536877457-5300-68899999996


Q ss_pred             HHCCCCCCEEE-EHHHHHCHHHHHHHHHHCCCEEEECCEEECCCCCC-----HHHHHHHHHHCCCC
Q ss_conf             96868721423-11565165689999980998899778665158889-----89999999982985
Q gi|254780485|r  264 ILMPKSRLRLA-AGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPS-----YNKDTILFNRLGLI  323 (328)
Q Consensus       264 L~lP~~~i~i~-~~~~~~~~~~~~~~L~~GaN~~~~g~~~~t~~g~~-----~~~~~~~i~~~G~~  323 (328)
                      -..+   ++|. .|=..-+.|. -.-+.+||+.+-++--+ -..|+.     .++..+.+++-||.
T Consensus       234 ~~~~---ipIiG~GGI~s~~Da-~e~ilAGAsaVQv~TA~-~~~G~~i~~~i~~eL~~~m~~~G~~  294 (325)
T cd04739         234 GRVK---ASLAASGGVHDAEDV-VKYLLAGADVVMTTSAL-LRHGPDYIGTLLAGLEAWMEEHGYE  294 (325)
T ss_pred             CCCC---CCEEEECCCCCHHHH-HHHHHCCCCHHHEEHHH-HHHCCHHHHHHHHHHHHHHHHCCCC
T ss_conf             4689---898888895989999-99998098876143234-6418379999999999999983999


No 141
>COG1964 Predicted Fe-S oxidoreductases [General function prediction only]
Probab=93.23  E-value=0.7  Score=25.59  Aligned_cols=137  Identities=18%  Similarity=0.197  Sum_probs=77.6

Q ss_pred             CCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCC-CEEEEEECCCCCCCCCCHHHHHHHHHHHCCCCC-CEEEEC-C---C
Q ss_conf             243354777564100068579999999999649-838997303688874428999998876213688-324102-5---6
Q gi|254780485|r   72 CNQSVHNKSKLKASKLINVDQVLKEAKNAKENG-ATRYCMGAAWREPKERDLSIIVDMIKGVKSLGL-ETCMTL-G---M  145 (328)
Q Consensus        72 Caf~~~~~~~~~~~~~~~~Eei~~~a~~~~~~G-~~~~~l~~~~~~~~~~~~~~~~e~i~~i~~~~~-~i~~~~-g---~  145 (328)
                      |=+.+...  ...| --+.|+|.+.++.++..- .-...+|..|++|..  -+.+.++++..++.+. +|.++. |   .
T Consensus        78 CFa~A~~a--g~vY-Ept~eqi~~Ml~~lk~e~p~~~~aIq~tGGEPTv--r~DL~eiv~~a~e~g~~hVqinTnGirlA  152 (475)
T COG1964          78 CFAYAEEA--GYIY-EPTLEQIREMLRNLKKEHPVGANAVQFTGGEPTL--RDDLIEIIKIAREEGYDHVQLNTNGIRLA  152 (475)
T ss_pred             CCCCHHHC--CCCC-CCCHHHHHHHHHHHHHCCCCCCCEEEECCCCCCC--HHHHHHHHHHHHHCCCCEEEECCCCEEEC
T ss_conf             75764326--8614-7779999999999985389998326722898664--35589999977656861899825750201


Q ss_pred             CCHHHHHHHHCCCCCEEEEECCC-CHHHHHCCCCCCCHHHHHHHHHHHHHCCCCC---CCEEEECCCC-CHHHHHHHH
Q ss_conf             99999998741576069751343-7777320588889899999999999879855---7707866898-999999999
Q gi|254780485|r  146 LSFEQAQILSKAGLDYYNHNIDT-SERFYPHVTTTHTFEDRLQTLENVRKSGIKV---CCGGILGLGE-MIDDRIDML  218 (328)
Q Consensus       146 ~~~~~~~~Lk~aG~~~~~~~let-~~~~~~~~~~~~~~~~~l~~~~~a~~~G~~~---~sg~l~G~gE-t~eeri~~l  218 (328)
                      .+.+..++|++||+..+.+..+. .+..+.+.    -|+=.. +++..+++|+.+   -.|.+=|..+ ...+++++.
T Consensus       153 ~~~~~~~~l~~ag~~tvYlsFDG~~e~~~~~~----~~eIk~-alen~r~~g~~svVLVptl~rgvNd~~lG~iirfa  225 (475)
T COG1964         153 FDPEYVKKLREAGVNTVYLSFDGVTPKTNWKN----HWEIKQ-ALENCRKAGLPSVVLVPTLIRGVNDHELGAIIRFA  225 (475)
T ss_pred             CCHHHHHHHHHCCCCEEEEECCCCCCCCHHHH----HHHHHH-HHHHHHHCCCCCEEEEEHHHCCCCHHHHHHHHHHH
T ss_conf             37789988986588579994278998621767----755689-99987754887289971052156747777899998


No 142
>PRK13585 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional
Probab=93.10  E-value=0.73  Score=25.46  Aligned_cols=203  Identities=17%  Similarity=0.151  Sum_probs=103.7

Q ss_pred             HHHHHHHHHHHHCCCEEEEEECCC--CCCCCCCHHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHCCCCCEEEEECCC
Q ss_conf             799999999996498389973036--888744289999988762136883241025699999998741576069751343
Q gi|254780485|r   91 DQVLKEAKNAKENGATRYCMGAAW--REPKERDLSIIVDMIKGVKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDT  168 (328)
Q Consensus        91 Eei~~~a~~~~~~G~~~~~l~~~~--~~~~~~~~~~~~e~i~~i~~~~~~i~~~~g~~~~~~~~~Lk~aG~~~~~~~let  168 (328)
                      +..++.|+...+.|+.+++++--.  ........+.+.++.+   ..++.+.+--|..+.+..+++.++|++.+.++-.+
T Consensus        31 ~dP~~~a~~~~~~Ga~~lhivDLd~a~~g~~~n~~~I~~i~~---~~~~pi~vGGGIrs~~~i~~~l~~Ga~kvvigs~~  107 (240)
T PRK13585         31 GDPVEVAKRWVDAGAKTLHLVDLDGAFEGSRKNADIIEKIVE---ATDVSIQLGGGIRSVEDAASLLDLGVDRVILGTAA  107 (240)
T ss_pred             CCHHHHHHHHHHCCCCEEEEEECCCCCCCCCCHHHHHHHHHH---HCCCCEEEECCCCCHHHHHHHHHCCCCEEEECCCC
T ss_conf             899999999998799979999897721189444999999997---37977899788587999999997699899939811


Q ss_pred             --CHHHHHCCCCCCCHHHHHHHHHHHHHCCCCCCCEEEECCC---CCHHHHHHHHHHHHHCCCCCCEEECCCEEECCCCC
Q ss_conf             --7777320588889899999999999879855770786689---89999999999997408888602054112048741
Q gi|254780485|r  169 --SERFYPHVTTTHTFEDRLQTLENVRKSGIKVCCGGILGLG---EMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSK  243 (328)
Q Consensus       169 --~~~~~~~~~~~~~~~~~l~~~~~a~~~G~~~~sg~l~G~g---Et~eeri~~l~~lr~l~~~~~~v~~~~~~p~~gt~  243 (328)
                        .|++..++......+...        +++..--+-++=+|   .+..+..+.+..+.+++.  ..+-+ --+-..|| 
T Consensus       108 ~~~~~~~~~i~~~~G~~~iv--------vsiD~k~~~v~~~gw~~~~~~~~~e~~~~~~~~g~--~eii~-tdI~~dGt-  175 (240)
T PRK13585        108 IENPELVRELSDEFGSERVM--------VSLDAKDGEVVIEGWTESTGKDPVEWAQRFEELGA--GSILF-TNVDVEGL-  175 (240)
T ss_pred             HHCCHHHHHHHHHHCCCEEE--------EEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHCCC--CEEEE-EEECCHHH-
T ss_conf             31842889999873972179--------99993065023247656788635577788886387--35898-64233223-


Q ss_pred             CCCCCCCCHHHHHHHHHHHHHHCCCCCCEEEEHHHHHCHHHHHHHHHHCCCEEEECCEEECCCCCCHHHHHHHHHH
Q ss_conf             2445687989999999999996868721423115651656899999809988997786651588898999999998
Q gi|254780485|r  244 FEENKKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTILFNR  319 (328)
Q Consensus       244 l~~~~~~~~~e~lr~iAi~RL~lP~~~i~i~~~~~~~~~~~~~~~L~~GaN~~~~g~~~~t~~g~~~~~~~~~i~~  319 (328)
                      +    .....+.++-++-  .  .+..+.+++|- +-..+...+ -..|+++.++|--+ -.+.-+.+|.++..++
T Consensus       176 ~----~G~d~~~~~~i~~--~--~~~pviasGGv-~s~~di~~l-~~~g~~gvivG~Al-~~g~i~l~e~~~~~~~  240 (240)
T PRK13585        176 L----QGVNPEPVRELVD--S--VDIPVIASGGV-TSLDDVKAL-KEAGAAGVVVGSAL-YKGKFTLEEALEAAED  240 (240)
T ss_pred             H----CCCCHHHHHHHHH--H--CCCCEEEECCC-CCHHHHHHH-HHCCCCEEEEEHHH-HCCCCCHHHHHHHHHC
T ss_conf             2----5789899999998--6--89999998899-999999999-97899789987687-6799789999999649


No 143
>PRK05581 ribulose-phosphate 3-epimerase; Validated
Probab=93.05  E-value=0.74  Score=25.41  Aligned_cols=197  Identities=19%  Similarity=0.211  Sum_probs=106.4

Q ss_pred             CHHHHHHHHHHHHHCCCEEEEE-ECCCCCCCCC-CHHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHCCCCCEEEEEC
Q ss_conf             8579999999999649838997-3036888744-2899999887621368832410256999999987415760697513
Q gi|254780485|r   89 NVDQVLKEAKNAKENGATRYCM-GAAWREPKER-DLSIIVDMIKGVKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNI  166 (328)
Q Consensus        89 ~~Eei~~~a~~~~~~G~~~~~l-~~~~~~~~~~-~~~~~~e~i~~i~~~~~~i~~~~g~~~~~~~~~Lk~aG~~~~~~~l  166 (328)
                      +.-.+.++++...+.|+..+++ +.-|+.-+.. .-...++.++...+....+|+-+-. .+..+..+.++|++.+..-.
T Consensus        14 d~~~l~~~i~~l~~~g~~~lHiDImDG~FVpn~t~g~~~v~~i~~~t~~~~DvHLMv~~-P~~~i~~~~~~g~d~I~~H~   92 (220)
T PRK05581         14 DFARLGEEVKAVEAAGADWIHVDVMDGHFVPNLTIGPPVVEAIRKVTKLPLDVHLMVEN-PDRYVPDFAKAGADIITFHV   92 (220)
T ss_pred             CHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCHHHHHHHHHHCCCCEEEEEEEEC-HHHHHHHHHHCCCCEEEECC
T ss_conf             99999999999997699989995757844775563999999998418996478999718-88879999973998899816


Q ss_pred             CCCHHHHHCCCCCCCHHHHHHHHHHHHHCCCCCCCEEEECCCCCHHHHHHHHHHHHHCCCCCCEEECCCEEECCCCCCCC
Q ss_conf             43777732058888989999999999987985577078668989999999999997408888602054112048741244
Q gi|254780485|r  167 DTSERFYPHVTTTHTFEDRLQTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEE  246 (328)
Q Consensus       167 et~~~~~~~~~~~~~~~~~l~~~~~a~~~G~~~~sg~l~G~gEt~eeri~~l~~lr~l~~~~~~v~~~~~~p~~gt~l~~  246 (328)
                      |+...             ..++++..++.|+++  |+-+.. +|.-+.++-+.  ..++    .|-+.-  -.||-  .+
T Consensus        93 Ea~~~-------------~~~~i~~ik~~g~k~--Glalnp-~T~~~~l~~~l--~~iD----~VlvMt--V~PGf--~G  146 (220)
T PRK05581         93 EASEH-------------IHRLLQLIKEAGIKA--GLVLNP-ATPLEYLEYVL--PLLD----LVLLMS--VNPGF--GG  146 (220)
T ss_pred             CCCCC-------------HHHHHHHHHHCCCCE--EEEECC-CCCHHHHHHHH--HHHC----EEEEEE--ECCCC--CC
T ss_conf             75027-------------999999999749970--467669-99989999998--7415----258998--65887--87


Q ss_pred             CCCCCHHHHHHHHHHHHHHC----CCCCCEEEEHHHHHCHHHHHHHHHHCCCEEEECCEEECCCCCCHHHHHHHHHH
Q ss_conf             56879899999999999968----68721423115651656899999809988997786651588898999999998
Q gi|254780485|r  247 NKKVDPIEHVRIISVARILM----PKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTILFNR  319 (328)
Q Consensus       247 ~~~~~~~e~lr~iAi~RL~l----P~~~i~i~~~~~~~~~~~~~~~L~~GaN~~~~g~~~~t~~g~~~~~~~~~i~~  319 (328)
                      .+-  -.+.+.-+.-+|=+.    ++..|.+-+|   +..+.......+|||.++.|.++-.+.  .+.+.++.+|+
T Consensus       147 Q~f--~~~~l~ki~~l~~~~~~~~~~~~I~VDGG---In~~~i~~l~~~Gad~~V~GS~iF~~~--d~~~~i~~lk~  216 (220)
T PRK05581        147 QKF--IPEVLEKIREVRKLIDERGLDILIEVDGG---VNAENIKECAEAGADVFVAGSAVFGAP--DYKEAIDELRA  216 (220)
T ss_pred             CCC--CHHHHHHHHHHHHHHHHCCCCEEEEEECC---CCHHHHHHHHHCCCCEEEECHHHHCCC--CHHHHHHHHHH
T ss_conf             645--56699999999999984599755999789---898999999977999999794885799--99999999999


No 144
>KOG2550 consensus
Probab=92.85  E-value=0.79  Score=25.23  Aligned_cols=169  Identities=15%  Similarity=0.164  Sum_probs=95.9

Q ss_pred             HHHHHHHHHHHHCCCEEEEEECCCCCCCCCCHHHHHHHHHHHCCCCCCEEEECC-CCCHHHHHHHHCCCCCEEEEECCCC
Q ss_conf             799999999996498389973036888744289999988762136883241025-6999999987415760697513437
Q gi|254780485|r   91 DQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLGLETCMTLG-MLSFEQAQILSKAGLDYYNHNIDTS  169 (328)
Q Consensus        91 Eei~~~a~~~~~~G~~~~~l~~~~~~~~~~~~~~~~e~i~~i~~~~~~i~~~~g-~~~~~~~~~Lk~aG~~~~~~~let~  169 (328)
                      |+-....+...+.|..-+++-++..     .-.|.+++|+-||+..|++.+-.| ..+.++.+.|-++|+|.+.+...+-
T Consensus       250 e~dK~rl~ll~~aGvdvviLDSSqG-----nS~~qiemik~iK~~yP~l~ViaGNVVT~~qa~nLI~aGaDgLrVGMGsG  324 (503)
T KOG2550         250 DDDKERLDLLVQAGVDVVILDSSQG-----NSIYQLEMIKYIKETYPDLQIIAGNVVTKEQAANLIAAGADGLRVGMGSG  324 (503)
T ss_pred             CHHHHHHHHHHHCCCCEEEEECCCC-----CCHHHHHHHHHHHHHCCCCEEECCCEEEHHHHHHHHHCCCCEEEECCCCC
T ss_conf             3016778886634886899966888-----50457999999986688863431655338889999873676057525567


Q ss_pred             -----HHHHHCCCCCCCHHHHHHHHHHHHHCCCCCCCEEEECCCCCHHHHHHHHHHHHHCCCCCCE----------EECC
Q ss_conf             -----7773205888898999999999998798557707866898999999999999740888860----------2054
Q gi|254780485|r  170 -----ERFYPHVTTTHTFEDRLQTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPES----------IPIN  234 (328)
Q Consensus       170 -----~~~~~~~~~~~~~~~~l~~~~~a~~~G~~~~sg~l~G~gEt~eeri~~l~~lr~l~~~~~~----------v~~~  234 (328)
                           .+.-.-.+|..+  .-.++.+.|+..|+++-+-   |-..+..+++..|    .|+..+.+          .| .
T Consensus       325 SiCiTqevma~GrpQ~T--AVy~va~~A~q~gvpviAD---GGi~~~Ghi~KAl----~lGAstVMmG~lLAgtTEap-G  394 (503)
T KOG2550         325 SICITQKVMACGRPQGT--AVYKVAEFANQFGVPCIAD---GGIQNVGHVVKAL----GLGASTVMMGGLLAGTTEAP-G  394 (503)
T ss_pred             CEEEECEEEECCCCCCC--CHHHHHHHHHHCCCCEECC---CCCCCCHHHHHHH----HCCCHHHHCCCHHCCCCCCC-C
T ss_conf             50545301232677620--0326999997649965506---8758731778887----53850631041101023588-6


Q ss_pred             CEEECCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCEEE
Q ss_conf             1120487412445687989999999999996868721423
Q gi|254780485|r  235 LLIPIPGSKFEENKKVDPIEHVRIISVARILMPKSRLRLA  274 (328)
Q Consensus       235 ~~~p~~gt~l~~~~~~~~~e~lr~iAi~RL~lP~~~i~i~  274 (328)
                      -+....|-.++....+...+...--.-.|.+-....+.++
T Consensus       395 eyf~~~g~r~KkyrGMGSl~AM~~~s~~rY~~e~dkvkiA  434 (503)
T KOG2550         395 EYFFRDGVRLKKYRGMGSLDAMESSSQKRYFSEVDKVKIA  434 (503)
T ss_pred             CEEEECCEEEEEECCCCHHHHHHHHHHHCCCCCCCEEEEC
T ss_conf             1474247343201176558877512011003665447641


No 145
>PRK07807 inositol-5-monophosphate dehydrogenase; Validated
Probab=92.75  E-value=0.81  Score=25.13  Aligned_cols=98  Identities=21%  Similarity=0.309  Sum_probs=46.5

Q ss_pred             HHHHHHHHHHHCCCEEEEEECCCCCCCCCCHHHHHHHHHHHCCCCCCEEEECC-CCCHHHHHHHHCCCCCEEEEECCCCH
Q ss_conf             99999999996498389973036888744289999988762136883241025-69999999874157606975134377
Q gi|254780485|r   92 QVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLGLETCMTLG-MLSFEQAQILSKAGLDYYNHNIDTSE  170 (328)
Q Consensus        92 ei~~~a~~~~~~G~~~~~l~~~~~~~~~~~~~~~~e~i~~i~~~~~~i~~~~g-~~~~~~~~~Lk~aG~~~~~~~let~~  170 (328)
                      +..+.++.+.+.|+--+++=+.+.     .-.+.+++++.+|+.++.+.+-+| ..+.+..+.|.++|+|.+.+.+..- 
T Consensus       227 d~~eR~~aLv~AGvDvlvIDtAHG-----hS~~vi~~vk~iK~~~p~~~viaGNvaT~~~a~~Li~aGad~ikvGiG~G-  300 (479)
T PRK07807        227 DVAAKARALLEAGVDVLVIDTAHG-----HQEKMLEAIRAVRALDPGVPLVAGNVVTAEGTRDLVEAGADIVKVGVGPG-  300 (479)
T ss_pred             CHHHHHHHHHHCCCCEEEEECCCC-----CHHHHHHHHHHHHHHCCCCCEEEEEHHHHHHHHHHHHCCCCEEECCCCCC-
T ss_conf             589999999976998999754576-----64899999999984089885787432029999999973999763155578-


Q ss_pred             HHHHCCCCCC--------CHHHHHHHHHHHHHCCCCC
Q ss_conf             7732058888--------9899999999999879855
Q gi|254780485|r  171 RFYPHVTTTH--------TFEDRLQTLENVRKSGIKV  199 (328)
Q Consensus       171 ~~~~~~~~~~--------~~~~~l~~~~~a~~~G~~~  199 (328)
                          .+|++.        ....-.++-+.|++.|+++
T Consensus       301 ----SiCtTr~v~gvG~pq~tAi~~~a~~a~~~gvpi  333 (479)
T PRK07807        301 ----AMCTTRMMTGVGRPQFSAVLECAAAARELGAHV  333 (479)
T ss_pred             ----CCEECCCCCCCCCCHHHHHHHHHHHHHHCCCCE
T ss_conf             ----324346323778860999999999987569978


No 146
>PRK01659 consensus
Probab=92.62  E-value=0.85  Score=25.02  Aligned_cols=201  Identities=15%  Similarity=0.135  Sum_probs=114.2

Q ss_pred             HHHHHHHHHHHCCCEEEEEECCCCCCCCCCHHHHHHHHHHH-CCCCCCEEEECCCCCHHHHHHHHCCCCCEEEEECCC--
Q ss_conf             99999999996498389973036888744289999988762-136883241025699999998741576069751343--
Q gi|254780485|r   92 QVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGV-KSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDT--  168 (328)
Q Consensus        92 ei~~~a~~~~~~G~~~~~l~~~~~~~~~~~~~~~~e~i~~i-~~~~~~i~~~~g~~~~~~~~~Lk~aG~~~~~~~let--  168 (328)
                      ..++.|+...+.|+.+++++--.......  ....++++.+ ++.++.+.+.-|..+.++.+.+.++|++.+.++-..  
T Consensus        31 DP~~~ak~~~~~Gad~ihivDld~a~~g~--~~n~~~I~~i~~~~~ipi~vGGGIrs~e~~~~~l~~GadkViigs~a~~  108 (252)
T PRK01659         31 DPVEIAAAYNEAGADELVFLDITATHEGR--KTMVDVVEKVAAKVFIPLTVGGGISSVKDMKRLLRAGADKVSINSAAVL  108 (252)
T ss_pred             CHHHHHHHHHHCCCCEEEEEECCCCCCCC--HHHHHHHHHHHHHCCCCEEEECCEECHHHHHHHHHCCCCEEEECHHHHH
T ss_conf             99999999998799999999467665688--6489999999975697479963320068888987448855983177752


Q ss_pred             CHHHHHCCCCCCCHHHHHHHHHHHHHCCCC-C------------CCEEEECCC---CCHHHHHHHHHHHHHCCCCCCEEE
Q ss_conf             777732058888989999999999987985-5------------770786689---899999999999974088886020
Q gi|254780485|r  169 SERFYPHVTTTHTFEDRLQTLENVRKSGIK-V------------CCGGILGLG---EMIDDRIDMLLTLANLSTPPESIP  232 (328)
Q Consensus       169 ~~~~~~~~~~~~~~~~~l~~~~~a~~~G~~-~------------~sg~l~G~g---Et~eeri~~l~~lr~l~~~~~~v~  232 (328)
                      .|.+..+.               +.+.|=+ +            +.+.++-+|   .+.-+..+++..+.+++.  ..+-
T Consensus       109 n~~~i~~~---------------~~~~G~q~IvvsiD~k~~~~~~~~~i~~~g~~~~~~~~~~~~i~~~~~~g~--geil  171 (252)
T PRK01659        109 RPELITEG---------------ADHFGSQCIVVAIDAKYDAEAGKWNVYTHGGRVDTGLDAIAWAKEAVRLGA--GEIL  171 (252)
T ss_pred             CHHHHHHH---------------HHHCCCEEEEEEEEEEEECCCCCEEEEECCCCCCCCCCHHHHHHHHHHCCC--CEEE
T ss_conf             91532146---------------764686326999998970568868999689957677779999999997699--7799


Q ss_pred             CCCEEECCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCEEEEHHHHHCHHHHHHHHHHCCCEEEECCEEECCCCCCHHH
Q ss_conf             54112048741244568798999999999999686872142311565165689999980998899778665158889899
Q gi|254780485|r  233 INLLIPIPGSKFEENKKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNK  312 (328)
Q Consensus       233 ~~~~~p~~gt~l~~~~~~~~~e~lr~iAi~RL~lP~~~i~i~~~~~~~~~~~~~~~L~~GaN~~~~g~~~~t~~g~~~~~  312 (328)
                      + --+-..|| +.   .++ .+.++-++-   .. +..+.+++|- +-..++..+.-..+++++++|.-+ --+.-++.+
T Consensus       172 ~-tdI~rDG~-~~---G~d-l~l~~~i~~---~~-~~PiIasGGi-~~~~di~~l~~~~~v~gv~~g~~~-~~~~~sl~e  239 (252)
T PRK01659        172 L-TSMDADGT-KN---GFD-LRLTKAISE---AV-SVPVIASGGA-GNADHMVEVFQKTTADAALAASIF-HYGETSIKE  239 (252)
T ss_pred             E-EEECCCCC-CC---CCC-HHHHHHHHH---HC-CCCEEEEECC-CCHHHHHHHHHHCCCCEEEEHHHH-HCCCCCHHH
T ss_conf             9-98814585-47---689-899999998---68-9999999179-999999999974898265575477-779999999


Q ss_pred             HHHHHHHCCCC
Q ss_conf             99999982985
Q gi|254780485|r  313 DTILFNRLGLI  323 (328)
Q Consensus       313 ~~~~i~~~G~~  323 (328)
                      ..+.+++.|+.
T Consensus       240 ~k~~L~~~~~~  250 (252)
T PRK01659        240 VKAKLREAGVN  250 (252)
T ss_pred             HHHHHHHCCCC
T ss_conf             99999987498


No 147
>KOG4039 consensus
Probab=92.48  E-value=0.16  Score=29.89  Aligned_cols=63  Identities=17%  Similarity=0.210  Sum_probs=48.8

Q ss_pred             CCCCCCCCCCCCCCCC-CCCCCCCCCCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCCCCHHH
Q ss_conf             7868342321243354-77756410006857999999999964983899730368887442899
Q gi|254780485|r   62 TGGCPENCGYCNQSVH-NKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSI  124 (328)
Q Consensus        62 TN~C~~~C~fCaf~~~-~~~~~~~~~~~~~Eei~~~a~~~~~~G~~~~~l~~~~~~~~~~~~~~  124 (328)
                      ||.-..+-.||+.... -+++.+..+..+.|.++..|+.+++.|++++.++++-.-++.+.+-|
T Consensus        79 ~~~qg~dV~FcaLgTTRgkaGadgfykvDhDyvl~~A~~AKe~Gck~fvLvSS~GAd~sSrFlY  142 (238)
T KOG4039          79 TNEQGPDVLFCALGTTRGKAGADGFYKVDHDYVLQLAQAAKEKGCKTFVLVSSAGADPSSRFLY  142 (238)
T ss_pred             HHHCCCCEEEEEECCCCCCCCCCCEEEECHHHHHHHHHHHHHCCCEEEEEEECCCCCCCCCEEE
T ss_conf             6502885689961135555566753761538888899998858970899974267886434202


No 148
>PTZ00314 inosine-5'-monophosphate dehydrogenase; Provisional
Probab=92.29  E-value=0.93  Score=24.75  Aligned_cols=28  Identities=21%  Similarity=0.400  Sum_probs=12.8

Q ss_pred             EEEHHHHHCHHHHHHHHHHCCCEEEECCE
Q ss_conf             23115651656899999809988997786
Q gi|254780485|r  273 LAAGRAMMSDELQALCFFSGANSIFVGDT  301 (328)
Q Consensus       273 i~~~~~~~~~~~~~~~L~~GaN~~~~g~~  301 (328)
                      |+-|=.+...+. -+||-+||+.+|+|..
T Consensus       345 IADGGIr~sGDi-~KAlAaGAd~VMlGsl  372 (499)
T PTZ00314        345 IADGGIRSSGDI-VKALALGASCVMLGSM  372 (499)
T ss_pred             EECCCCCCHHHH-HHHHHCCCCEEEECCC
T ss_conf             914784643189-9998728987860841


No 149
>pfam05913 DUF871 Bacterial protein of unknown function (DUF871). This family consists of several conserved hypothetical proteins from bacteria and archaea. The function of this family is unknown.
Probab=92.10  E-value=0.98  Score=24.61  Aligned_cols=118  Identities=26%  Similarity=0.298  Sum_probs=62.2

Q ss_pred             CHHHHHHHHHHHHHCCCEEEEEECCCCC-CCCCCHHHHHHHHHHHCCCCCCEEEECCC-------CCHHHHHHHHCCCCC
Q ss_conf             8579999999999649838997303688-87442899999887621368832410256-------999999987415760
Q gi|254780485|r   89 NVDQVLKEAKNAKENGATRYCMGAAWRE-PKERDLSIIVDMIKGVKSLGLETCMTLGM-------LSFEQAQILSKAGLD  160 (328)
Q Consensus        89 ~~Eei~~~a~~~~~~G~~~~~l~~~~~~-~~~~~~~~~~e~i~~i~~~~~~i~~~~g~-------~~~~~~~~Lk~aG~~  160 (328)
                      +.|+..+..+.+.+.|++++........ +.....+.+-++++..++.++.+.+-+.+       .+.+.+..|++.|++
T Consensus        11 ~~e~~~~yi~~a~~~Gf~~iFTSL~i~e~~~~~~~~~~~~l~~~a~~~g~~vi~DIsp~~l~~lg~s~~dl~~~~~lGi~   90 (357)
T pfam05913        11 TFEEDKAYIKLAAKLGFTRIFTSLHIPEDDKEEYLERLKELIKYAKELGMEVIADISPSVLKQLGISYDDLSFLKELGVT   90 (357)
T ss_pred             CHHHHHHHHHHHHHCCCCEEEECCCCCCCCHHHHHHHHHHHHHHHHHCCCEEEEECCHHHHHHCCCCHHHHHHHHHCCCC
T ss_conf             87999999999998699899604775788879999999999999998799999987989998819997889999977998


Q ss_pred             EEEEEC---------------------CC---------------------CHHHHHCCCCCCCHHHHHHHHHHHHHCCCC
Q ss_conf             697513---------------------43---------------------777732058888989999999999987985
Q gi|254780485|r  161 YYNHNI---------------------DT---------------------SERFYPHVTTTHTFEDRLQTLENVRKSGIK  198 (328)
Q Consensus       161 ~~~~~l---------------------et---------------------~~~~~~~~~~~~~~~~~l~~~~~a~~~G~~  198 (328)
                      .+-+..                     -|                     .=.+|++--++-+++.-.+.-+..|+.|++
T Consensus        91 glRlD~Gf~~~eia~ls~n~l~I~LNASti~~~~l~~l~~~~~n~~~l~a~HNfYPr~~TGLs~~~f~~~n~~~k~~gi~  170 (357)
T pfam05913        91 GLRLDYGFTGEEIAELSKNPLKIELNASTITTEYLDNLLSYGANFENLEACHNFYPRPYTGLSYEFFLEKNRWFKKYGIK  170 (357)
T ss_pred             EEEECCCCCHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHCCCCHHHEEEEECCCCCCCCCCCHHHHHHHHHHHHHCCCC
T ss_conf             99977999989999972799679997864999999999980998789799744479988788999999999999977996


Q ss_pred             CCCEEEECC
Q ss_conf             577078668
Q gi|254780485|r  199 VCCGGILGL  207 (328)
Q Consensus       199 ~~sg~l~G~  207 (328)
                      +. .++-|.
T Consensus       171 ~~-AFI~g~  178 (357)
T pfam05913       171 TA-AFIPGD  178 (357)
T ss_pred             EE-EEEECC
T ss_conf             89-997279


No 150
>PRK02621 consensus
Probab=91.64  E-value=1.1  Score=24.27  Aligned_cols=201  Identities=13%  Similarity=0.090  Sum_probs=111.1

Q ss_pred             HHHHHHHHHHHCCCEEEEEECCCCCCCCCCHHHHHHHHHHHC-CCCCCEEEECCCCCHHHHHHHHCCCCCEEEEECCC--
Q ss_conf             999999999964983899730368887442899999887621-36883241025699999998741576069751343--
Q gi|254780485|r   92 QVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVK-SLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDT--  168 (328)
Q Consensus        92 ei~~~a~~~~~~G~~~~~l~~~~~~~~~~~~~~~~e~i~~i~-~~~~~i~~~~g~~~~~~~~~Lk~aG~~~~~~~let--  168 (328)
                      ..++.|+...+.|+.+++++--......+  ....++++.+. +.++.+.+--|..+.++.+++.++|++.+.++=-.  
T Consensus        31 dP~~~ak~~~~~gad~lhivDld~a~~~~--~~~~~~I~~i~~~~~ipi~vGGGIrs~e~~~~ll~~GadkVii~s~a~~  108 (254)
T PRK02621         31 DPVELACRYSQAGADELVFLDITATHEGR--ATLIDVVYRTAEQVFIPLTVGGGISSLEGIKELLRAGADKVSLNSAAVR  108 (254)
T ss_pred             CHHHHHHHHHHCCCCEEEEEECCCCCCCC--HHHHHHHHHHHHHCCCCEEEECCEEEHHHHHHHHHCCCCEEEECCHHHH
T ss_conf             99999999998599999998266765675--4289999999986798589963353579999999749998999886764


Q ss_pred             CHHHHHCCCCCCCHHHHHHHHHHHHHCCCC-CCCE-------------EEEC---CCCCHHHHHHHHHHHHHCCCCCCEE
Q ss_conf             777732058888989999999999987985-5770-------------7866---8989999999999997408888602
Q gi|254780485|r  169 SERFYPHVTTTHTFEDRLQTLENVRKSGIK-VCCG-------------GILG---LGEMIDDRIDMLLTLANLSTPPESI  231 (328)
Q Consensus       169 ~~~~~~~~~~~~~~~~~l~~~~~a~~~G~~-~~sg-------------~l~G---~gEt~eeri~~l~~lr~l~~~~~~v  231 (328)
                      .|++..++               +...|-+ +..+             -+|-   .-.|.-+..+++..+.+++.  ..+
T Consensus       109 np~~~~~~---------------~~~fG~q~Iv~siD~k~~~~~~~gw~~~~~~~~~~~~~~~~~~~~~~~~~g~--gei  171 (254)
T PRK02621        109 DPDLVRQA---------------SDRFGSQCIVVAIDARRRKPDNPGWDVYVRGGRENTGLDAVEWAEEVAERGA--GEI  171 (254)
T ss_pred             CCCHHHHH---------------HHHCCCCCEEEEEEEECCCCCCCCEEEEECCCCCCCCCCHHHHHHHHHHHCC--CEE
T ss_conf             73544556---------------8756984339999955353478862899668845577679999988776288--969


Q ss_pred             ECCCEEECCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCEEEEHHHHHCHHHHHHHHHHCCCEEEECCEEECCCCCCHH
Q ss_conf             05411204874124456879899999999999968687214231156516568999998099889977866515888989
Q gi|254780485|r  232 PINLLIPIPGSKFEENKKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYN  311 (328)
Q Consensus       232 ~~~~~~p~~gt~l~~~~~~~~~e~lr~iAi~RL~lP~~~i~i~~~~~~~~~~~~~~~L~~GaN~~~~g~~~~t~~g~~~~  311 (328)
                      -+ .-+-..|| +    .....+.++-++-  . . +..+.+++|- +-..++.+..-..|+.++++|.-+ -.+--+++
T Consensus       172 l~-tdI~~DGt-~----~G~d~~l~~~i~~--~-~-~iPvi~sGGi-~s~edi~~~l~~~~v~gvivG~al-~~~~~~l~  239 (254)
T PRK02621        172 LL-TSMDGDGT-Q----AGYDLELTRAIAE--A-V-EIPVIASGGA-GCCDHIAEALTEGKAEAALLASLL-HYGQLTIA  239 (254)
T ss_pred             EE-EEECCCCC-C----CCCCHHHHHHHHH--H-C-CCCEEEECCC-CCHHHHHHHHHHCCCEEEEEHHHH-HCCCCCHH
T ss_conf             99-88804797-5----7688699999997--1-7-9979997799-999999999985898198775787-88999999


Q ss_pred             HHHHHHHHCCCC
Q ss_conf             999999982985
Q gi|254780485|r  312 KDTILFNRLGLI  323 (328)
Q Consensus       312 ~~~~~i~~~G~~  323 (328)
                      +..+.++..|+.
T Consensus       240 e~K~~l~~~~i~  251 (254)
T PRK02621        240 EIKADLLARGLP  251 (254)
T ss_pred             HHHHHHHHCCCC
T ss_conf             999999977799


No 151
>cd00429 RPE Ribulose-5-phosphate 3-epimerase (RPE). This enzyme catalyses the interconversion of D-ribulose 5-phosphate (Ru5P) into D-xylulose 5-phosphate, as part of the Calvin cycle (reductive pentose phosphate pathway) in chloroplasts and in the oxidative pentose phosphate pathway. In the Calvin cycle Ru5P is phosphorylated by phosphoribulose kinase to ribulose-1,5-bisphosphate, which in turn is used by RubisCO (ribulose-1,5-bisphosphate carboxylase/oxygenase) to incorporate CO2 as the central step in carbohydrate synthesis.
Probab=91.54  E-value=1.1  Score=24.20  Aligned_cols=185  Identities=19%  Similarity=0.225  Sum_probs=102.7

Q ss_pred             CHHHHHHHHHHHHHCCCEEEEE-ECCCCC-CCCCCHHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHCCCCCEEEEEC
Q ss_conf             8579999999999649838997-303688-87442899999887621368832410256999999987415760697513
Q gi|254780485|r   89 NVDQVLKEAKNAKENGATRYCM-GAAWRE-PKERDLSIIVDMIKGVKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNI  166 (328)
Q Consensus        89 ~~Eei~~~a~~~~~~G~~~~~l-~~~~~~-~~~~~~~~~~e~i~~i~~~~~~i~~~~g~~~~~~~~~Lk~aG~~~~~~~l  166 (328)
                      +.-.+.++.+...+.|+..+++ +.-|+- |....-...++.++...+....+|+-+-. .+..+..+.++|++.+..-.
T Consensus        10 d~~~l~~~i~~~~~~g~d~lHiDimDG~Fvpn~t~g~~~v~~i~~~t~~~~DvHLMv~~-P~~~i~~~~~~g~d~I~~H~   88 (211)
T cd00429          10 DFANLGEELKRLEEAGADWIHIDVMDGHFVPNLTFGPPVVKALRKHTDLPLDVHLMVEN-PERYIEAFAKAGADIITFHA   88 (211)
T ss_pred             CHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCHHHHHHHHHHCCCCEEEEEEECC-HHHHHHHHHHHCCCEEEECC
T ss_conf             99999999999997699989995757972786675989999998757997058998718-87769999970998899864


Q ss_pred             CCCHHHHHCCCCCCCHHHHHHHHHHHHHCCCCCCCEEEECCCCCHHHHHHHHHHHHHCCCCCCEEECCCEEECCCCCCCC
Q ss_conf             43777732058888989999999999987985577078668989999999999997408888602054112048741244
Q gi|254780485|r  167 DTSERFYPHVTTTHTFEDRLQTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEE  246 (328)
Q Consensus       167 et~~~~~~~~~~~~~~~~~l~~~~~a~~~G~~~~sg~l~G~gEt~eeri~~l~~lr~l~~~~~~v~~~~~~p~~gt~l~~  246 (328)
                      |+.+             +..++++..++.|+++  |+-+... |.-+.+..+..  .++    .|-+.  .-.||.  .+
T Consensus        89 E~~~-------------~~~~~i~~ik~~g~~~--Glal~p~-T~~~~l~~~l~--~~D----~vliM--tV~PGf--~G  142 (211)
T cd00429          89 EATD-------------HLHRTIQLIKELGMKA--GVALNPG-TPVEVLEPYLD--EVD----LVLVM--SVNPGF--GG  142 (211)
T ss_pred             CCCC-------------CHHHHHHHHHHCCCCC--EEEECCC-CCHHHHHHHHH--HHC----EEEEE--EECCCC--CC
T ss_conf             3220-------------8999999999739872--3575489-99899999997--515----22798--746887--88


Q ss_pred             CCCCCHHHHHHHHHHHHHHCC----CCCCEEEEHHHHHCHHHHHHHHHHCCCEEEECCEEECC
Q ss_conf             568798999999999999686----87214231156516568999998099889977866515
Q gi|254780485|r  247 NKKVDPIEHVRIISVARILMP----KSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTA  305 (328)
Q Consensus       247 ~~~~~~~e~lr~iAi~RL~lP----~~~i~i~~~~~~~~~~~~~~~L~~GaN~~~~g~~~~t~  305 (328)
                      .+  -..+.+.-+.-+|-+.|    +..|.+-+|   +..+.-.....+|||.++.|.++-..
T Consensus       143 Q~--f~~~~~~ki~~l~~~~~~~~~~~~I~vDGG---I~~~~i~~l~~~Gad~~V~GS~iF~~  200 (211)
T cd00429         143 QK--FIPEVLEKIRKLRELIPENNLNLLIEVDGG---INLETIPLLAEAGADVLVAGSALFGS  200 (211)
T ss_pred             CC--CCHHHHHHHHHHHHHHHHCCCCEEEEEECC---CCHHHHHHHHHCCCCEEEECHHHHCC
T ss_conf             75--456799999999999986499859999678---59899999998599999979377589


No 152
>PRK07565 dihydroorotate dehydrogenase 2; Reviewed
Probab=91.51  E-value=1.1  Score=24.18  Aligned_cols=189  Identities=17%  Similarity=0.200  Sum_probs=94.1

Q ss_pred             CHHHHHHHHHHHCCC-CCCEEEECCCCCHHH----HHHHHCCCCCEEEEECCCCHHHHHCCCCCCCHHHHHHHHHHHHHC
Q ss_conf             289999988762136-883241025699999----998741576069751343777732058888989999999999987
Q gi|254780485|r  121 DLSIIVDMIKGVKSL-GLETCMTLGMLSFEQ----AQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKS  195 (328)
Q Consensus       121 ~~~~~~e~i~~i~~~-~~~i~~~~g~~~~~~----~~~Lk~aG~~~~~~~let~~~~~~~~~~~~~~~~~l~~~~~a~~~  195 (328)
                      .++++++.++..++. +..+.+|+.-.+.++    .+++.++|+|.+.+|+-. +..-+........+.-.++++..++.
T Consensus        85 g~e~~l~~i~~~k~~~~~pvIaSi~g~s~ee~~~~a~~~e~~gadaiElNis~-~~~~~~~~~~~~~~~~~~iv~~V~~~  163 (333)
T PRK07565         85 GPEEYLELIRRAKEAVDIPVIASLNGSSAGGWVDYARQIEEAGADALELNIYY-LPTDPDISGAEVEQRYLDILRAVKSA  163 (333)
T ss_pred             CHHHHHHHHHHHHHCCCCCEEEECCCCCHHHHHHHHHHHHHCCCCEEEEECCC-CCCCCCCCCCCHHHHHHHHHHHHHHH
T ss_conf             89999999998775059845987477998999999999976499889997667-79886544465078899999999864


Q ss_pred             -CCCCCCEEEECCCCCHHHHHHHHHHHHHCCCCCCEEE-CCCE----------EECCCCCCCCCCCCCHHHHHHHHHHHH
Q ss_conf             -9855770786689899999999999974088886020-5411----------204874124456879899999999999
Q gi|254780485|r  196 -GIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIP-INLL----------IPIPGSKFEENKKVDPIEHVRIISVAR  263 (328)
Q Consensus       196 -G~~~~sg~l~G~gEt~eeri~~l~~lr~l~~~~~~v~-~~~~----------~p~~gt~l~~~~~~~~~e~lr~iAi~R  263 (328)
                       .+++    ++=+.-...+..+....+.+-+.  +++. +|.+          .+.++..+.. +... --.||+++..+
T Consensus       164 ~~~Pv----~vKLsPn~tdi~~iA~aa~~~Ga--dgv~~iNT~~~~~Id~e~~~~~~~~~lSg-p~~~-~~alr~v~~v~  235 (333)
T PRK07565        164 VSIPV----AVKLSPYFSNLANMAKRLDAAGA--DGLVLFNRFYQPDIDLETLEVVPGLVLST-PAEL-RLPLRWIAILS  235 (333)
T ss_pred             CCCCE----EEECCCCCCHHHHHHHHHHHCCC--CEEEEECCCCCCCCCCCCCEEECCCCCCC-CCCC-CHHHHHHHHHH
T ss_conf             68856----87359982109999999997499--88998436665633155443736866677-4312-07889999996


Q ss_pred             HHCCCCCCEEEE-HHHHHCHHHHHHHHHHCCCEEEECCEEECCCCCC-----HHHHHHHHHHCCCC
Q ss_conf             968687214231-1565165689999980998899778665158889-----89999999982985
Q gi|254780485|r  264 ILMPKSRLRLAA-GRAMMSDELQALCFFSGANSIFVGDTLLTAKNPS-----YNKDTILFNRLGLI  323 (328)
Q Consensus       264 L~lP~~~i~i~~-~~~~~~~~~~~~~L~~GaN~~~~g~~~~t~~g~~-----~~~~~~~i~~~G~~  323 (328)
                      =..+   |+|.+ |=..-+.+. -.-+.+||+.+-+|--+ -..|+.     .+++.+.+++-||.
T Consensus       236 ~~~~---ipIiG~GGI~sg~Da-iE~ilAGAsaVQv~Ta~-~~~G~~v~~~i~~eL~~~m~~~G~~  296 (333)
T PRK07565        236 GRVG---ADLAATTGVHDAEDV-IKMLLAGADVVMIASAL-LRHGPDYIGTILAGLEDWMERHGYE  296 (333)
T ss_pred             CCCC---CCEEEECCCCCHHHH-HHHHHCCCCHHEEEHHH-HHHCCHHHHHHHHHHHHHHHHCCCC
T ss_conf             0469---898888895989999-99998098863362236-6537279999999999999983999


No 153
>PRK12595 bifunctional 3-deoxy-7-phosphoheptulonate synthase/chorismate mutase; Reviewed
Probab=91.42  E-value=1.2  Score=24.12  Aligned_cols=200  Identities=12%  Similarity=0.121  Sum_probs=107.5

Q ss_pred             CCHHHHHHHHHHHHHCCCEEEEEECCCCCCCCCC--H----HHHHHHHHHHC-CCCCCEEEECCCCCHHHHHHHHCCCCC
Q ss_conf             6857999999999964983899730368887442--8----99999887621-368832410256999999987415760
Q gi|254780485|r   88 INVDQVLKEAKNAKENGATRYCMGAAWREPKERD--L----SIIVDMIKGVK-SLGLETCMTLGMLSFEQAQILSKAGLD  160 (328)
Q Consensus        88 ~~~Eei~~~a~~~~~~G~~~~~l~~~~~~~~~~~--~----~~~~e~i~~i~-~~~~~i~~~~g~~~~~~~~~Lk~aG~~  160 (328)
                      -|.|++++.|+..++.|++-+  -+|-..|..++  |    +.=+++++.++ +.++.+...  .++..++....+. +|
T Consensus       129 ES~eQi~~~A~~vk~~G~~~l--RgGa~KPRTsPysFqGlG~eGL~~L~~a~~e~gl~vvTE--V~~~~~ve~~~~y-vD  203 (360)
T PRK12595        129 ESYEQVAAVAQALKAKGLKLL--RGGAFKPRTSPYDFQGLGVEGLKILKQVADEYDLAVISE--IVNPNDVEVALDY-VD  203 (360)
T ss_pred             CCHHHHHHHHHHHHHCCCCEE--ECCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCEEEE--ECCHHHHHHHHHH-CC
T ss_conf             789999999999997597557--255568999997657684579999999999859972798--5788899999974-86


Q ss_pred             EEEEECCCCHHHHHCCCCCCCHHHHHHHHHHHHHCCCCCCCEEEE--CCCCCHHHHHHHHHHHHHCCCCCCEEECC--CE
Q ss_conf             697513437777320588889899999999999879855770786--68989999999999997408888602054--11
Q gi|254780485|r  161 YYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSGIKVCCGGIL--GLGEMIDDRIDMLLTLANLSTPPESIPIN--LL  236 (328)
Q Consensus       161 ~~~~~let~~~~~~~~~~~~~~~~~l~~~~~a~~~G~~~~sg~l~--G~gEt~eeri~~l~~lr~l~~~~~~v~~~--~~  236 (328)
                      .+-++--+          ...    ...++.+.+.+.++    |+  |+.-|.++.+.-..++-.-+- ++-+-+-  +.
T Consensus       204 ilqIGARn----------mqN----f~LLk~vg~~~kPV----LlKrg~~ati~ewl~AaEyi~~~Gn-~~vilceRGir  264 (360)
T PRK12595        204 VIQIGARN----------MQN----FELLKAAGRVNKPV----LLKRGLSATIEEFIYAAEYIMSQGN-DQIILCERGIR  264 (360)
T ss_pred             EEEECCHH----------CCC----HHHHHHHHCCCCCE----EEECCCCCCHHHHHHHHHHHHHCCC-CCEEEEECCCC
T ss_conf             89888410----------359----99999986139937----9607999999999999999986799-87899917756


Q ss_pred             EECCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCC----CEEEEHHHHHCHHHHHHHHHHCCCEEEECCEEE----CCCC-
Q ss_conf             2048741244568798999999999999686872----142311565165689999980998899778665----1588-
Q gi|254780485|r  237 IPIPGSKFEENKKVDPIEHVRIISVARILMPKSR----LRLAAGRAMMSDELQALCFFSGANSIFVGDTLL----TAKN-  307 (328)
Q Consensus       237 ~p~~gt~l~~~~~~~~~e~lr~iAi~RL~lP~~~----i~i~~~~~~~~~~~~~~~L~~GaN~~~~g~~~~----t~~g-  307 (328)
                      +....|      .-+  -.+..+++.+- ++...    +.=++||-.+-..+.+.++.+||||+|++-..-    -+++ 
T Consensus       265 T~e~~t------Rnt--ldl~avp~~k~-~thLPVivDPSH~~G~r~lv~~~a~aa~a~GaDGlmIEvHp~P~~AlSD~~  335 (360)
T PRK12595        265 TYEKAT------RNT--LDISAVPILKQ-ETHLPVMVDVTHSTGRRDLLLPTAKAALAIGADGVMAEVHPDPAVALSDSA  335 (360)
T ss_pred             CCCCCC------CCC--CCHHHHHHHHC-CCCCCEEECCCCCCCCHHHHHHHHHHHHHCCCCEEEEEECCCHHHCCCCCC
T ss_conf             778766------889--88678899864-999998989965215575899999999974999799986688232158710


Q ss_pred             --CCHHHHHHHHHHC
Q ss_conf             --8989999999982
Q gi|254780485|r  308 --PSYNKDTILFNRL  320 (328)
Q Consensus       308 --~~~~~~~~~i~~~  320 (328)
                        -++++..+|++++
T Consensus       336 Qql~~~~f~~l~~~l  350 (360)
T PRK12595        336 QQMDIPEFDRFYDEL  350 (360)
T ss_pred             CCCCHHHHHHHHHHH
T ss_conf             048999999999999


No 154
>KOG2535 consensus
Probab=91.37  E-value=1.2  Score=24.09  Aligned_cols=173  Identities=15%  Similarity=0.140  Sum_probs=92.8

Q ss_pred             CCHHHHHHHHHHHHHCCCE----EEEEECCC-CCCCCCCHHHHHH----HHHHHCCC-----------CCC--EEEEC--
Q ss_conf             6857999999999964983----89973036-8887442899999----88762136-----------883--24102--
Q gi|254780485|r   88 INVDQVLKEAKNAKENGAT----RYCMGAAW-REPKERDLSIIVD----MIKGVKSL-----------GLE--TCMTL--  143 (328)
Q Consensus        88 ~~~Eei~~~a~~~~~~G~~----~~~l~~~~-~~~~~~~~~~~~e----~i~~i~~~-----------~~~--i~~~~--  143 (328)
                      -..++....+++.+..|..    ++.+.+|. ...+..+-++++.    +++.....           ...  +.+.+  
T Consensus       150 dP~~QaR~Rv~QLk~LGHsvDKVE~i~MGGTFMsLPe~YRd~FI~nLHdALSGhts~~v~EAv~yse~s~tKCiGiTIET  229 (554)
T KOG2535         150 DPYLQARGRVEQLKQLGHSVDKVEFIVMGGTFMSLPEEYRDYFIRNLHDALSGHTSANVEEAVKYSERSLTKCIGITIET  229 (554)
T ss_pred             CHHHHHHHHHHHHHHHCCCCCEEEEEEECCEEECCHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHCCCEEEEEEEEC
T ss_conf             98888888999999837764206899845622058088899999988877427875478999874031234035689612


Q ss_pred             --CCCCHHHHHHHHCCCCCEEEEECCC-CHHHHHCCCCCCCHHHHHHHHHHHHHCCCCCCCEEEECCCCC--HHHHHHHH
Q ss_conf             --5699999998741576069751343-777732058888989999999999987985577078668989--99999999
Q gi|254780485|r  144 --GMLSFEQAQILSKAGLDYYNHNIDT-SERFYPHVTTTHTFEDRLQTLENVRKSGIKVCCGGILGLGEM--IDDRIDML  218 (328)
Q Consensus       144 --g~~~~~~~~~Lk~aG~~~~~~~let-~~~~~~~~~~~~~~~~~l~~~~~a~~~G~~~~sg~l~G~gEt--~eeri~~l  218 (328)
                        ..-...++..|-.-|..+..++..+ .++....--.+|+....-++...|+.+|+++.++||=-+..-  ..|.....
T Consensus       230 RPDyC~~~Hl~~ML~YGCTRlEiGVQS~YEDVARDTNRGHTV~aVce~F~laKDaG~KvV~HMMPdLPNVg~eRDieqF~  309 (554)
T KOG2535         230 RPDYCLKRHLSDMLTYGCTRLEIGVQSVYEDVARDTNRGHTVKAVCESFHLAKDAGFKVVAHMMPDLPNVGMERDIEQFK  309 (554)
T ss_pred             CCCCCHHHHHHHHHHCCCCEEEECCHHHHHHHHHCCCCCCCHHHHHHHHHHHHCCCCEEEHHHCCCCCCCCHHHHHHHHH
T ss_conf             77422126699998608713785100357776521668846899987766300368245023278999985041299999


Q ss_pred             HHHHHCCCCCCEEECCCEEECCCCCCCCC------CCCCHHHHHHHHH
Q ss_conf             99974088886020541120487412445------6879899999999
Q gi|254780485|r  219 LTLANLSTPPESIPINLLIPIPGSKFEEN------KKVDPIEHVRIIS  260 (328)
Q Consensus       219 ~~lr~l~~~~~~v~~~~~~p~~gt~l~~~------~~~~~~e~lr~iA  260 (328)
                      .....-...+++.-+-+..-+.||-+...      ..-++.+..-.+|
T Consensus       310 E~FenP~FR~DGLKiYPTLVIrGTGLyELWKtgrYk~Y~p~~LvdlvA  357 (554)
T KOG2535         310 EYFENPAFRPDGLKIYPTLVIRGTGLYELWKTGRYKSYSPSALVDLVA  357 (554)
T ss_pred             HHHCCCCCCCCCCEECCEEEEECCCHHHHHHCCCCCCCCHHHHHHHHH
T ss_conf             983196768787412226999344279887528866689899999999


No 155
>PRK08745 ribulose-phosphate 3-epimerase; Provisional
Probab=91.36  E-value=1.2  Score=24.08  Aligned_cols=195  Identities=13%  Similarity=0.157  Sum_probs=104.4

Q ss_pred             HHHHHHHHHHHHCCCEEEEE-ECCCCCCCCCCH-HHHHHHHHHH-CCCCCCEEEECCCCCHHHHHHHHCCCCCEEEEECC
Q ss_conf             79999999999649838997-303688874428-9999988762-13688324102569999999874157606975134
Q gi|254780485|r   91 DQVLKEAKNAKENGATRYCM-GAAWREPKERDL-SIIVDMIKGV-KSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNID  167 (328)
Q Consensus        91 Eei~~~a~~~~~~G~~~~~l-~~~~~~~~~~~~-~~~~e~i~~i-~~~~~~i~~~~g~~~~~~~~~Lk~aG~~~~~~~le  167 (328)
                      -.+.++++.+.+.|+..+++ +.-|+.-+...+ -..++.+|.. ....+.+|+-+ .-.+..+..+.++|++.+..-.|
T Consensus        16 ~~L~~ei~~l~~~g~d~iHiDImDG~FVpN~t~g~~~i~~ir~~~~~~plDvHLMv-~~P~~~i~~~~~aGad~i~~H~E   94 (223)
T PRK08745         16 ARLGEEVDNVLKAGADWVHFDVMDNHYVPNLTIGPMVCQALRKHGITAPIDVHLMV-EPVDRIVPDFADAGATTISFHPE   94 (223)
T ss_pred             HHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCHHHHHHHHHHCCCCCEEEEEEE-CCHHHHHHHHHHCCCCEEEEEEC
T ss_conf             99999999999769998998276797077557095999999961899753778983-39899999999739978999606


Q ss_pred             CCHHHHHCCCCCCCHHHHHHHHHHHHHCCCCCCCEEEECCCCCHHHHHHHHHHHHHCCCCCCEEECCCEEECCCCCCCCC
Q ss_conf             37777320588889899999999999879855770786689899999999999974088886020541120487412445
Q gi|254780485|r  168 TSERFYPHVTTTHTFEDRLQTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEEN  247 (328)
Q Consensus       168 t~~~~~~~~~~~~~~~~~l~~~~~a~~~G~~~~sg~l~G~gEt~eeri~~l~~lr~l~~~~~~v~~~~~~p~~gt~l~~~  247 (328)
                      +.+.          .   -++++..++.|++.  |+-+... |.-+.++-+  |.++    +.|-+.-.  .||-  .+.
T Consensus        95 a~~~----------~---~~~i~~ik~~g~k~--GlalnP~-T~~~~l~~~--l~~~----D~VliMtV--~PGf--~GQ  148 (223)
T PRK08745         95 ASRH----------V---HRTIQLIKSHGCQA--GLVLNPA-TPVDILDWV--LPEL----DLVLVMSV--NPGF--GGQ  148 (223)
T ss_pred             CCCC----------H---HHHHHHHHHCCCCE--EEEECCC-CCHHHHHHH--HHHC----CEEEEEEE--CCCC--CCC
T ss_conf             4429----------9---99999999839844--6774699-987999998--8647----98999875--6998--875


Q ss_pred             CCCCHHHHHHHHHHHHHHCC----CCCCEEEEHHHHHCHHHHHHHHHHCCCEEEECCEEECCCCCCHHHHHHHHHH
Q ss_conf             68798999999999999686----8721423115651656899999809988997786651588898999999998
Q gi|254780485|r  248 KKVDPIEHVRIISVARILMP----KSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTILFNR  319 (328)
Q Consensus       248 ~~~~~~e~lr~iAi~RL~lP----~~~i~i~~~~~~~~~~~~~~~L~~GaN~~~~g~~~~t~~g~~~~~~~~~i~~  319 (328)
                      +-  -.+.+.-|.-.|-+.+    +..|-+-+   .+..+.-.....+|||.++.|.++-...  .+.+.++-+|+
T Consensus       149 ~f--~~~~l~KI~~l~~~~~~~~~~~~I~VDG---GI~~~ti~~l~~aGad~~V~GSaiF~~~--d~~~~i~~lr~  217 (223)
T PRK08745        149 AF--IPSALDKLRAIRKKIDALGKPIRLEIDG---GVKADNIGAIAAAGADTFVAGSAIFNAP--DYAQVIAQMRA  217 (223)
T ss_pred             CC--CHHHHHHHHHHHHHHHHCCCCCEEEEEC---CCCHHHHHHHHHCCCCEEEECHHHHCCC--CHHHHHHHHHH
T ss_conf             45--6889999999999998649994599978---8798999999986999999741775799--99999999999


No 156
>PRK11613 folP dihydropteroate synthase; Provisional
Probab=91.21  E-value=1.2  Score=23.98  Aligned_cols=136  Identities=18%  Similarity=0.240  Sum_probs=83.2

Q ss_pred             CCHHHHHHHHHHHHHCCCEEEEEECC-CCCC-----CCCCHHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHCCCCCE
Q ss_conf             68579999999999649838997303-6888-----74428999998876213688324102569999999874157606
Q gi|254780485|r   88 INVDQVLKEAKNAKENGATRYCMGAA-WREP-----KERDLSIIVDMIKGVKSLGLETCMTLGMLSFEQAQILSKAGLDY  161 (328)
Q Consensus        88 ~~~Eei~~~a~~~~~~G~~~~~l~~~-~~~~-----~~~~~~~~~e~i~~i~~~~~~i~~~~g~~~~~~~~~Lk~aG~~~  161 (328)
                      .+.++.++.+++..+.|+.-+-+++- .++.     ...+.+.+...++.+++.. .+.+|+.+...+..+.--++|++.
T Consensus        35 ~~~~~a~~~a~~mi~~GAdiIDIGgeSTrPga~~vs~eeE~~Rl~pvi~~i~~~~-~v~iSIDT~~~~Va~~ale~Ga~i  113 (282)
T PRK11613         35 NSLIDAVKHANLMINAGATIIDVGGESTRPGAAEVSVEEELDRVIPVVEAIAQRF-EVWISVDTSKPEVIRESAKAGAHI  113 (282)
T ss_pred             CCHHHHHHHHHHHHHCCCCEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHC-CCEEEEECCCHHHHHHHHHCCCCE
T ss_conf             8999999999999988996999798258998986898999999999999999735-972999799889999999639788


Q ss_pred             EEE--ECCCCHHHHHC-------C---C----CC-----CCHHH-------HH-HHHHHHHHCCCCCCCEEE---ECCCC
Q ss_conf             975--13437777320-------5---8----88-----89899-------99-999999987985577078---66898
Q gi|254780485|r  162 YNH--NIDTSERFYPH-------V---T----TT-----HTFED-------RL-QTLENVRKSGIKVCCGGI---LGLGE  209 (328)
Q Consensus       162 ~~~--~let~~~~~~~-------~---~----~~-----~~~~~-------~l-~~~~~a~~~G~~~~sg~l---~G~gE  209 (328)
                      +|-  .+. .|+.+..       +   |    |+     ..|++       |+ +.++.+.+.|++-.--++   +|.|-
T Consensus       114 INDIsg~~-d~~~~~~va~~~~~~vlmH~~g~p~~m~~~~~y~dvi~~v~~~f~~~i~~~~~~Gi~~~~IilDPGiGFgK  192 (282)
T PRK11613        114 INDIRSLS-EPGALEAAAETGLPVCLMHMQGNPKTMQEAPKYDDVFAEVNRYFIEQIARCEQAGIAKEKLLLDPGFGFGK  192 (282)
T ss_pred             EECCCCCC-CHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCEEEECCCCCCCC
T ss_conf             86632124-86599999972998899806899855332676352799999999999999998799947499806877678


Q ss_pred             CHHHHHHHHHHHHHCC
Q ss_conf             9999999999997408
Q gi|254780485|r  210 MIDDRIDMLLTLANLS  225 (328)
Q Consensus       210 t~eeri~~l~~lr~l~  225 (328)
                      +.++=++.|.+|..+.
T Consensus       193 ~~~~n~~ll~~l~~~~  208 (282)
T PRK11613        193 NLSHNYQLLARLAEFH  208 (282)
T ss_pred             CHHHHHHHHHHHHHHH
T ss_conf             8788999998389985


No 157
>PRK08005 ribulose-phosphate 3-epimerase; Validated
Probab=91.19  E-value=1.2  Score=23.97  Aligned_cols=194  Identities=12%  Similarity=0.075  Sum_probs=109.7

Q ss_pred             HHHHHHHHHHHCCCEEEEE-ECCCCCCCC-CCHHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHCCCCCEEEEECCCC
Q ss_conf             9999999999649838997-303688874-42899999887621368832410256999999987415760697513437
Q gi|254780485|r   92 QVLKEAKNAKENGATRYCM-GAAWREPKE-RDLSIIVDMIKGVKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTS  169 (328)
Q Consensus        92 ei~~~a~~~~~~G~~~~~l-~~~~~~~~~-~~~~~~~e~i~~i~~~~~~i~~~~g~~~~~~~~~Lk~aG~~~~~~~let~  169 (328)
                      .+.++++.+.+.|+..+++ +.-|+--+. ..-...++.+|........+|.-+- -.+..+..+.++|++.+..-.|+.
T Consensus        14 ~L~~ei~~l~~~g~d~lHiDIMDG~FVPNitfg~~~v~~ir~~t~~p~DvHLMv~-~P~~~i~~~~~~g~d~it~H~Ea~   92 (210)
T PRK08005         14 RYAEALTALHDAPLGSLHLDIEDTSFINNITFGMKTIQAVAQYTRHPLSFHLMVS-SPQRWLPWLAAIRPGWIFIHAESV   92 (210)
T ss_pred             HHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCHHHHHHHHHCCCCCEEEEEEEC-CHHHHHHHHHHCCCCEEEEECCCC
T ss_conf             9999999999779998998288898277456298999999861899807999868-889999999972998599935677


Q ss_pred             HHHHHCCCCCCCHHHHHHHHHHHHHCCCCCCCEEEECCCCCHHHHHHHHHHHHHCCCCCCEEECCCEEECCCCCCCCCCC
Q ss_conf             77732058888989999999999987985577078668989999999999997408888602054112048741244568
Q gi|254780485|r  170 ERFYPHVTTTHTFEDRLQTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKK  249 (328)
Q Consensus       170 ~~~~~~~~~~~~~~~~l~~~~~a~~~G~~~~sg~l~G~gEt~eeri~~l~~lr~l~~~~~~v~~~~~~p~~gt~l~~~~~  249 (328)
                      +.          .   .++++..++.|.+.  |+-+-. .|.-+.+..+  +-++    +.|-++--  .||.  .+.+-
T Consensus        93 ~~----------~---~~~i~~Ik~~g~k~--GlAlnP-~T~i~~~~~~--l~~v----D~VLvMtV--~PGf--~GQ~F  146 (210)
T PRK08005         93 QN----------P---SEILADIRAIGAKA--GLALNP-ATPLLPYRYL--ALQL----DALMIMTS--EPDG--RGQQF  146 (210)
T ss_pred             CC----------H---HHHHHHHHHCCCEE--EEEECC-CCCHHHHHHH--HHCC----CEEEEEEE--CCCC--CCCCC
T ss_conf             69----------9---99999999749807--888379-9987998730--4007----98999877--8999--87211


Q ss_pred             CCHHHHHHHHHHHHHHCCCCCCEEEEHHHHHCHHHHHHHHHHCCCEEEECCEEECCCCCCHHHHHHHHHH
Q ss_conf             7989999999999996868721423115651656899999809988997786651588898999999998
Q gi|254780485|r  250 VDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTILFNR  319 (328)
Q Consensus       250 ~~~~e~lr~iAi~RL~lP~~~i~i~~~~~~~~~~~~~~~L~~GaN~~~~g~~~~t~~g~~~~~~~~~i~~  319 (328)
                        -.+.+.-|.-.|-..|+..|.+=+|   +..+.......+|||.++.|.++-.+.  ...+-+.-+|+
T Consensus       147 --i~~~~~KI~~~r~~~~~~~I~vDGG---In~~t~~~~~~aGad~~V~GSaiF~~~--d~~~~i~~lr~  209 (210)
T PRK08005        147 --IAAMCEKVSQSREHFPAAECWADGG---ITLRAARLLAAAGAQHLVIGRALFTTA--NYDVTLSQFTA  209 (210)
T ss_pred             --CHHHHHHHHHHHHHCCCCCEEEECC---CCHHHHHHHHHCCCCEEEECHHHHCCC--CHHHHHHHHHC
T ss_conf             --7889999999996287788899788---788999999986999999790653699--99999999863


No 158
>PRK12331 oxaloacetate decarboxylase; Provisional
Probab=90.76  E-value=1.3  Score=23.71  Aligned_cols=174  Identities=16%  Similarity=0.127  Sum_probs=88.2

Q ss_pred             CHHHHHHHHHHHHHCCCEEEEEECCCCCCCCCCHHHHHHHHHHHCCCCCCEEEECCC-CCHHHHHHHHCCCCCEEEEECC
Q ss_conf             857999999999964983899730368887442899999887621368832410256-9999999874157606975134
Q gi|254780485|r   89 NVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLGLETCMTLGM-LSFEQAQILSKAGLDYYNHNID  167 (328)
Q Consensus        89 ~~Eei~~~a~~~~~~G~~~~~l~~~~~~~~~~~~~~~~e~i~~i~~~~~~i~~~~g~-~~~~~~~~Lk~aG~~~~~~~le  167 (328)
                      +.|-.++.++++.+.|+..+++--..+-..+.....++..+|..-...+++|.|... +....+..-.+||+|.+...+.
T Consensus       152 t~~yyv~~a~~l~~~Gad~I~ikD~aGll~P~~~~eLV~aLk~~~~lpI~~HtH~t~Gla~an~laAieAGaDivD~a~~  231 (463)
T PRK12331        152 TIDYFVKLAKEMQEIGADSICIKDMAGILTPYVAYELVKCIKENVTVPLEVHTHATSGIAEMTYLKAIEAGADIIDTAIS  231 (463)
T ss_pred             CHHHHHHHHHHHHHCCCCEEEEECCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHCCCCEEEECCC
T ss_conf             69999999999996499889986786776889999999999974498569983688757999999999849999962353


Q ss_pred             CCHHHHHCCCCCCCHHHHHHHHHHHHHCCCCCCCEEEECC-CCCHHHHHHHHHHHHHCCC-------CCCEE-ECCCEEE
Q ss_conf             3777732058888989999999999987985577078668-9899999999999974088-------88602-0541120
Q gi|254780485|r  168 TSERFYPHVTTTHTFEDRLQTLENVRKSGIKVCCGGILGL-GEMIDDRIDMLLTLANLST-------PPESI-PINLLIP  238 (328)
Q Consensus       168 t~~~~~~~~~~~~~~~~~l~~~~~a~~~G~~~~sg~l~G~-gEt~eeri~~l~~lr~l~~-------~~~~v-~~~~~~p  238 (328)
                      ..-.    . +.+..  -..+...++..|+.+      |+ -+...+..+++..+|+...       ...++ +-....+
T Consensus       232 ~~s~----g-tsqP~--~~s~v~~l~~~~~~~------~ld~~~l~~i~~y~~~vr~~y~~~~~~~~~~~~~d~~v~~hq  298 (463)
T PRK12331        232 PFAG----G-TSQPA--TESMVIALQDLGYDT------GLDLEELSEIAEYFNPIRDHYREEGILNPKVKDVEPKTLIYQ  298 (463)
T ss_pred             CCCC----C-CCCCC--HHHHHHHHHCCCCCC------CCCHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCHHHEEEC
T ss_conf             5467----9-78987--999999985389999------989999999999999999999874478875766774351236


Q ss_pred             CCCCCCCCC-------CCC-CHHHHHHHHHHHHHHCCCCCCEEEEH
Q ss_conf             487412445-------687-98999999999999686872142311
Q gi|254780485|r  239 IPGSKFEEN-------KKV-DPIEHVRIISVARILMPKSRLRLAAG  276 (328)
Q Consensus       239 ~~gt~l~~~-------~~~-~~~e~lr~iAi~RL~lP~~~i~i~~~  276 (328)
                      .||.-+.+.       ... .-.|.++.++-.|-.+-+. +.++-+
T Consensus       299 ~PGGm~snl~~Ql~~~g~~dr~~eV~~e~~~Vr~~lG~~-~~VTP~  343 (463)
T PRK12331        299 VPGGMLSNLLSQLKEQGLADKYEEVLAEVPKVRADLGYP-PLVTPL  343 (463)
T ss_pred             CCCCHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHCCCC-CEECCH
T ss_conf             873066789999997784767999999999999974999-835928


No 159
>PTZ00170 D-ribulose-5-phosphate 3-epimerase; Provisional
Probab=90.47  E-value=1.4  Score=23.54  Aligned_cols=196  Identities=14%  Similarity=0.167  Sum_probs=105.3

Q ss_pred             HHHHHHHHHHHHCCCEEEEE-ECCCCCCCCCC-HHHHHHHHHH-HCCCCCCEEEECCCCCHHHHHHHHCCCCCEEEEECC
Q ss_conf             79999999999649838997-30368887442-8999998876-213688324102569999999874157606975134
Q gi|254780485|r   91 DQVLKEAKNAKENGATRYCM-GAAWREPKERD-LSIIVDMIKG-VKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNID  167 (328)
Q Consensus        91 Eei~~~a~~~~~~G~~~~~l-~~~~~~~~~~~-~~~~~e~i~~-i~~~~~~i~~~~g~~~~~~~~~Lk~aG~~~~~~~le  167 (328)
                      ++-++++++....|+..+++ +.-|+.-+... -...++.+|. .+.....+|+-+-. .+..+..+.++|++.+..-.|
T Consensus        17 ~~ei~~~~~~~~~g~d~lHiDImDG~FVpN~t~g~~~v~~ir~~~~~~~lDvHLMv~~-P~~~i~~~~~~gad~I~~H~E   95 (224)
T PTZ00170         17 LDESQDVLSPEGGGADWLHVDVMDGHFVPNLSFGPPVVSSLRKHLPNTFLDVHLMVSD-PERWVDSFAKAGASQFTFHIE   95 (224)
T ss_pred             HHHHHHHHHHHCCCCCEEEEECCCCCCCCCCCCCHHHHHHHHHHCCCCCEEEEEEECC-HHHHHHHHHHCCCCEEEECCC
T ss_conf             9999999863405997899944058507765749789999997179986468998638-888799998628967998500


Q ss_pred             CCHHHHHCCCCCCCHHHHHHHHHHHHHCCCCCCCEEEECCCCCHHHHHHHHHHHHHCCCCCCEEECCCEEECCCCCCCCC
Q ss_conf             37777320588889899999999999879855770786689899999999999974088886020541120487412445
Q gi|254780485|r  168 TSERFYPHVTTTHTFEDRLQTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEEN  247 (328)
Q Consensus       168 t~~~~~~~~~~~~~~~~~l~~~~~a~~~G~~~~sg~l~G~gEt~eeri~~l~~lr~l~~~~~~v~~~~~~p~~gt~l~~~  247 (328)
                      +...             -.++++..++.|++.+  +-+- ..|.-+.++.+.  .+.  ..+.|-++-.  .||  +.+.
T Consensus        96 ~~~~-------------~~~~i~~ik~~g~k~G--lAln-P~T~i~~l~~~l--~~~--~iD~VLlMsV--~PG--f~GQ  151 (224)
T PTZ00170         96 ATED-------------PKAVARKIRAAGMQVG--VALK-PKTPAEELFPLI--DAG--LVDMVLVMTV--EPG--FGGQ  151 (224)
T ss_pred             CCCC-------------HHHHHHHHHHHCCCEE--EEEC-CCCCHHHHHHHH--HHC--CCCEEEEEEE--CCC--CCCC
T ss_conf             1339-------------9999999997147645--5607-999879999997--114--4578999855--699--8762


Q ss_pred             CCCCHHHHHHHHHHHHHHCCCCCCEEEEHHHHHCHHHHHHHHHHCCCEEEECCEEECCCCCCHHHHHHHHH
Q ss_conf             68798999999999999686872142311565165689999980998899778665158889899999999
Q gi|254780485|r  248 KKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTILFN  318 (328)
Q Consensus       248 ~~~~~~e~lr~iAi~RL~lP~~~i~i~~~~~~~~~~~~~~~L~~GaN~~~~g~~~~t~~g~~~~~~~~~i~  318 (328)
                      +-  ..+.+.-+.-.|-..|+..|.+-+|   +..+.......+|||.++.|.++-.+..  +.+-++-+|
T Consensus       152 ~F--i~~~l~KI~~lr~~~~~~~I~VDGG---In~~ti~~l~~aGad~~V~GSaiF~~~d--~~~~i~~lr  215 (224)
T PTZ00170        152 SF--MHDMMPKVRQLRQRYPHLNIQVDGG---INPDTIDLAAEAGANVIVAGTSIFKAND--RKESIETLR  215 (224)
T ss_pred             CC--CHHHHHHHHHHHHCCCCCEEEEECC---CCHHHHHHHHHCCCCEEEECHHHHCCCC--HHHHHHHHH
T ss_conf             14--5889999999985489975999589---9989999999869999997858867999--999999999


No 160
>TIGR00559 pdxJ pyridoxal phosphate biosynthetic protein PdxJ; InterPro: IPR004569    Pyridoxal phosphate is the active form of vitamin B6 (pyridoxine or pyridoxal). PLP is a versatile catalyst, acting as a coenzyme in a multitude of reactions, including decarboxylation, deamination and transamination , , . PLP-dependent enzymes are primarily involved in the biosynthesis of amino acids and amino acid-derived metabolites, but they are also found in the biosynthetic pathways of amino sugars and in the synthesis or catabolism of neurotransmitters; pyridoxal phosphate can also inhibit DNA polymerases and several steroid receptors . Inadequate levels of pyridoxal phosphate in the brain can cause neurological dysfunction, particularly epilepsy .   PLP enzymes exist in their resting state as a Schiff base, the aldehyde group of PLP forming a linkage with the epsilon-amino group of an active site lysine residue on the enzyme. The alpha-amino group of the substrate displaces the lysine epsilon-amino group, in the process forming a new aldimine with the substrate. This aldimine is the common central intermediate for all PLP-catalyzed reactions, enzymatic and non-enzymatic .   In Escherichia coli, the pdx genes involved in vitamin B6 have been characterised , , . This entry represents PdxJ, which catalyses the condensation of 1-amino-3-oxo-4-(phosphohydroxy)propan-2-one and 1-deoxy-D-xylulose-5-phosphate to form pyridoxine-5'-phosphate. The product of the PdxJ reaction is then oxidized by PdxH to pyridoxal 5'-phosphate.; GO: 0008615 pyridoxine biosynthetic process, 0005737 cytoplasm.
Probab=90.20  E-value=1.5  Score=23.39  Aligned_cols=137  Identities=15%  Similarity=0.172  Sum_probs=85.8

Q ss_pred             CCHHHHHHHHHHHHHCCCEEEEEE--------CCCCCCCCCCHHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHCCCC
Q ss_conf             685799999999996498389973--------036888744289999988762136883241025699999998741576
Q gi|254780485|r   88 INVDQVLKEAKNAKENGATRYCMG--------AAWREPKERDLSIIVDMIKGVKSLGLETCMTLGMLSFEQAQILSKAGL  159 (328)
Q Consensus        88 ~~~Eei~~~a~~~~~~G~~~~~l~--------~~~~~~~~~~~~~~~e~i~~i~~~~~~i~~~~g~~~~~~~~~Lk~aG~  159 (328)
                      ...||+.+.+.+.+... ..++||        +-++-+..+.-+.+.+.++.+++.|+.+++=+ ...++++.-=.+.|+
T Consensus        71 ~~~ee~~~~~~~~knkP-~~vTlVPe~r~evTtegGLDva~~~dkL~~~~~~~~~~GI~vSlFI-d~~~d~i~~A~e~g~  148 (265)
T TIGR00559        71 APTEEMIEIAVEIKNKP-EKVTLVPEKRDEVTTEGGLDVARLKDKLKELVKRLHEAGIEVSLFI-DADKDQISAAAEVGA  148 (265)
T ss_pred             CCHHHHHHHHHHHCCCC-CEEEECCCCCCEEECCCCCCHHHHHHHHHHHHHHHHHCCCEEEEEE-CCCHHHHHHHHHCCC
T ss_conf             85189999999855899-7387416988603026440001104679999999986798587742-544688899997089


Q ss_pred             CEEEEECCCCHHHHHC-------------CCCCCCHHH-----------HHHHHHHHHHCCCCCCCEEEECCCCCHH---
Q ss_conf             0697513437777320-------------588889899-----------9999999998798557707866898999---
Q gi|254780485|r  160 DYYNHNIDTSERFYPH-------------VTTTHTFED-----------RLQTLENVRKSGIKVCCGGILGLGEMID---  212 (328)
Q Consensus       160 ~~~~~~let~~~~~~~-------------~~~~~~~~~-----------~l~~~~~a~~~G~~~~sg~l~G~gEt~e---  212 (328)
                      +.+.+.=+.+..+|.+             +...+|+++           ..+.-..|+.+|+++    --|||=|+.   
T Consensus       149 ~~iE~hTg~YA~~~~~~~~nannqihaisvlkdksP~e~~~el~~aflq~~~as~~A~~~GL~v----~AGHgL~y~Nvk  224 (265)
T TIGR00559       149 DRIEIHTGVYANLYNKLYSNANNQIHAISVLKDKSPKELKEELQRAFLQIKKASVYAKSLGLKV----NAGHGLNYHNVK  224 (265)
T ss_pred             CEEEEECCHHHHHHHHHHHHHCCCEEEEEEECCCCHHHHHHHHHHHHHHHHHHHHHHHHCCCEE----EECCCCCHHHHH
T ss_conf             8488502246898887741001321223111158868999999899999999999998749868----614888778999


Q ss_pred             HHHHHHH-HHHHCCCCCCEE
Q ss_conf             9999999-997408888602
Q gi|254780485|r  213 DRIDMLL-TLANLSTPPESI  231 (328)
Q Consensus       213 eri~~l~-~lr~l~~~~~~v  231 (328)
                      +.++-+. .|++|.. .|++
T Consensus       225 ~~~~~l~GYl~ElnI-GHa~  243 (265)
T TIGR00559       225 EFAKILEGYLDELNI-GHAI  243 (265)
T ss_pred             HHHHCCCCHHHHHHH-HHHH
T ss_conf             998617401102411-3899


No 161
>COG0854 PdxJ Pyridoxal phosphate biosynthesis protein [Coenzyme metabolism]
Probab=90.08  E-value=1.5  Score=23.33  Aligned_cols=111  Identities=15%  Similarity=0.180  Sum_probs=68.2

Q ss_pred             CHHHHHHHHHHHHHCCCEEEEEE-------CC-CCCCCCCCHHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHCCCCC
Q ss_conf             85799999999996498389973-------03-68887442899999887621368832410256999999987415760
Q gi|254780485|r   89 NVDQVLKEAKNAKENGATRYCMG-------AA-WREPKERDLSIIVDMIKGVKSLGLETCMTLGMLSFEQAQILSKAGLD  160 (328)
Q Consensus        89 ~~Eei~~~a~~~~~~G~~~~~l~-------~~-~~~~~~~~~~~~~e~i~~i~~~~~~i~~~~g~~~~~~~~~Lk~aG~~  160 (328)
                      ..||++..+...   .-..+|+|       ++ +.-+.....+++.+.++.++..++.++.-+ ..+.+++..-++.|++
T Consensus        72 ~teEml~ia~~~---kP~~vtLVPe~r~evTTegGlD~~~~~~~l~~~v~~L~~~GirVSLFi-D~d~~qi~aa~~~gA~  147 (243)
T COG0854          72 PTEEMLAIALKT---KPHQVTLVPEKREEVTTEGGLDVAGQLDKLRDAVRRLKNAGIRVSLFI-DPDPEQIEAAAEVGAP  147 (243)
T ss_pred             CHHHHHHHHHHC---CCCEEEECCCCHHHCCCCCCHHHHHHHHHHHHHHHHHHHCCCEEEEEE-CCCHHHHHHHHHHCCC
T ss_conf             448999999855---987478578964641455563355002469999999985797699972-7998999999984998


Q ss_pred             EEEEECCCCHHHHHCCCCCCCHH------HHH-HHHHHHHHCCCCCCCEEEECCCCCH
Q ss_conf             69751343777732058888989------999-9999999879855770786689899
Q gi|254780485|r  161 YYNHNIDTSERFYPHVTTTHTFE------DRL-QTLENVRKSGIKVCCGGILGLGEMI  211 (328)
Q Consensus       161 ~~~~~let~~~~~~~~~~~~~~~------~~l-~~~~~a~~~G~~~~sg~l~G~gEt~  211 (328)
                      .+.+.-    ..|...+.....+      +++ .+.+.|+++|+.+++    |||=|.
T Consensus       148 ~IELhT----G~Ya~~~~~~~~~~~~~el~rl~~~a~~A~~lGL~VnA----GHgLty  197 (243)
T COG0854         148 RIELHT----GPYADAHDAAEQARADAELERLAKAAKLAAELGLKVNA----GHGLTY  197 (243)
T ss_pred             EEEEEC----CCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHCCCEEEC----CCCCCC
T ss_conf             799843----66566478677887999999999999999973945745----888650


No 162
>PRK07455 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional
Probab=89.99  E-value=1.5  Score=23.28  Aligned_cols=182  Identities=12%  Similarity=0.139  Sum_probs=112.3

Q ss_pred             CCCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCCCCHHHHHHHHHHHCCCCCCEEEECCC-CCHHHHHHHHCCCCCEEE
Q ss_conf             0006857999999999964983899730368887442899999887621368832410256-999999987415760697
Q gi|254780485|r   85 SKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLGLETCMTLGM-LSFEQAQILSKAGLDYYN  163 (328)
Q Consensus        85 ~~~~~~Eei~~~a~~~~~~G~~~~~l~~~~~~~~~~~~~~~~e~i~~i~~~~~~i~~~~g~-~~~~~~~~Lk~aG~~~~~  163 (328)
                      .+..+.|+.+..++.+.+.|++-+-+...  .+.      -.+.|+.+++..+.+.+-+|. ++.++++...++|++.+.
T Consensus        19 lr~~~~~~a~~~~~al~~gGi~~iEiTl~--t~~------a~~~I~~l~~~~p~~~iGaGTV~~~e~~~~a~~aGA~FiV   90 (210)
T PRK07455         19 IRAPDLELGLQMAEAVAAGGMRLIEITWN--SDQ------PAELISQLREKLPECIIGTGTLLTLEDLEEAIAAGAQFCF   90 (210)
T ss_pred             EECCCHHHHHHHHHHHHHCCCCEEEEECC--CCC------HHHHHHHHHHHCCCCEEEEEECCCHHHHHHHHHCCCCEEE
T ss_conf             97599999999999999879988999689--988------9999999998789968988818789999999986999998


Q ss_pred             EECCCCHHHHHCCCCCCCHHHHHHHHHHHHHCCCCCCCEEEECCCCCHHHHHHHHHHHHHCCCCCCEEECCCEEECCCCC
Q ss_conf             51343777732058888989999999999987985577078668989999999999997408888602054112048741
Q gi|254780485|r  164 HNIDTSERFYPHVTTTHTFEDRLQTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSK  243 (328)
Q Consensus       164 ~~let~~~~~~~~~~~~~~~~~l~~~~~a~~~G~~~~sg~l~G~gEt~eeri~~l~~lr~l~~~~~~v~~~~~~p~~gt~  243 (328)
                           +|.        .+    .++++.+++.|++.-.|.+     |+-|...-+    +++.  ..+-   ++|..  .
T Consensus        91 -----SP~--------~~----~~vi~~a~~~~i~~iPGv~-----TpsEi~~A~----~~G~--~~vK---lFPA~--~  137 (210)
T PRK07455         91 -----TPH--------VD----LELIQAAVAADIPIIPGAL-----TPTEIVTAW----QAGA--SCVK---VFPVQ--A  137 (210)
T ss_pred             -----CCC--------CC----HHHHHHHHHCCCCEECCCC-----CHHHHHHHH----HCCC--CEEE---ECCCH--H
T ss_conf             -----688--------88----9999999982997658869-----999999999----8699--8477---50513--2


Q ss_pred             CCCCCCCCHHHHHHHHHHHHHHCCCCCCEEEEHHHHHCHHHHHHHHHHCCCEEEECCEEECCC---CCCHHHHHHHHHH
Q ss_conf             244568798999999999999686872142311565165689999980998899778665158---8898999999998
Q gi|254780485|r  244 FEENKKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAK---NPSYNKDTILFNR  319 (328)
Q Consensus       244 l~~~~~~~~~e~lr~iAi~RL~lP~~~i~i~~~~~~~~~~~~~~~L~~GaN~~~~g~~~~t~~---g~~~~~~~~~i~~  319 (328)
                            ...-.|+|-   .|=-+|+..+.-++|   +..+....-|.+|+...-.|..+....   ....+++.+..++
T Consensus       138 ------~GG~~ylka---l~~p~p~i~~~ptGG---V~~~n~~~yl~ag~~~vg~Gs~l~~~~~i~~~d~~~I~~~A~~  204 (210)
T PRK07455        138 ------VGGADYIKS---LQGPLGHIPLIPTGG---VTLENAQAFIQAGAIAVGLSSQLFPKTLLAAQNWPAITQRAEL  204 (210)
T ss_pred             ------CCCHHHHHH---HHCCCCCCCEEECCC---CCHHHHHHHHHCCCEEEEECHHHCCHHHHHCCCHHHHHHHHHH
T ss_conf             ------067999999---865489993887899---8988899999689979998846189888861899999999999


No 163
>PRK12330 oxaloacetate decarboxylase; Provisional
Probab=89.95  E-value=1.5  Score=23.26  Aligned_cols=165  Identities=14%  Similarity=0.115  Sum_probs=75.0

Q ss_pred             CHHHHHHHHHHHHHCCCEEEEEECCCCCCCCCCHHHHHHHHHHHCCC---CCCEEEECCC---CCHHHHHHHHCCCCCEE
Q ss_conf             85799999999996498389973036888744289999988762136---8832410256---99999998741576069
Q gi|254780485|r   89 NVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSL---GLETCMTLGM---LSFEQAQILSKAGLDYY  162 (328)
Q Consensus        89 ~~Eei~~~a~~~~~~G~~~~~l~~~~~~~~~~~~~~~~e~i~~i~~~---~~~i~~~~g~---~~~~~~~~Lk~aG~~~~  162 (328)
                      +.|.-++.|+++.+.|+..+||--...-..   .....++++.+|+.   ++.|+++...   +....|.+-.+||+|.+
T Consensus       153 t~~yy~~~ak~l~~~G~d~i~IKDmAGll~---P~~a~~LV~~lk~~~g~d~pI~~HtH~T~G~~~~~~l~AieAGvDiv  229 (499)
T PRK12330        153 TTEGFVEQAKRLLDMGCDSICIKDMAALLK---PQPAYDLVKGIKEACGPDTRVHVHAHATTGVTLVSLMKAIEAGVDVV  229 (499)
T ss_pred             CHHHHHHHHHHHHHCCCCEEEEECCCCCCC---HHHHHHHHHHHHHHCCCCCCEEEECCCCCCHHHHHHHHHHHCCCCEE
T ss_conf             899999999999975999899847534678---89999999999986389983798517887469999999998499887


Q ss_pred             EEECCCCHHHHHCCCCCCCHHHHHHHHHHHHHCCCCCCCEEEECCCCCHHHHHHHHHHHHHCCCC----CCEE-ECCCEE
Q ss_conf             75134377773205888898999999999998798557707866898999999999999740888----8602-054112
Q gi|254780485|r  163 NHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTP----PESI-PINLLI  237 (328)
Q Consensus       163 ~~~let~~~~~~~~~~~~~~~~~l~~~~~a~~~G~~~~sg~l~G~gEt~eeri~~l~~lr~l~~~----~~~v-~~~~~~  237 (328)
                      -..+...    .. .+.+..-  .-+...++..|+.++--     .+-.++..+++..+|.....    ..++ +-....
T Consensus       230 D~A~~~~----s~-gtsqp~~--~s~va~L~~t~~d~~ld-----~~~l~~i~~y~~~vr~~Y~~fe~~~~~~d~~v~~~  297 (499)
T PRK12330        230 DTAISSM----SL-GPGHNPT--ESLVEMLEGTGYTTKLD-----MDRLLKIKDHFAKVRPRYKEFLSKITGVETEIFKS  297 (499)
T ss_pred             CCCCCCC----CC-CCCCCCH--HHHHHHHHCCCCCCCCC-----HHHHHHHHHHHHHHHHHHHHCCCCCCCCCHHHHCC
T ss_conf             2445432----37-9889979--99999985789889979-----99999999999999999975046676788635038


Q ss_pred             ECCCCCCCC-------CCCCC-HHHHHHHHHHHHHHCCC
Q ss_conf             048741244-------56879-89999999999996868
Q gi|254780485|r  238 PIPGSKFEE-------NKKVD-PIEHVRIISVARILMPK  268 (328)
Q Consensus       238 p~~gt~l~~-------~~~~~-~~e~lr~iAi~RL~lP~  268 (328)
                      +.||.-+.+       ..... -+|.++-++--|-.|-+
T Consensus       298 q~PGGm~sNl~~Ql~~~g~~dr~~eVl~e~~~Vr~~lG~  336 (499)
T PRK12330        298 QIPGGMLSNMESQLKQQGAGDRMKEVLEEVPRVRKDAGY  336 (499)
T ss_pred             CCCHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHCCC
T ss_conf             895668999999999778476799999999999996699


No 164
>PRK02083 imidazole glycerol phosphate synthase subunit HisF; Provisional
Probab=89.91  E-value=1.6  Score=23.24  Aligned_cols=202  Identities=14%  Similarity=0.159  Sum_probs=111.5

Q ss_pred             HHHHHHHHHHHCCCEEEEEECCCCCCCCCCHHHHHHHHHHH-CCCCCCEEEECCCCCHHHHHHHHCCCCCEEEEECCC--
Q ss_conf             99999999996498389973036888744289999988762-136883241025699999998741576069751343--
Q gi|254780485|r   92 QVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGV-KSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDT--  168 (328)
Q Consensus        92 ei~~~a~~~~~~G~~~~~l~~~~~~~~~~~~~~~~e~i~~i-~~~~~~i~~~~g~~~~~~~~~Lk~aG~~~~~~~let--  168 (328)
                      ..++.|+...+.|+.+++++--......+  ..-.+.++.+ ++.++.+++.-|..+.++.+++-++|++.+.++=-.  
T Consensus        31 dP~~~a~~~~~~gadel~ivDld~s~~~~--~~~~~~I~~i~~~~~~pi~vGGGIrs~e~~~~ll~~GadkVvigs~a~~  108 (253)
T PRK02083         31 DPVELAKRYDEEGADELVFLDITASSEGR--DTMKDVVERVAEQVFIPLTVGGGIRSVEDARRLLRAGADKVSINSAAVA  108 (253)
T ss_pred             CHHHHHHHHHHCCCCEEEEEECCCCCCCC--HHHHHHHHHHHHHCCCCEEEECCCCCHHHHHHHHHCCCCEEEECCHHHH
T ss_conf             99999999998799989999562664577--4179999999986398778517621389876898779878999984653


Q ss_pred             CHHHHHCCCCCCCHHHHHHHHHHHHHCCCC-CCCE------------EEECC---CCCHHHHHHHHHHHHHCCCCCCEEE
Q ss_conf             777732058888989999999999987985-5770------------78668---9899999999999974088886020
Q gi|254780485|r  169 SERFYPHVTTTHTFEDRLQTLENVRKSGIK-VCCG------------GILGL---GEMIDDRIDMLLTLANLSTPPESIP  232 (328)
Q Consensus       169 ~~~~~~~~~~~~~~~~~l~~~~~a~~~G~~-~~sg------------~l~G~---gEt~eeri~~l~~lr~l~~~~~~v~  232 (328)
                      .|.+..               +.++..|=+ +...            .++=+   -.|..+..+++..+.+++.  ..+-
T Consensus       109 ~p~~i~---------------~~~~~~G~q~Iv~siD~~~~~~~~~~~v~~~~~~~~~~~~~~~~i~~~~~~g~--geil  171 (253)
T PRK02083        109 DPELIT---------------ELADRFGSQCIVVAIDAKRDGEPGRWEVFTHGGRKPTGIDAVEWAKEVQELGA--GEIL  171 (253)
T ss_pred             CCCHHH---------------HHHHHCCCEEEEEEEEEEECCCCCEEEEEECCCCCCCCCCHHHHHHHHHHCCC--CEEE
T ss_conf             853557---------------88974698359999998873768718999807841255239999999875698--7899


Q ss_pred             CCCEEECCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCEEEEHHHHHCHHHHHHHHHHCCCEEEECCEEECCCCCCHHH
Q ss_conf             54112048741244568798999999999999686872142311565165689999980998899778665158889899
Q gi|254780485|r  233 INLLIPIPGSKFEENKKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNK  312 (328)
Q Consensus       233 ~~~~~p~~gt~l~~~~~~~~~e~lr~iAi~RL~lP~~~i~i~~~~~~~~~~~~~~~L~~GaN~~~~g~~~~t~~g~~~~~  312 (328)
                      + .-+-..|| +.+   + ..+.++-++  . .. +..+.+++|-- -..++.+..-..|++++.+|.-+ --+..++.+
T Consensus       172 ~-tdI~rDG~-~~G---~-d~~l~~~i~--~-~~-~iPiI~sGGv~-s~~di~~~l~~~~i~gv~~G~~~-~~~~~sl~~  239 (253)
T PRK02083        172 L-TSMDQDGT-KNG---Y-DLELTRAVR--D-AV-SVPVIASGGAG-NLEHFAEAFTEGGADAALAASVF-HFGEITIGE  239 (253)
T ss_pred             E-EEECCCCC-CCC---C-CHHHHHHHH--H-HC-CCCEEEECCCC-CHHHHHHHHHHCCCEEEEEHHHH-HCCCCCHHH
T ss_conf             9-98855586-678---8-999999999--7-57-99999988999-99999999986798099871277-769999999


Q ss_pred             HHHHHHHCCCCC
Q ss_conf             999999829853
Q gi|254780485|r  313 DTILFNRLGLIP  324 (328)
Q Consensus       313 ~~~~i~~~G~~P  324 (328)
                      ..+.+.+.|+.-
T Consensus       240 ~k~~L~~~~i~v  251 (253)
T PRK02083        240 LKAYLAEQGIEV  251 (253)
T ss_pred             HHHHHHHCCCCC
T ss_conf             999999878961


No 165
>COG0800 Eda 2-keto-3-deoxy-6-phosphogluconate aldolase [Carbohydrate transport and metabolism]
Probab=89.64  E-value=1.6  Score=23.10  Aligned_cols=105  Identities=21%  Similarity=0.191  Sum_probs=75.7

Q ss_pred             CCCCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCCCCHHHHHHHHHHHCCCCCCEEEECCC-CCHHHHHHHHCCCCCEE
Q ss_conf             10006857999999999964983899730368887442899999887621368832410256-99999998741576069
Q gi|254780485|r   84 ASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLGLETCMTLGM-LSFEQAQILSKAGLDYY  162 (328)
Q Consensus        84 ~~~~~~~Eei~~~a~~~~~~G~~~~~l~~~~~~~~~~~~~~~~e~i~~i~~~~~~i~~~~g~-~~~~~~~~Lk~aG~~~~  162 (328)
                      .-+..+.|+.+..++...+.|++-+-+..  +.|.      -.+.|+.+++..+++.+-+|+ ++.+++....++|.+-+
T Consensus        18 Vlr~~~~e~a~~~a~Ali~gGi~~IEITl--~sp~------a~e~I~~l~~~~p~~lIGAGTVL~~~q~~~a~~aGa~fi   89 (211)
T COG0800          18 VIRGDDVEEALPLAKALIEGGIPAIEITL--RTPA------ALEAIRALAKEFPEALIGAGTVLNPEQARQAIAAGAQFI   89 (211)
T ss_pred             EEEECCHHHHHHHHHHHHHCCCCEEEEEC--CCCC------HHHHHHHHHHHCCCCEECCCCCCCHHHHHHHHHCCCCEE
T ss_conf             99708999999999999976987699964--7987------899999999867465882455669999999998599789


Q ss_pred             EEECCCCHHHHHCCCCCCCHHHHHHHHHHHHHCCCCCCCEEEECCCCCHHHHHHHH
Q ss_conf             75134377773205888898999999999998798557707866898999999999
Q gi|254780485|r  163 NHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSGIKVCCGGILGLGEMIDDRIDML  218 (328)
Q Consensus       163 ~~~let~~~~~~~~~~~~~~~~~l~~~~~a~~~G~~~~sg~l~G~gEt~eeri~~l  218 (328)
                      -     +|.        .+    -++++.+++.|+++.-|.+     |.-|...-+
T Consensus        90 V-----sP~--------~~----~ev~~~a~~~~ip~~PG~~-----TptEi~~Al  123 (211)
T COG0800          90 V-----SPG--------LN----PEVAKAANRYGIPYIPGVA-----TPTEIMAAL  123 (211)
T ss_pred             E-----CCC--------CC----HHHHHHHHHCCCCCCCCCC-----CHHHHHHHH
T ss_conf             8-----999--------99----9999999867996368879-----989999999


No 166
>cd00331 IGPS Indole-3-glycerol phosphate synthase (IGPS); an enzyme in the tryptophan biosynthetic pathway, catalyzing the ring closure reaction of 1-(o-carboxyphenylamino)-1-deoxyribulose-5-phosphate (CdRP) to indole-3-glycerol phosphate (IGP), accompanied by the release of carbon dioxide and water. IGPS is active as a separate monomer in most organisms, but is also found fused to other enzymes as part of a bifunctional or multifunctional enzyme involved in tryptophan biosynthesis.
Probab=88.89  E-value=1.8  Score=22.75  Aligned_cols=179  Identities=17%  Similarity=0.147  Sum_probs=105.6

Q ss_pred             HHHHHHHHHHHHCCCEEEEEECCCCCCCCCCHHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHCCCCCEEEEECCCCH
Q ss_conf             79999999999649838997303688874428999998876213688324102569999999874157606975134377
Q gi|254780485|r   91 DQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSE  170 (328)
Q Consensus        91 Eei~~~a~~~~~~G~~~~~l~~~~~~~~~~~~~~~~e~i~~i~~~~~~i~~~~g~~~~~~~~~Lk~aG~~~~~~~let~~  170 (328)
                      -...+.|+...+.|+.-+.+.+- ...+...++++..+-+.   ..+.+...-+..++.+...-+.+|+|.+.+-...  
T Consensus        31 ~d~~~~A~~Y~~~GA~aiSVLTe-~~~F~Gs~~~L~~v~~~---~~~PiLrKDFIid~~QI~ea~~~GAdaiLLI~~~--  104 (217)
T cd00331          31 FDPVEIAKAYEKAGAAAISVLTE-PKYFQGSLEDLRAVREA---VSLPVLRKDFIIDPYQIYEARAAGADAVLLIVAA--  104 (217)
T ss_pred             CCHHHHHHHHHHCCCCEEEEECC-CCCCCCCHHHHHHHHHH---CCCCEEECCCCCCHHHHHHHHHCCCCCHHHHHHH--
T ss_conf             99999999999779818999557-77779889999999984---7998674232176999999998199878798885--


Q ss_pred             HHHHCCCCCCCHHHHHHHHHHHHHCCCCCCCEEEECCCCCHHHHHHHHHHHHHCCCCCCEEECCCEEECCCCCCCCCCCC
Q ss_conf             77320588889899999999999879855770786689899999999999974088886020541120487412445687
Q gi|254780485|r  171 RFYPHVTTTHTFEDRLQTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKV  250 (328)
Q Consensus       171 ~~~~~~~~~~~~~~~l~~~~~a~~~G~~~~sg~l~G~gEt~eeri~~l~~lr~l~~~~~~v~~~~~~p~~gt~l~~~~~~  250 (328)
                               -+.++--+.++.|+++|+.+    ++-. .+.+|    +.+..+++.  ..+.+|...      +.. -..
T Consensus       105 ---------L~~~~l~~l~~~a~~lgl~~----LvEv-h~~~E----l~~a~~~~a--~iIGINnRd------L~t-~~v  157 (217)
T cd00331         105 ---------LDDEQLKELYELARELGMEV----LVEV-HDEEE----LERALALGA--KIIGINNRD------LKT-FEV  157 (217)
T ss_pred             ---------CCHHHHHHHHHHHHHHCCEE----EEEE-CCHHH----HHHHHHCCC--CEEEECCCC------CHH-CEE
T ss_conf             ---------49999999999999949827----9885-89999----999995799--878421677------123-034


Q ss_pred             CHHHHHHHHHHHHHHCCCCCCEEEEHHHHHCHHHHHHHHHHCCCEEEECCEEECCCC
Q ss_conf             989999999999996868721423115651656899999809988997786651588
Q gi|254780485|r  251 DPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKN  307 (328)
Q Consensus       251 ~~~e~lr~iAi~RL~lP~~~i~i~~~~~~~~~~~~~~~L~~GaN~~~~g~~~~t~~g  307 (328)
                      +.   -++..++.. +|.-.+.|+-|=.+-..+. ......|+|+.++|+.++++..
T Consensus       158 d~---~~~~~L~~~-ip~~~~~IsESGI~~~~di-~~l~~~G~d~~LIG~sLm~~~~  209 (217)
T cd00331         158 DL---NTTERLAPL-IPKDVILVSESGISTPEDV-KRLAEAGADAVLIGESLMRAPD  209 (217)
T ss_pred             CH---HHHHHHHHH-CCCCCEEEECCCCCCHHHH-HHHHHCCCCEEEECHHHHCCCC
T ss_conf             78---999999964-8989889982799999999-9999879999998978867999


No 167
>pfam00218 IGPS Indole-3-glycerol phosphate synthase.
Probab=88.86  E-value=1.9  Score=22.74  Aligned_cols=178  Identities=17%  Similarity=0.124  Sum_probs=102.9

Q ss_pred             HHHHHHHHHHHCCCEEEEEECCCCCCCCCCHHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHCCCCCEEEEECCCCHH
Q ss_conf             99999999996498389973036888744289999988762136883241025699999998741576069751343777
Q gi|254780485|r   92 QVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSER  171 (328)
Q Consensus        92 ei~~~a~~~~~~G~~~~~l~~~~~~~~~~~~~~~~e~i~~i~~~~~~i~~~~g~~~~~~~~~Lk~aG~~~~~~~let~~~  171 (328)
                      ...+.|+...+.|+.-+.+.+- ...+....+++.. +|..  ..+.+...-+..++.+...-+.+|+|.+.+-...   
T Consensus        69 dp~~iA~~Y~~~GA~aiSVLTd-~~~F~Gs~~~L~~-vr~~--v~lPiLrKDFIid~yQI~ear~~GADaiLLI~~~---  141 (254)
T pfam00218        69 DPAEIARAYEAAGASAISVLTE-PKYFQGSLEYLRE-VREA--VSLPVLRKDFIIDEYQIYEARAYGADTVLLIVAV---  141 (254)
T ss_pred             CHHHHHHHHHHCCCCEEEEECC-CCCCCCCHHHHHH-HHHH--CCCCEECCHHEEEHHHHHHHHHCCCCEEEHHHHC---
T ss_conf             9999999999779837998426-7867987999999-9986--4885111410465999999998088863144711---


Q ss_pred             HHHCCCCCCCHHHHHHHHHHHHHCCCCCCCEEEECCCCCHHHHHHHHHHHHHCCCCCCEEECCCEEECCCCCCCCCCCCC
Q ss_conf             73205888898999999999998798557707866898999999999999740888860205411204874124456879
Q gi|254780485|r  172 FYPHVTTTHTFEDRLQTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVD  251 (328)
Q Consensus       172 ~~~~~~~~~~~~~~l~~~~~a~~~G~~~~sg~l~G~gEt~eeri~~l~~lr~l~~~~~~v~~~~~~p~~gt~l~~~~~~~  251 (328)
                              -+.++--+.++.|+++|+.+    ++-. .+.+|    +.+.-+++.  .-+.+|...      |.. -..+
T Consensus       142 --------L~~~~l~~l~~~a~~lgl~~----LvEv-h~~~E----l~~al~~~a--~iIGINNRn------L~t-f~vd  195 (254)
T pfam00218       142 --------LSDELLEELYEYARSLGMEP----LVEV-HNEEE----LERALALGA--KLIGVNNRN------LKT-FEVD  195 (254)
T ss_pred             --------CCHHHHHHHHHHHHHHCCEE----EEEE-CCHHH----HHHHHHCCC--CEEEECCCC------HHH-HHCC
T ss_conf             --------99999999999999848867----9886-89999----999984899--789632788------465-1005


Q ss_pred             HHHHHHHHHHHHHHCCCCCCEEEEHHHHHCHHHHHHHHHHCCCEEEECCEEECCCC
Q ss_conf             89999999999996868721423115651656899999809988997786651588
Q gi|254780485|r  252 PIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKN  307 (328)
Q Consensus       252 ~~e~lr~iAi~RL~lP~~~i~i~~~~~~~~~~~~~~~L~~GaN~~~~g~~~~t~~g  307 (328)
                      ..   ++..++. .+|...+.++-|=..-. +-......+|+|++++|+.+.++..
T Consensus       196 ~~---~t~~L~~-~ip~~~~~VsESGI~~~-~di~~l~~~G~~~~LIGe~lm~~~d  246 (254)
T pfam00218       196 LN---TTRRLAP-MVPEDVLLVAESGISTP-EDVEKLAKHGANAFLVGESLMRAPD  246 (254)
T ss_pred             HH---HHHHHHH-HCCCCCEEEECCCCCCH-HHHHHHHHCCCCEEEECHHHHCCCC
T ss_conf             79---9999995-58989879983899999-9999999879999998968757999


No 168
>TIGR02090 LEU1_arch isopropylmalate/citramalate/homocitrate synthases; InterPro: IPR011830   Methanogenic archaea contain three closely related homologs of the 2-isopropylmalate synthases (LeuA) represented by IPR005671 from INTERPRO. Two of these in Methanococcus janaschii (MJ1392 - CimA ; MJ0503 - AksA ) have been characterised as catalyzing alternative reactions leaving the third (MJ1195) as the presumptive LeuA enzyme. CimA is citramalate (2-methylmalate) synthase, which condenses acetyl-CoA with pyruvate. This enzyme is believed to be involved in the biosynthesis of isoleucine in methanogens and possibly other species lacking threonine dehydratase. AksA is a homocitrate synthase which also produces (homo)2-citrate and (homo)3-citrate in the biosynthesis of Coenzyme B which is restricted solely to methanogenic archaea. Methanogens, then should and apparently do contain all three of these enzymes. Unfortunately, phylogenetic trees do not resolve into three unambiguous clades, making assignment of function to particular genes problematic. Other archaea, which lack a threonine dehydratase (mainly Euryarchaeota), should contain both CimA and LeuA genes. This is true for archaeoglobus fulgidis, but not for the Pyrococci which have none in this clade, but one in IPR005671 from INTERPRO and one in IPR005675 from INTERPRO which may fulfil these roles. Proteins from other species, which have only one hit to this entry and lack threonine dehydratase, are very likely to be LeuA enzymes.; GO: 0046912 transferase activity transferring acyl groups acyl groups converted into alkyl on transfer, 0019752 carboxylic acid metabolic process.
Probab=88.80  E-value=1.9  Score=22.71  Aligned_cols=107  Identities=18%  Similarity=0.159  Sum_probs=41.4

Q ss_pred             CCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCCCCHHHHHHHHHHHCCC-CCCEEEE-CCCCCHHHHHHHHCCCCCEEEE
Q ss_conf             0685799999999996498389973036888744289999988762136-8832410-2569999999874157606975
Q gi|254780485|r   87 LINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSL-GLETCMT-LGMLSFEQAQILSKAGLDYYNH  164 (328)
Q Consensus        87 ~~~~Eei~~~a~~~~~~G~~~~~l~~~~~~~~~~~~~~~~e~i~~i~~~-~~~i~~~-~g~~~~~~~~~Lk~aG~~~~~~  164 (328)
                      -||+|+=++.|+.+.+.|..-+   -.|-+- .+  +-=.+++|.|-+. ++..-+. +-=..+...-.--++|+|+++.
T Consensus        18 sLT~EqK~~IA~KLDeLGVDvI---EAGfpi-~S--~GE~~aiK~I~~~vGLnAEI~~l~RA~k~DID~AidcgvdsIh~   91 (371)
T TIGR02090        18 SLTVEQKVEIARKLDELGVDVI---EAGFPI-AS--EGEFEAIKKIAEEVGLNAEICSLARALKKDIDKAIDCGVDSIHT   91 (371)
T ss_pred             CCCHHHHHHHHHHHHHCCCCEE---ECCCCC-CC--HHHHHHHHHHHHHCCCCEEEEEEECCCCCCHHHHHHCCCCEEEE
T ss_conf             6886568999999974698288---547631-45--14578999999862896355101026731001564369877899


Q ss_pred             ECCCCHHHHHCCCCCCCHHHH----HHHHHHHHHCCCCC
Q ss_conf             134377773205888898999----99999999879855
Q gi|254780485|r  165 NIDTSERFYPHVTTTHTFEDR----LQTLENVRKSGIKV  199 (328)
Q Consensus       165 ~let~~~~~~~~~~~~~~~~~----l~~~~~a~~~G~~~  199 (328)
                      ..=|||-..+..-+..|-++-    ++.++.|++.|+-+
T Consensus        92 fiaTSpiH~KYKl~~K~~devle~~veAvEYAKEHGLiV  130 (371)
T TIGR02090        92 FIATSPIHLKYKLKNKSRDEVLEKAVEAVEYAKEHGLIV  130 (371)
T ss_pred             EECCCHHHHHCCCCCCCHHHHHHHHHHHHHHHHHCCCEE
T ss_conf             804885787234888789999999999898775257355


No 169
>TIGR01182 eda 2-dehydro-3-deoxyphosphogluconate aldolase/4-hydroxy-2-oxoglutarate aldolase; InterPro: IPR000887 4-Hydroxy-2-oxoglutarate aldolase (4.1.3.16 from EC) (KHG-aldolase) catalyzes the interconversion of 4-hydroxy-2-oxoglutarate into pyruvate and glyoxylate. Phospho-2-dehydro-3-deoxygluconate aldolase (4.1.2.14 from EC) (KDPG-aldolase) catalyzes the interconversion of 6-phospho-2-dehydro-3-deoxy-D-gluconate into pyruvate and glyceraldehyde 3-phosphate. These two enzymes are structurally and functionally related . They are both homotrimeric proteins of approximately 220 amino-acid residues. They are class I aldolases whose catalytic mechanism involves the formation of a Schiff-base intermediate between the substrate and the epsilon-amino group of a lysine residue. In both enzymes, an arginine is required for catalytic activity.; GO: 0003824 catalytic activity, 0008152 metabolic process.
Probab=88.43  E-value=2  Score=22.55  Aligned_cols=106  Identities=20%  Similarity=0.233  Sum_probs=78.5

Q ss_pred             CCCCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCCCCHHHHHHHHHHHCCCCC-CEEEECCC-CCHHHHHHHHCCCCCE
Q ss_conf             100068579999999999649838997303688874428999998876213688-32410256-9999999874157606
Q gi|254780485|r   84 ASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLGL-ETCMTLGM-LSFEQAQILSKAGLDY  161 (328)
Q Consensus        84 ~~~~~~~Eei~~~a~~~~~~G~~~~~l~~~~~~~~~~~~~~~~e~i~~i~~~~~-~i~~~~g~-~~~~~~~~Lk~aG~~~  161 (328)
                      .-..-+.|+.+..|+.+.+.|.+-+-+  ..+.+      .=.|+|+.+++..+ ++.+-+|+ ++.+++..-.++|++-
T Consensus        13 Vi~~~~~~~A~~lA~aL~egG~~~~Ev--TlRT~------~A~~aI~~l~~~~P~~~~iGAGTVL~~~Q~~~A~~AGA~F   84 (205)
T TIGR01182        13 VIRIDDVEDALPLAKALIEGGLRVLEV--TLRTP------VALEAIRALRKEVPKDALIGAGTVLNPEQLRQAVAAGAQF   84 (205)
T ss_pred             EEEECCHHHHHHHHHHHHHCCCEEEEE--EECCC------CHHHHHHHHHHHCCCCCEECCCCCCCHHHHHHHHHCCCCE
T ss_conf             887267877789999998679808988--51472------1689999999728233487167648989999999708957


Q ss_pred             EEEECCCCHHHHHCCCCCCCHHHHHHHHHHHHHCCCCCCCEEEECCCCCHHHHHHHHH
Q ss_conf             9751343777732058888989999999999987985577078668989999999999
Q gi|254780485|r  162 YNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSGIKVCCGGILGLGEMIDDRIDMLL  219 (328)
Q Consensus       162 ~~~~let~~~~~~~~~~~~~~~~~l~~~~~a~~~G~~~~sg~l~G~gEt~eeri~~l~  219 (328)
                      +.     +|.        .+    -+..+.+++.|++.--|++     |.-|+..-|.
T Consensus        85 ~v-----SPG--------~~----p~l~~~~~~~~~P~iPGV~-----tpsEi~~Al~  120 (205)
T TIGR01182        85 IV-----SPG--------LT----PELAKHAKDKGIPIIPGVA-----TPSEIMLALE  120 (205)
T ss_pred             EE-----CCC--------CC----HHHHHHHHHCCCCEECCCC-----CHHHHHHHHH
T ss_conf             87-----697--------88----8999998508881217776-----8789999987


No 170
>PRK06843 inositol-5-monophosphate dehydrogenase; Validated
Probab=88.36  E-value=2  Score=22.52  Aligned_cols=115  Identities=15%  Similarity=0.183  Sum_probs=61.2

Q ss_pred             HHHHHHHHHHHHCCCEEEEEECCCCCCCCCCHHHHHHHHHHHCCCCCCEEEECC-CCCHHHHHHHHCCCCCEEEEECCCC
Q ss_conf             799999999996498389973036888744289999988762136883241025-6999999987415760697513437
Q gi|254780485|r   91 DQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLGLETCMTLG-MLSFEQAQILSKAGLDYYNHNIDTS  169 (328)
Q Consensus        91 Eei~~~a~~~~~~G~~~~~l~~~~~~~~~~~~~~~~e~i~~i~~~~~~i~~~~g-~~~~~~~~~Lk~aG~~~~~~~let~  169 (328)
                      ++..+.+..+.+.|+.-+++.+.+.     .-.+.++.++.+|+..+.+.+-+| ..+.+....|.++|+|.+.+.+..-
T Consensus       152 ~d~~era~~Lv~AGvD~lvID~AhG-----hs~~~~e~ik~ik~~~p~v~VIaGNVaT~~~a~~Li~aGAD~VkVGiGpG  226 (404)
T PRK06843        152 IDTIERVEELVKAHVDILVIDSAHG-----HSTRIIELVKTIKNKYPNLDLIAGNIVTKEAALDLINVGADCLKVGIGPG  226 (404)
T ss_pred             HHHHHHHHHHHHCCCCEEEEECCCC-----CHHHHHHHHHHHHHHCCCCCEEECCCCCHHHHHHHHHHCCCEEEECCCCC
T ss_conf             5289999999976999999968875-----21789999999997679961663030579999999981989999565478


Q ss_pred             HHHHHCCCCCC--------CHHHHHHHHHHHHHCCCCCCCEEEECCCCCHHHHHHHH
Q ss_conf             77732058888--------98999999999998798557707866898999999999
Q gi|254780485|r  170 ERFYPHVTTTH--------TFEDRLQTLENVRKSGIKVCCGGILGLGEMIDDRIDML  218 (328)
Q Consensus       170 ~~~~~~~~~~~--------~~~~~l~~~~~a~~~G~~~~sg~l~G~gEt~eeri~~l  218 (328)
                           .+|++.        ...-..++.+.+++.+.++-+-   |=..+.-|++.-|
T Consensus       227 -----siCTTr~v~GvGvPq~tAi~d~~~~a~~~~v~IIAD---GGI~~sGDi~KAl  275 (404)
T PRK06843        227 -----SICTTRIVAGVGVPQITAICDVYEVCKNTNICIIAD---GGIRFSGDVVKAI  275 (404)
T ss_pred             -----CCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCCEEEC---CCCCCCCHHHHHH
T ss_conf             -----772566545868748999999999960579978836---8746532799999


No 171
>PRK12344 putative alpha-isopropylmalate/homocitrate synthase family transferase; Provisional
Probab=88.05  E-value=2.1  Score=22.39  Aligned_cols=123  Identities=14%  Similarity=0.106  Sum_probs=50.6

Q ss_pred             CCHHHHHHHH----HHHHHCCCEEEEEEC-CCCCCCCCCHHHHHHHHHHHCCCCC---CEEEECCCCCHHHHHHHHCCCC
Q ss_conf             6857999999----999964983899730-3688874428999998876213688---3241025699999998741576
Q gi|254780485|r   88 INVDQVLKEA----KNAKENGATRYCMGA-AWREPKERDLSIIVDMIKGVKSLGL---ETCMTLGMLSFEQAQILSKAGL  159 (328)
Q Consensus        88 ~~~Eei~~~a----~~~~~~G~~~~~l~~-~~~~~~~~~~~~~~e~i~~i~~~~~---~i~~~~g~~~~~~~~~Lk~aG~  159 (328)
                      ++.|++++.+    +.+++.|.. +.... ...+....+.+|++++++...+.+.   .++=++|.....++..+-..=.
T Consensus       119 ~t~~e~l~~i~~~v~~a~~~g~~-V~~~~E~f~Da~R~d~efl~ev~~aa~~aGa~~i~l~DTvG~~~P~~v~~~i~~l~  197 (530)
T PRK12344        119 TTLEENLAMIRDSVAYLKAHGRE-VIYDAEHFFDGYKANPEYALATLKAAAEAGADWVVLCDTNGGTLPHEVAAIVAEVR  197 (530)
T ss_pred             CCHHHHHHHHHHHHHHHHHCCCE-EEECCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEEECCCCCCCCHHHHHHHHHHHH
T ss_conf             99999999999999999971987-99413213664337999999999999852996002378865558899999999999


Q ss_pred             CEEEEECCCCHHHHHCCCCCCCHHHHHHHHHHHHHCCCCCCCEEEECCCC-----CHHHHHHHH
Q ss_conf             06975134377773205888898999999999998798557707866898-----999999999
Q gi|254780485|r  160 DYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSGIKVCCGGILGLGE-----MIDDRIDML  218 (328)
Q Consensus       160 ~~~~~~let~~~~~~~~~~~~~~~~~l~~~~~a~~~G~~~~sg~l~G~gE-----t~eeri~~l  218 (328)
                      ..    +...+   -.+|.+.+..==...-..|-.+|-.---+-++|+||     ..++.+-.|
T Consensus       198 ~~----~~~~~---isvH~HND~GlAvANal~Av~aGA~~ve~TvnGiGERaGNa~Leevv~~L  254 (530)
T PRK12344        198 AR----LPGAP---LGIHAHNDSGLAVANSLAAVRAGARQVQGTINGYGERCGNANLCSIIPNL  254 (530)
T ss_pred             HH----CCCCE---EEEEECCCCCHHHHHHHHHHHHCCCCEEEEEECCCCCCCCCCHHHHHHHH
T ss_conf             74----89982---79984599688999999999838060431360325555777899999999


No 172
>COG3623 SgaU Putative L-xylulose-5-phosphate 3-epimerase [Carbohydrate transport and metabolism]
Probab=87.95  E-value=2.1  Score=22.35  Aligned_cols=54  Identities=9%  Similarity=0.146  Sum_probs=35.2

Q ss_pred             CCHHHHHCCCCCCCHHHHHHHHHHHHHCCCCCCCEEEECC-CCCHHHHHHHHHHHHH
Q ss_conf             3777732058888989999999999987985577078668-9899999999999974
Q gi|254780485|r  168 TSERFYPHVTTTHTFEDRLQTLENVRKSGIKVCCGGILGL-GEMIDDRIDMLLTLAN  223 (328)
Q Consensus       168 t~~~~~~~~~~~~~~~~~l~~~~~a~~~G~~~~sg~l~G~-gEt~eeri~~l~~lr~  223 (328)
                      ++|.-|+.++=+..--+|.+..+..|++++..  .+++-+ -|+.||-+.++...|+
T Consensus       220 ~~~GqFrdvpfGeG~Vdf~~~f~~lk~~ny~g--pfLIEMWse~~ee~~~~i~~A~~  274 (287)
T COG3623         220 TSPGQFRDVPFGEGCVDFEECFKTLKQLNYRG--PFLIEMWSETAEEPVAEIIQARD  274 (287)
T ss_pred             CCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCC--CEEHHHHHHHHHHHHHHHHHHHH
T ss_conf             58875015786776034999999999828887--66223222022536999999999


No 173
>pfam01081 Aldolase KDPG and KHG aldolase. This family includes the following members: 4-hydroxy-2-oxoglutarate aldolase (KHG-aldolase) Phospho-2-dehydro-3-deoxygluconate aldolase (KDPG-aldolase)
Probab=87.91  E-value=2.1  Score=22.34  Aligned_cols=166  Identities=14%  Similarity=0.112  Sum_probs=104.4

Q ss_pred             CCCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCCCCHHHHHHHHHHHCCCCCCEEEECCC-CCHHHHHHHHCCCCCEEE
Q ss_conf             0006857999999999964983899730368887442899999887621368832410256-999999987415760697
Q gi|254780485|r   85 SKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLGLETCMTLGM-LSFEQAQILSKAGLDYYN  163 (328)
Q Consensus        85 ~~~~~~Eei~~~a~~~~~~G~~~~~l~~~~~~~~~~~~~~~~e~i~~i~~~~~~i~~~~g~-~~~~~~~~Lk~aG~~~~~  163 (328)
                      .+..+.|+....++.+.+.|++.+-+..  +.+      .-.+.++.+++..+.+.+-+|. ++.++++...++|++.+.
T Consensus        14 ~r~~~~~~a~~~~~al~~~Gi~~iEiTl--~t~------~a~~~I~~l~~~~p~~~iGaGTV~~~e~~~~a~~aGA~Fiv   85 (196)
T pfam01081        14 IVIKDKEDALPLAEALAAGGIRVLEVTL--RTP------CALDAIRLLRKNRPDALVGAGTVLNAQQLAEAAEAGAQFVV   85 (196)
T ss_pred             EECCCHHHHHHHHHHHHHCCCCEEEEEC--CCH------HHHHHHHHHHHHCCCCEEEEEECCCHHHHHHHHHCCCCEEE
T ss_conf             9779999999999999987998899947--982------79999999996499967999837689999999974999999


Q ss_pred             EECCCCHHHHHCCCCCCCHHHHHHHHHHHHHCCCCCCCEEEECCCCCHHHHHHHHHHHHHCCCCCCEEECCCEEECCCCC
Q ss_conf             51343777732058888989999999999987985577078668989999999999997408888602054112048741
Q gi|254780485|r  164 HNIDTSERFYPHVTTTHTFEDRLQTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSK  243 (328)
Q Consensus       164 ~~let~~~~~~~~~~~~~~~~~l~~~~~a~~~G~~~~sg~l~G~gEt~eeri~~l~~lr~l~~~~~~v~~~~~~p~~gt~  243 (328)
                           +|.        .    -.++++.+++.|++.-.|.+     |+-|...-    .+.+.  ..+-+   +|  ...
T Consensus        86 -----SP~--------~----~~~v~~~a~~~~i~~iPGv~-----TpsEi~~A----~~~G~--~~vKl---FP--A~~  132 (196)
T pfam01081        86 -----SPG--------L----TADLLKHAVDVKIPLIPGVS-----TPSEIMLG----LDLGL--TRFKF---FP--AEA  132 (196)
T ss_pred             -----CCC--------C----HHHHHHHHHHCCCCEECCCC-----CHHHHHHH----HHCCC--CEEEE---CC--CHH
T ss_conf             -----787--------6----39999999973996637859-----99999999----98799--98997---87--310


Q ss_pred             CCCCCCCCHHHHHHHHHHHHHHCCCCCCEEEEHHHHHCHHHHHHHHHHCCCEEEECCEEE
Q ss_conf             244568798999999999999686872142311565165689999980998899778665
Q gi|254780485|r  244 FEENKKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLL  303 (328)
Q Consensus       244 l~~~~~~~~~e~lr~iAi~RL~lP~~~i~i~~~~~~~~~~~~~~~L~~GaN~~~~g~~~~  303 (328)
                            ..+..++|.   .|=-+|+....-++|   +..+....-|.+|+.....|..+.
T Consensus       133 ------~Gg~~~lka---l~~p~p~~~f~ptGG---v~~~N~~~yl~~g~v~~~~GS~l~  180 (196)
T pfam01081       133 ------SGGVPAIKA---LAGPFPQVRFCPTGG---IHPANVRDYLALPNILCVGGSWLV  180 (196)
T ss_pred             ------CCCHHHHHH---HHCCCCCCEEEEECC---CCHHHHHHHHHCCCEEEEECHHHC
T ss_conf             ------184999999---857799986998079---898889999968986999893648


No 174
>TIGR01496 DHPS dihydropteroate synthase; InterPro: IPR006390   This domain is present in sequences representing dihydropteroate synthase, the enzyme that catalyzes the second to last step in folic acid biosynthesis.   Dihydropteroate synthase (2.5.1.15 from EC) (DHPS) catalyses the condensation of 6-hydroxymethyl-7,8-dihydropteridine pyrophosphate to para-aminobenzoic acid to form 7,8-dihydropteroate. This is the second step in the three-step pathway leading from 6-hydroxymethyl-7,8-dihydropterin to 7,8-dihydrofolate. DHPS is the target of sulphonamides, which are substrate analogues that compete with para-aminobenzoic acid. Bacterial DHPS (gene sul or folP)  is a protein of about 275 to 315 amino acid residues that is either chromosomally encoded or found on various antibiotic resistance plasmids. In the lower eukaryote Pneumocystis carinii, DHPS is the C-terminal domain of a multifunctional folate synthesis enzyme (gene fas) .; GO: 0004156 dihydropteroate synthase activity, 0009396 folic acid and derivative biosynthetic process.
Probab=87.79  E-value=2.2  Score=22.29  Aligned_cols=141  Identities=21%  Similarity=0.323  Sum_probs=93.2

Q ss_pred             CCCCCCCHHHHHHHHHHHHHCCCEEEEEECC-CCCC-----CCCCHHHHHHHHHHHCCCC--CC--EEEECCCCCHHHHH
Q ss_conf             4100068579999999999649838997303-6888-----7442899999887621368--83--24102569999999
Q gi|254780485|r   83 KASKLINVDQVLKEAKNAKENGATRYCMGAA-WREP-----KERDLSIIVDMIKGVKSLG--LE--TCMTLGMLSFEQAQ  152 (328)
Q Consensus        83 ~~~~~~~~Eei~~~a~~~~~~G~~~~~l~~~-~~~~-----~~~~~~~~~e~i~~i~~~~--~~--i~~~~g~~~~~~~~  152 (328)
                      +....++.+..++.|++..+.|+.-+-+++- .++.     +..+.+++++.|+.|++..  ..  +-+|+-+.--+..+
T Consensus        15 DgG~~~~~~~A~~~a~~m~~~GA~IiDiGGeSTRPG~~~vs~~eE~~Rv~Pv~~~~~~~~~~~dQC~~iSvDT~~a~Va~   94 (268)
T TIGR01496        15 DGGRFLSVDKALEHAERMLEEGADIIDIGGESTRPGADRVSPEEELNRVVPVIKALREQYLFSDQCVPISVDTYRAEVAR   94 (268)
T ss_pred             CCCCCCCHHHHHHHHHHHHHCCCCEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCHHHHH
T ss_conf             88766677899999999997399889657705797698789799999889999999974489998414776188289999


Q ss_pred             HHHCC-CCCEEEE--ECCCCHHHHHC-------C---C----CCC-----CHH-------HHH-HHHHHHHHCCCCCCCE
Q ss_conf             87415-7606975--13437777320-------5---8----888-----989-------999-9999999879855770
Q gi|254780485|r  153 ILSKA-GLDYYNH--NIDTSERFYPH-------V---T----TTH-----TFE-------DRL-QTLENVRKSGIKVCCG  202 (328)
Q Consensus       153 ~Lk~a-G~~~~~~--~let~~~~~~~-------~---~----~~~-----~~~-------~~l-~~~~~a~~~G~~~~sg  202 (328)
                      .--++ |++.+|=  .+.-.|..++-       +   |    |..     .|+       .++ +-++.+.++|+. .= 
T Consensus        95 ~Al~~~Ga~iiNDv~G~~~dp~m~~vaae~~~~~vlMH~~g~P~~~q~~~~Y~dv~~e~~~fl~~~~~~~~~~Gv~-~~-  172 (268)
T TIGR01496        95 AALEAFGADIINDVSGGQFDPDMLEVAAEYGVPLVLMHMRGTPETMQENPRYEDVVEEVLRFLEARAEELLAAGVA-ER-  172 (268)
T ss_pred             HHHHHCCCCEEEECCCCCCCHHHHHHHHHHCCCEEEECCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCC-CC-
T ss_conf             9998679867860411466835899999848988987687638876667776566899999999999999975886-65-


Q ss_pred             EE----ECCCC--CHHHHHHHHHHHHHCC
Q ss_conf             78----66898--9999999999997408
Q gi|254780485|r  203 GI----LGLGE--MIDDRIDMLLTLANLS  225 (328)
Q Consensus       203 ~l----~G~gE--t~eeri~~l~~lr~l~  225 (328)
                      ++    ||.+-  |.+|=++.|.++.++.
T Consensus       173 I~LDPG~GF~K~~t~~~Nl~ll~~l~~f~  201 (268)
T TIGR01496       173 IILDPGIGFGKSDTVEHNLELLKRLEEFK  201 (268)
T ss_pred             EEECCCCCCCCCCCHHHHHHHHHHHHHHH
T ss_conf             78717757788888767899998689999


No 175
>PRK13802 bifunctional indole-3-glycerol phosphate synthase/tryptophan synthase subunit beta; Provisional
Probab=87.76  E-value=2.2  Score=22.28  Aligned_cols=178  Identities=13%  Similarity=0.082  Sum_probs=101.1

Q ss_pred             HHHHHHHHHHHCCCEEEEEECCCCCCCCCCHHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHCCCCCEEEEECCCCHH
Q ss_conf             99999999996498389973036888744289999988762136883241025699999998741576069751343777
Q gi|254780485|r   92 QVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSER  171 (328)
Q Consensus        92 ei~~~a~~~~~~G~~~~~l~~~~~~~~~~~~~~~~e~i~~i~~~~~~i~~~~g~~~~~~~~~Lk~aG~~~~~~~let~~~  171 (328)
                      +..+.|+...+.|+.-+...+- ...+....+++.. +|..  ..+.+...-+..++.++.+-+..|+|.+++-..    
T Consensus        71 dp~~iA~~Ye~~GA~aISVLTe-~~~F~Gsl~dL~~-vr~~--v~lPvLRKDFIvD~yQI~EAr~~GADaILLIva----  142 (695)
T PRK13802         71 DPAALAREYEKGGASAISVLTE-GRKFLGSLDDFDK-VRAA--VHIPVLRKDFIVTDYQIFEARAHGADLVLLIVA----  142 (695)
T ss_pred             CHHHHHHHHHHCCCEEEEEECC-CCCCCCCHHHHHH-HHHH--CCCCEEECCEECCHHHHHHHHHCCCCHHHHHHH----
T ss_conf             9999999999879849998258-6767989999999-9985--899857023306399999999828788999998----


Q ss_pred             HHHCCCCCCCHHHHHHHHHHHHHCCCCCCCEEEECCCCCHHHHHHHHHHHHHCCCCCCEEECCCEEECCCCCCCCCCCCC
Q ss_conf             73205888898999999999998798557707866898999999999999740888860205411204874124456879
Q gi|254780485|r  172 FYPHVTTTHTFEDRLQTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVD  251 (328)
Q Consensus       172 ~~~~~~~~~~~~~~l~~~~~a~~~G~~~~sg~l~G~gEt~eeri~~l~~lr~l~~~~~~v~~~~~~p~~gt~l~~~~~~~  251 (328)
                             --+.++--+.++.++++||..    |+-. .+.+|.    .+.-+.+.  .-|.+|...      |     -+
T Consensus       143 -------~L~~~~L~~l~~~a~~LGm~~----LVEV-H~~~El----~rAl~~ga--~iIGINnRn------L-----~T  193 (695)
T PRK13802        143 -------ALDDAQLKHLLDLAHELNMTV----LVET-HTREEI----ERARKAGA--KVIGINARN------L-----KN  193 (695)
T ss_pred             -------HCCHHHHHHHHHHHHHCCCEE----EEEE-CCHHHH----HHHHHCCC--CEEEEECCC------C-----CC
T ss_conf             -------669999999999999869917----9997-899999----99984799--989987898------8-----64


Q ss_pred             HHHHHHHHHHHHHHCCCCCCEEEEHHHHHCHHHHHHHHHHCCCEEEECCEEECCCC
Q ss_conf             89999999999996868721423115651656899999809988997786651588
Q gi|254780485|r  252 PIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKN  307 (328)
Q Consensus       252 ~~e~lr~iAi~RL~lP~~~i~i~~~~~~~~~~~~~~~L~~GaN~~~~g~~~~t~~g  307 (328)
                      .+-.+.+..-..=.+|...+.++-|=..--.+... .-.+|||.+++||.++|++.
T Consensus       194 f~vD~~~~~~Lap~iP~~~v~VAESGI~~~~Dv~~-~a~aGadAvLVGEalvta~d  248 (695)
T PRK13802        194 LKVDVNKYNELAADLPDDVIKVAESGVFGAVEVED-YARAGADAVLVGEGVATADN  248 (695)
T ss_pred             CEECHHHHHHHHHHCCCCCEEEECCCCCCHHHHHH-HHHCCCCEEEECCHHHCCCC
T ss_conf             22877999999846899857995689999899999-99779999997803415898


No 176
>PRK11121 nrdG anaerobic ribonucleotide reductase-activating protein; Provisional
Probab=87.73  E-value=2.2  Score=22.27  Aligned_cols=84  Identities=13%  Similarity=0.199  Sum_probs=42.3

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCC--EEEEEECCCCCCCCCCHHHHHHHHHHHCCC--CC
Q ss_conf             78683423212433547775641000685799999999996498--389973036888744289999988762136--88
Q gi|254780485|r   62 TGGCPENCGYCNQSVHNKSKLKASKLINVDQVLKEAKNAKENGA--TRYCMGAAWREPKERDLSIIVDMIKGVKSL--GL  137 (328)
Q Consensus        62 TN~C~~~C~fCaf~~~~~~~~~~~~~~~~Eei~~~a~~~~~~G~--~~~~l~~~~~~~~~~~~~~~~e~i~~i~~~--~~  137 (328)
                      +..|+.+|+-|- +..... .......+.+.+.+..........  ..+-+ +||++......+.+++.++.+++.  +.
T Consensus        23 ~qGC~~~C~GC~-Np~tw~-~~~G~~~~~~~~~~ii~~l~~~~~~~~GvTi-sGGEP~~q~~~~~l~~l~~~~k~~~~~~   99 (154)
T PRK11121         23 VSGCVHQCPGCY-NKSTWR-LNSGHPFTKAMEDQIIADLNDTRIKRQGLSL-SGGDPLHPQNVPAILKLVKRVKAECPGK   99 (154)
T ss_pred             ECCCCCCCCCCC-CHHHCC-CCCCEECHHHHHHHHHHHHHHCCCCCCCEEE-ECCCCCCCCCHHHHHHHHHHHHHHCCCC
T ss_conf             568877797999-977858-7589776199999999987642355475388-6888265147999999999999758998


Q ss_pred             CEEEECCCCCH
Q ss_conf             32410256999
Q gi|254780485|r  138 ETCMTLGMLSF  148 (328)
Q Consensus       138 ~i~~~~g~~~~  148 (328)
                      .|.+-.|..-+
T Consensus       100 ~I~~yTGyt~e  110 (154)
T PRK11121        100 DIWLWTGYKLD  110 (154)
T ss_pred             CEEEEECCCHH
T ss_conf             49998186389


No 177
>PRK05567 inositol-5'-monophosphate dehydrogenase; Reviewed
Probab=87.63  E-value=2.2  Score=22.23  Aligned_cols=68  Identities=19%  Similarity=0.213  Sum_probs=26.4

Q ss_pred             HHHHHHHHHCCCEEEEEECCCCCCCCCCHHHHHHHHHHHCCCCCCEEEECC-CCCHHHHHHHHCCCCCEEEEEC
Q ss_conf             999999996498389973036888744289999988762136883241025-6999999987415760697513
Q gi|254780485|r   94 LKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLGLETCMTLG-MLSFEQAQILSKAGLDYYNHNI  166 (328)
Q Consensus        94 ~~~a~~~~~~G~~~~~l~~~~~~~~~~~~~~~~e~i~~i~~~~~~i~~~~g-~~~~~~~~~Lk~aG~~~~~~~l  166 (328)
                      .+.++.+.+.|+--+++-+.+.     .-++.+++++.+|+..+.+.+-+| ..+.+..+.|.++|+|.+.+.+
T Consensus       230 ~eRa~~Lv~AGvDvivIDtAhG-----hs~~vi~~ik~ik~~~~~v~viaGNv~T~~~a~~L~~aGaD~vkVGi  298 (486)
T PRK05567        230 EERAEALVKAGVDVLVVDTAHG-----HSEGVLDRVREIKAKYPDVQIIAGNVATAEAARALIEAGADAVKVGI  298 (486)
T ss_pred             HHHHHHHHHCCCCEEEEECCCC-----CHHHHHHHHHHHHHCCCCCCEEEEEECHHHHHHHHHHCCCCEEEECC
T ss_conf             9999999976998899504452-----15778999999974078773687512019999999972987699656


No 178
>PRK13957 indole-3-glycerol-phosphate synthase; Provisional
Probab=87.55  E-value=2.2  Score=22.20  Aligned_cols=177  Identities=13%  Similarity=0.112  Sum_probs=102.9

Q ss_pred             HHHHHHHHHHHCCCEEEEEECCCCCCCCCCHHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHCCCCCEEEEECCCCHH
Q ss_conf             99999999996498389973036888744289999988762136883241025699999998741576069751343777
Q gi|254780485|r   92 QVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSER  171 (328)
Q Consensus        92 ei~~~a~~~~~~G~~~~~l~~~~~~~~~~~~~~~~e~i~~i~~~~~~i~~~~g~~~~~~~~~Lk~aG~~~~~~~let~~~  171 (328)
                      ...+.|+...+.|+.-+.+.+- ...+....+++..+ +.  ...+.+...-+..++.+...-+.+|+|.+++-...   
T Consensus        62 dp~~iA~~Y~~~GA~aiSVLTe-~~~F~Gs~~~L~~v-~~--~v~lPiLrKDFIid~~QI~ea~~~GADaILLIaa~---  134 (247)
T PRK13957         62 HPVQIAKTYETLGASAISVLTD-QSYFGGSLEDLKSV-SS--ELKIPVLRKDFILDEIQIREARAFGASAILLIVRI---  134 (247)
T ss_pred             CHHHHHHHHHHCCCCEEEECCC-CCCCCCCHHHHHHH-HH--HCCCCEEEEEEECCHHHHHHHHHCCCCEEHHHHHC---
T ss_conf             9999999999779928998278-56679989999999-98--57998474112064999999997399851268850---


Q ss_pred             HHHCCCCCCCHHHHHHHHHHHHHCCCCCCCEEEECCCCCHHHHHHHHHHHHHCCCCCCEEECCCEEECCCCCCCCCCCCC
Q ss_conf             73205888898999999999998798557707866898999999999999740888860205411204874124456879
Q gi|254780485|r  172 FYPHVTTTHTFEDRLQTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVD  251 (328)
Q Consensus       172 ~~~~~~~~~~~~~~l~~~~~a~~~G~~~~sg~l~G~gEt~eeri~~l~~lr~l~~~~~~v~~~~~~p~~gt~l~~~~~~~  251 (328)
                              -+.++--+.++.|+++|+.+    ++-. .+.+|.    .+.-+++.  ..+.+|...      +.. -..+
T Consensus       135 --------L~~~~l~~l~~~A~~lGle~----LvEv-H~~~El----~~al~~~~--~iIGINNRn------L~t-f~vd  188 (247)
T PRK13957        135 --------LTPSQIKSFLKHASSLGMDV----LVEV-HTEDEA----KLALDCGA--EIIGINTRD------LDT-FQIH  188 (247)
T ss_pred             --------CCHHHHHHHHHHHHHHCCEE----EEEE-CCHHHH----HHHHHCCC--CEEEEECCC------CCC-CCCC
T ss_conf             --------89999999999999838815----6255-899999----99984899--889874577------321-4639


Q ss_pred             HHHHHHHHHHHHHHCCCCCCEEEEHHHHHCHHHHHHHHHHCCCEEEECCEEECCCC
Q ss_conf             89999999999996868721423115651656899999809988997786651588
Q gi|254780485|r  252 PIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKN  307 (328)
Q Consensus       252 ~~e~lr~iAi~RL~lP~~~i~i~~~~~~~~~~~~~~~L~~GaN~~~~g~~~~t~~g  307 (328)
                      ..    +..-.+=++|...+.++-|=..-..+..  .+..++|+.++|+.+..+..
T Consensus       189 ~~----~~~~l~~~ip~~~~~VsESGI~~~~di~--~l~~~~da~LIGeslMk~~d  238 (247)
T PRK13957        189 QN----LVEEVAAFLPPNIVKVGESGIESRSDLD--KFRKLVDAALIGTYFMEKKD  238 (247)
T ss_pred             HH----HHHHHHHHCCCCCEEEECCCCCCHHHHH--HHHHHCCEEEECHHHHCCCC
T ss_conf             88----9999984389998799678999999999--99973999998867756999


No 179
>PRK00748 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Validated
Probab=87.16  E-value=2.3  Score=22.05  Aligned_cols=203  Identities=15%  Similarity=0.190  Sum_probs=103.4

Q ss_pred             HHHHHHHHHHHCCCEEEEEECCCCCCCCCCHHHHHHHHHHH-CCCCCCEEEECCCCCHHHHHHHHCCCCCEEEEECCC--
Q ss_conf             99999999996498389973036888744289999988762-136883241025699999998741576069751343--
Q gi|254780485|r   92 QVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGV-KSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDT--  168 (328)
Q Consensus        92 ei~~~a~~~~~~G~~~~~l~~~~~~~~~~~~~~~~e~i~~i-~~~~~~i~~~~g~~~~~~~~~Lk~aG~~~~~~~let--  168 (328)
                      ..++.|+...+.|+.+++++--......+  ..-.++++.+ ++.++.+.+.-|..+.+..+++.++|++.+.++-.+  
T Consensus        30 dP~~~A~~~~~~Ga~~lhvvDLd~A~~g~--~~n~~~I~~i~~~~~~pi~vGGGIrs~e~~~~~l~~GadkVvigS~a~~  107 (241)
T PRK00748         30 DPLAQAQAWQDQGAEWLHLVDLDGAFAGR--PVNLELIEAIVAAVDIPVQLGGGIRDLETVEAYLDAGVARVIIGTAAVK  107 (241)
T ss_pred             CHHHHHHHHHHCCCCEEEEEECCCCCCCC--CCHHHHHHHHHHHCCCCEEEECCCCCHHHHHHHHHCCCCEEEECCHHHH
T ss_conf             99999999998799989999785420288--2079999999986799999827707499999999769775886471033


Q ss_pred             CHHHHHCCCCCCCHHHHHHHHHHHHHCCCCCCCEEEECCC---CCHHHHHHHHHHHHHCCCCCCEEECCCEEECCCCCCC
Q ss_conf             7777320588889899999999999879855770786689---8999999999999740888860205411204874124
Q gi|254780485|r  169 SERFYPHVTTTHTFEDRLQTLENVRKSGIKVCCGGILGLG---EMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFE  245 (328)
Q Consensus       169 ~~~~~~~~~~~~~~~~~l~~~~~a~~~G~~~~sg~l~G~g---Et~eeri~~l~~lr~l~~~~~~v~~~~~~p~~gt~l~  245 (328)
                      .|++..++..... + ++-       +++.+--+.+.-+|   .|.-+..+++..+.+++.  ..+-+ .-+-..|| +.
T Consensus       108 n~~~i~~~~~~~g-~-~iv-------vsiD~k~~~v~~~gw~~~t~~~~~~~i~~~~~~G~--~eii~-tdI~~DGt-~~  174 (241)
T PRK00748        108 NPELVKEACKKFP-G-RIV-------VGLDARDGKVATRGWQEVSGVDLEDLAKRFEDAGV--AAIIY-TDISRDGT-LS  174 (241)
T ss_pred             CHHHHHHHHHHCC-C-CEE-------EEEEECCCEEECCCCCCCCCCCHHHHHHHHHHCCC--CEEEE-EEEECCCC-CC
T ss_conf             9689999986235-5-579-------99982166540157554679748999999985587--56999-88705685-47


Q ss_pred             CCCCCCHHHHHHHHHHHHHHCCCCCCEEEEHHHHHCHHHHHHH-H-HHCCCEEEECCEEECCCCCCHHHHHHHHHH
Q ss_conf             4568798999999999999686872142311565165689999-9-809988997786651588898999999998
Q gi|254780485|r  246 ENKKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALC-F-FSGANSIFVGDTLLTAKNPSYNKDTILFNR  319 (328)
Q Consensus       246 ~~~~~~~~e~lr~iAi~RL~lP~~~i~i~~~~~~~~~~~~~~~-L-~~GaN~~~~g~~~~t~~g~~~~~~~~~i~~  319 (328)
                         .++ .+.++-++   -..+ ..+.+++| .+-..+..++. + ..|++++++|--+ -.+.-+.+|.++-++.
T Consensus       175 ---G~d-~~l~~~i~---~~~~-ipviasGG-v~s~~Di~~L~~~~~~gv~gviiG~Al-y~g~i~l~eal~~~~~  240 (241)
T PRK00748        175 ---GPN-VELTRELA---AATP-IPVIASGG-VSSLDDIRALKALGPEGVEGVIVGKAL-YEGKFDLAEALACWQN  240 (241)
T ss_pred             ---CCC-HHHHHHHH---HHCC-CCEEEECC-CCCHHHHHHHHHCCCCCCCEEEEEHHH-HCCCCCHHHHHHHHHC
T ss_conf             ---689-99999999---8689-98999889-999999999986031792489987898-7799899999998652


No 180
>PRK09722 allulose-6-phosphate 3-epimerase; Provisional
Probab=87.03  E-value=2.4  Score=22.00  Aligned_cols=187  Identities=14%  Similarity=0.192  Sum_probs=102.5

Q ss_pred             HCCCEEEEE-ECCCCCCCC-CCHHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHCCCCCEEEEECCCCHHHHHCCCCC
Q ss_conf             649838997-303688874-428999998876213688324102569999999874157606975134377773205888
Q gi|254780485|r  102 ENGATRYCM-GAAWREPKE-RDLSIIVDMIKGVKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTT  179 (328)
Q Consensus       102 ~~G~~~~~l-~~~~~~~~~-~~~~~~~e~i~~i~~~~~~i~~~~g~~~~~~~~~Lk~aG~~~~~~~let~~~~~~~~~~~  179 (328)
                      +.|+..+++ +.-|+--+. ..-..+++.+|........+|+-+-. .+..+..+.++|++.+..-.|+...        
T Consensus        23 ~~~~d~iHiDIMDG~FVPN~tfgp~~v~~ir~~t~~p~DvHLMv~~-P~~~i~~~~~~gad~It~H~Ea~~~--------   93 (227)
T PRK09722         23 DSKADYFHIDIMDGHFVPNLTLSPFFVSQVKKLASKPLDCHLMVTR-PQDYIAQLADAGADFITLHPETING--------   93 (227)
T ss_pred             HCCCCEEEEECCCCCCCCCCCCCHHHHHHHHHCCCCCEEEEEEECC-HHHHHHHHHHCCCCEEEECHHHCCC--------
T ss_conf             7489889995616860785451865999997448996478999658-8888999985499899956565056--------


Q ss_pred             CCHHHHHHHHHHHHHCCCCCCCEEEECCCCCHHHHHHHHHHHHHCCCCCCEEECCCEEECCCCCCCCCCCCCHHHHHHHH
Q ss_conf             89899999999999879855770786689899999999999974088886020541120487412445687989999999
Q gi|254780485|r  180 HTFEDRLQTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEHVRII  259 (328)
Q Consensus       180 ~~~~~~l~~~~~a~~~G~~~~sg~l~G~gEt~eeri~~l~~lr~l~~~~~~v~~~~~~p~~gt~l~~~~~~~~~e~lr~i  259 (328)
                          .-.++++..++.|++.+  +-+-. +|.-+.++.+.  .++    +.|-++-.  .||  +.+.+-.  .+.+.-|
T Consensus        94 ----~~~~~i~~Ik~~g~k~G--lAlnP-~Tpi~~i~~~l--~~v----D~VLvMsV--~PG--f~GQ~Fi--~~~l~KI  154 (227)
T PRK09722         94 ----QAFRLIDEIRRAGMKVG--LVLNP-ETPVEAIKYYI--HLA----DKVTVMTV--DPG--FAGQPFI--PEMLDKI  154 (227)
T ss_pred             ----CHHHHHHHHHHCCCCEE--EEECC-CCCHHHHHHHH--HHC----CEEEEEEE--CCC--CCCCCCC--HHHHHHH
T ss_conf             ----59999999998699722--33389-99866887667--437----98999988--899--9876566--8899999


Q ss_pred             HHHHHHCCC----CCCEEEEHHHHHCHHHHHHHHHHCCCEEEECCEEECCCCCCHHHHHHHHHH
Q ss_conf             999996868----721423115651656899999809988997786651588898999999998
Q gi|254780485|r  260 SVARILMPK----SRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTILFNR  319 (328)
Q Consensus       260 Ai~RL~lP~----~~i~i~~~~~~~~~~~~~~~L~~GaN~~~~g~~~~t~~g~~~~~~~~~i~~  319 (328)
                      .-.|-+.+.    ..|.+-+   .+..+....+..+|||.++.|..-+=..+-+.++-++.+++
T Consensus       155 ~~lr~~~~~~~~~~~I~VDG---GI~~~~i~~~~~aGAd~~V~GssaiF~~~~~i~~~~~~l~~  215 (227)
T PRK09722        155 AELKAWREREGLEYEIEVDG---SCNQKTYEKLMAAGADVFIVGTSGLFNHAENIDEAWDIMTA  215 (227)
T ss_pred             HHHHHHHHHCCCCCEEEEEC---CCCHHHHHHHHHCCCCEEEECCHHHCCCCCCHHHHHHHHHH
T ss_conf             99999998259982699989---88899999999869999997748974899999999999999


No 181
>cd00959 DeoC 2-deoxyribose-5-phosphate aldolase (DERA) of the DeoC family. DERA belongs to the class I aldolases and catalyzes a reversible aldol reaction between acetaldehyde and glyceraldehyde 3-phosphate to generate 2-deoxyribose 5-phosphate. DERA is unique in catalyzing the aldol reaction between two aldehydes, and its broad substrate specificity confers considerable utility as a biocatalyst, offering an environmentally benign alternative to chiral transition metal catalysis of the asymmetric aldol reaction.
Probab=86.97  E-value=0.75  Score=25.37  Aligned_cols=23  Identities=26%  Similarity=0.417  Sum_probs=12.6

Q ss_pred             CCHHHHHHHHHHHHHCCCEEEEE
Q ss_conf             68579999999999649838997
Q gi|254780485|r   88 INVDQVLKEAKNAKENGATRYCM  110 (328)
Q Consensus        88 ~~~Eei~~~a~~~~~~G~~~~~l  110 (328)
                      .+.++|.+-+.++.+.|+.-+|+
T Consensus        14 ~T~~~i~~l~~~A~~~~~aaVcV   36 (203)
T cd00959          14 ATEEDIRKLCDEAKEYGFAAVCV   36 (203)
T ss_pred             CCHHHHHHHHHHHHHHCCEEEEE
T ss_conf             99999999999998759839998


No 182
>cd00423 Pterin_binding Pterin binding enzymes. This family includes dihydropteroate synthase (DHPS) and cobalamin-dependent methyltransferases such as methyltetrahydrofolate, corrinoid iron-sulfur protein methyltransferase (MeTr) and methionine synthase (MetH).  DHPS, a functional homodimer, catalyzes the condensation of p-aminobenzoic acid (pABA) in the de novo biosynthesis of folate, which is an essential cofactor in both nucleic acid and protein biosynthesis. Prokaryotes (and some lower eukaryotes) must synthesize folate de novo, while higher eukaryotes are able to utilize dietary folate and therefore lack DHPS.  Sulfonamide drugs, which are substrate analogs of pABA, target DHPS.  Cobalamin-dependent methyltransferases catalyze the transfer of a methyl group via a methyl- cob(III)amide intermediate.  These include MeTr, a functional heterodimer, and the folate binding domain of MetH.
Probab=86.78  E-value=2.5  Score=21.92  Aligned_cols=138  Identities=20%  Similarity=0.289  Sum_probs=79.5

Q ss_pred             CCCHHHHHHHHHHHHHCCCEEEEEECCC-CC-----CCCCCHHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHCCCCC
Q ss_conf             0685799999999996498389973036-88-----87442899999887621368832410256999999987415760
Q gi|254780485|r   87 LINVDQVLKEAKNAKENGATRYCMGAAW-RE-----PKERDLSIIVDMIKGVKSLGLETCMTLGMLSFEQAQILSKAGLD  160 (328)
Q Consensus        87 ~~~~Eei~~~a~~~~~~G~~~~~l~~~~-~~-----~~~~~~~~~~e~i~~i~~~~~~i~~~~g~~~~~~~~~Lk~aG~~  160 (328)
                      ..+.+.+++.|+...+.|+.-+-+++.- ++     +...+++++...++.+++. ..+.+|+-+...+.++.--++|++
T Consensus        20 ~~~~~~a~~~a~~~i~~GAdiIDIG~eSTrPg~~~i~~~eE~~Rl~pvl~~i~~~-~~v~iSIDT~~~~Va~~al~~G~~   98 (258)
T cd00423          20 FLSLDKALEHARRMVEEGADIIDIGGESTRPGAEPVSVEEELERVIPVLRALAGE-PDVPISVDTFNAEVAEAALKAGAD   98 (258)
T ss_pred             CCCHHHHHHHHHHHHHCCCCEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHHHCC-CCCEEEEECCCHHHHHHHHHCCCC
T ss_conf             7899999999999998799999979877899997477788888850056887427-996099979888999999985998


Q ss_pred             EEE-E-ECCCCHHHHHC-------C---C----CC-----CC----HH---HHH-HHHHHHHHCCCCCCCEE---EECCC
Q ss_conf             697-5-13437777320-------5---8----88-----89----89---999-99999998798557707---86689
Q gi|254780485|r  161 YYN-H-NIDTSERFYPH-------V---T----TT-----HT----FE---DRL-QTLENVRKSGIKVCCGG---ILGLG  208 (328)
Q Consensus       161 ~~~-~-~let~~~~~~~-------~---~----~~-----~~----~~---~~l-~~~~~a~~~G~~~~sg~---l~G~g  208 (328)
                      .+| + .....++..+.       +   |    |.     ..    .+   +|+ +.++.+.+.|++..-=+   -+|.|
T Consensus        99 iINDVsg~~~d~~m~~~va~~~~~~ilmH~~~~p~~~~~~~~~~~~~~~v~~~~~~~i~~~~~~Gi~~~~IiiDPGiGFg  178 (258)
T cd00423          99 IINDVSGGRGDPEMAPLAAEYGAPVVLMHMDGTPQTMQNNPYYADVVDEVVEFLEERVEAATEAGIPPEDIILDPGIGFG  178 (258)
T ss_pred             EEECCHHHHCCHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCHHEEEECCCCCCC
T ss_conf             68240031065579999997499889830578865566689866489999999999999999869993008874776778


Q ss_pred             CCHHHHHHHHHHHHHCC
Q ss_conf             89999999999997408
Q gi|254780485|r  209 EMIDDRIDMLLTLANLS  225 (328)
Q Consensus       209 Et~eeri~~l~~lr~l~  225 (328)
                      -+.++-.+.|..+..+.
T Consensus       179 K~~~~n~~ll~~l~~~~  195 (258)
T cd00423         179 KTEEHNLELLRRLDAFR  195 (258)
T ss_pred             CCHHHHHHHHHHHHHHH
T ss_conf             88788999999799997


No 183
>pfam00834 Ribul_P_3_epim Ribulose-phosphate 3 epimerase family. This enzyme catalyses the conversion of D-ribulose 5-phosphate into D-xylulose 5-phosphate.
Probab=86.72  E-value=2.5  Score=21.90  Aligned_cols=181  Identities=16%  Similarity=0.223  Sum_probs=99.9

Q ss_pred             HHHHHHHHHHHHHCCCEEEEE-ECCCCCCCCCCH-HHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHCCCCCEEEEECC
Q ss_conf             579999999999649838997-303688874428-999998876213688324102569999999874157606975134
Q gi|254780485|r   90 VDQVLKEAKNAKENGATRYCM-GAAWREPKERDL-SIIVDMIKGVKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNID  167 (328)
Q Consensus        90 ~Eei~~~a~~~~~~G~~~~~l-~~~~~~~~~~~~-~~~~e~i~~i~~~~~~i~~~~g~~~~~~~~~Lk~aG~~~~~~~le  167 (328)
                      .-.+.++.+.+.+.|+..+++ +.-|+--+...+ -..++.+|........+|+-+-. .+..+..+.++|++.+..-.|
T Consensus        11 ~~~l~~~i~~l~~~g~d~iHiDimDG~FVpn~t~g~~~i~~ir~~t~~~~DvHLMv~~-P~~~i~~~~~~g~d~i~~H~E   89 (201)
T pfam00834        11 FAHLGEEIKAVENAGADWLHVDVMDGHFVPNLTIGPLVVEALRPLTELPLDVHLMVEE-PDRIIPDFAEAGADIISFHAE   89 (201)
T ss_pred             HHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCHHHHHHHHHCCCCCEEEEEEEEC-HHHHHHHHHHCCCCEEEECHH
T ss_conf             9999999999997699989982767972775555877999998638996389999837-766399998739988997544


Q ss_pred             CCHHHHHCCCCCCCHHHHHHHHHHHHHCCCCCCCEEEECCCCCHHHHHHHHHHHHHCCCCCCEEECCCEEECCCCCCCCC
Q ss_conf             37777320588889899999999999879855770786689899999999999974088886020541120487412445
Q gi|254780485|r  168 TSERFYPHVTTTHTFEDRLQTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEEN  247 (328)
Q Consensus       168 t~~~~~~~~~~~~~~~~~l~~~~~a~~~G~~~~sg~l~G~gEt~eeri~~l~~lr~l~~~~~~v~~~~~~p~~gt~l~~~  247 (328)
                      +.+             +..++++..++.|+++  |+-+-.. |.-+.++.+  |..+    +.|-++-.  .||  +.+.
T Consensus        90 ~~~-------------~~~~~i~~ik~~g~k~--GlAlnP~-T~~~~l~~~--l~~i----D~VLvMtV--~PG--f~GQ  143 (201)
T pfam00834        90 ASD-------------HPHRTIQLIKEAGAKA--GLVLNPA-TPLDAIEYL--LDDL----DLVLLMSV--NPG--FGGQ  143 (201)
T ss_pred             HHH-------------CHHHHHHHHHHCCCEE--EEEECCC-CCCHHHHHH--HHHC----CEEEEEEE--CCC--CCCC
T ss_conf             413-------------7999999998649726--8885699-860288876--7427----98999886--689--8876


Q ss_pred             CCCCHHHHHHHHHHHHHHCCC----CCCEEEEHHHHHCHHHHHHHHHHCCCEEEECCEE
Q ss_conf             687989999999999996868----7214231156516568999998099889977866
Q gi|254780485|r  248 KKVDPIEHVRIISVARILMPK----SRLRLAAGRAMMSDELQALCFFSGANSIFVGDTL  302 (328)
Q Consensus       248 ~~~~~~e~lr~iAi~RL~lP~----~~i~i~~~~~~~~~~~~~~~L~~GaN~~~~g~~~  302 (328)
                      +-  -...+.-|.-+|-+.|.    ..|.+-+   .+..+.......+|||.++.|.++
T Consensus       144 ~f--~~~~l~KI~~lr~~~~~~~~~~~I~vDG---GIn~~ti~~l~~~Gad~~V~GSai  197 (201)
T pfam00834       144 SF--IPSVLPKIRKVRKMIDEGGLDTLIEVDG---GVNLDNIPQIAEAGADVLVAGSAV  197 (201)
T ss_pred             CC--CHHHHHHHHHHHHHHHHCCCCEEEEEEC---CCCHHHHHHHHHCCCCEEEECCEE
T ss_conf             45--6779999999999998269980799989---888999999998799999978002


No 184
>COG0107 HisF Imidazoleglycerol-phosphate synthase [Amino acid transport and metabolism]
Probab=86.65  E-value=2.5  Score=21.87  Aligned_cols=208  Identities=14%  Similarity=0.193  Sum_probs=103.0

Q ss_pred             HHHHHHHHHHHHCCCEEEEEECCCCCCCCCCHHHHHHHHHHH-CCCCCCEEEECCCCCHHHHHHHHCCCCCEEEEECCC-
Q ss_conf             799999999996498389973036888744289999988762-136883241025699999998741576069751343-
Q gi|254780485|r   91 DQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGV-KSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDT-  168 (328)
Q Consensus        91 Eei~~~a~~~~~~G~~~~~l~~~~~~~~~~~~~~~~e~i~~i-~~~~~~i~~~~g~~~~~~~~~Lk~aG~~~~~~~let-  168 (328)
                      =..++.|+...+.|+-++++.--.-....  -+-..+.++.. ...++.+++--|..+.+.++++..+|+|-+.+|--. 
T Consensus        30 GDpVelA~~Y~e~GADElvFlDItAs~~g--r~~~~~vv~~~A~~vfiPltVGGGI~s~eD~~~ll~aGADKVSINsaAv  107 (256)
T COG0107          30 GDPVELAKRYNEEGADELVFLDITASSEG--RETMLDVVERVAEQVFIPLTVGGGIRSVEDARKLLRAGADKVSINSAAV  107 (256)
T ss_pred             CCHHHHHHHHHHCCCCEEEEEECCCCCCC--CCCHHHHHHHHHHHCEEEEEECCCCCCHHHHHHHHHCCCCEEEECHHHH
T ss_conf             89499999997759976999862256566--6207999999973030324754775888999999976997465284675


Q ss_pred             -CHHHHHCCCCCC-------CHHHHHHHHHHHHHCCCCCCCEEEECCC---CCHHHHHHHHHHHHHCCCCCCEEECCCEE
Q ss_conf             -777732058888-------9899999999999879855770786689---89999999999997408888602054112
Q gi|254780485|r  169 -SERFYPHVTTTH-------TFEDRLQTLENVRKSGIKVCCGGILGLG---EMIDDRIDMLLTLANLSTPPESIPINLLI  237 (328)
Q Consensus       169 -~~~~~~~~~~~~-------~~~~~l~~~~~a~~~G~~~~sg~l~G~g---Et~eeri~~l~~lr~l~~~~~~v~~~~~~  237 (328)
                       .|++-.+.-...       +-+-|.+.      -| ..+....+=+|   .|--+.++-.....+++.  ..+-++-. 
T Consensus       108 ~~p~lI~~~a~~FGsQciVvaIDakr~~------~g-~~~~~~v~~~gGr~~t~~d~~eWa~~~e~~GA--GEIlLtsm-  177 (256)
T COG0107         108 KDPELITEAADRFGSQCIVVAIDAKRVP------DG-ENGWYEVFTHGGREDTGLDAVEWAKEVEELGA--GEILLTSM-  177 (256)
T ss_pred             CCHHHHHHHHHHHCCCEEEEEEEEEECC------CC-CCCCEEEEECCCCCCCCCCHHHHHHHHHHCCC--CEEEEEEE-
T ss_conf             0959999999983881299998755426------89-98767999668975688579999999997388--54878635-


Q ss_pred             ECCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCE-E-EEHHHHHCHHHHHHHHHHC-CCEEEECCEEECCCCCCHHHHH
Q ss_conf             04874124456879899999999999968687214-2-3115651656899999809-9889977866515888989999
Q gi|254780485|r  238 PIPGSKFEENKKVDPIEHVRIISVARILMPKSRLR-L-AAGRAMMSDELQALCFFSG-ANSIFVGDTLLTAKNPSYNKDT  314 (328)
Q Consensus       238 p~~gt~l~~~~~~~~~e~lr~iAi~RL~lP~~~i~-i-~~~~~~~~~~~~~~~L~~G-aN~~~~g~~~~t~~g~~~~~~~  314 (328)
                      -..||     ...-+.+.++.++      ..+.|+ | |+|-.++ .++.+ ++..| |+..+... +-.-+..++.+..
T Consensus       178 D~DGt-----k~GyDl~l~~~v~------~~v~iPvIASGGaG~~-ehf~e-af~~~~adAaLAAs-iFH~~~~~i~evK  243 (256)
T COG0107         178 DRDGT-----KAGYDLELTRAVR------EAVNIPVIASGGAGKP-EHFVE-AFTEGKADAALAAS-IFHFGEITIGEVK  243 (256)
T ss_pred             CCCCC-----CCCCCHHHHHHHH------HHCCCCEEECCCCCCH-HHHHH-HHHHCCCHHHHHHH-HHHCCCCCHHHHH
T ss_conf             56565-----3675799999999------6488788911898968-89999-99815700887644-3314745499999


Q ss_pred             HHHHHCCCCC
Q ss_conf             9999829853
Q gi|254780485|r  315 ILFNRLGLIP  324 (328)
Q Consensus       315 ~~i~~~G~~P  324 (328)
                      +-+++.|..-
T Consensus       244 ~yl~~~gi~V  253 (256)
T COG0107         244 EYLAEQGIEV  253 (256)
T ss_pred             HHHHHCCCCC
T ss_conf             9999859862


No 185
>PRK00278 trpC indole-3-glycerol-phosphate synthase; Reviewed
Probab=85.93  E-value=2.7  Score=21.63  Aligned_cols=188  Identities=18%  Similarity=0.133  Sum_probs=107.4

Q ss_pred             HHHHHHHHHHHCCCEEEEEECCCCCCCCCCHHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHCCCCCEEEEECCCCHH
Q ss_conf             99999999996498389973036888744289999988762136883241025699999998741576069751343777
Q gi|254780485|r   92 QVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSER  171 (328)
Q Consensus        92 ei~~~a~~~~~~G~~~~~l~~~~~~~~~~~~~~~~e~i~~i~~~~~~i~~~~g~~~~~~~~~Lk~aG~~~~~~~let~~~  171 (328)
                      ...+.|+...+.|+.-+.+.+- ...+...++++.. ++..  ..+.+...-+..++.+...-+.+|+|.+.+-...   
T Consensus        71 dp~~~A~~Y~~~GA~aiSVLTe-~~~F~Gs~~~L~~-vr~~--~~lPiLrKDFIid~~QI~ea~~~GADaiLLI~~~---  143 (261)
T PRK00278         71 DPVEIAKAYEEGGAACLSVLTD-ERFFQGSFEYLRA-ARAA--VSLPVLRKDFIIDPYQIYEARAAGADAILLIVAA---  143 (261)
T ss_pred             CHHHHHHHHHHCCCCEEEEEEC-CCCCCCCHHHHHH-HHHH--CCCCEEEEHEECCHHHHHHHHHCCCCCHHHHHHH---
T ss_conf             9999999999779968999513-0324887999999-9986--6998772010176999999998189857898875---


Q ss_pred             HHHCCCCCCCHHHHHHHHHHHHHCCCCCCCEEEECCCCCHHHHHHHHHHHHHCCCCCCEEECCCEEECCCCCCCCCCCCC
Q ss_conf             73205888898999999999998798557707866898999999999999740888860205411204874124456879
Q gi|254780485|r  172 FYPHVTTTHTFEDRLQTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVD  251 (328)
Q Consensus       172 ~~~~~~~~~~~~~~l~~~~~a~~~G~~~~sg~l~G~gEt~eeri~~l~~lr~l~~~~~~v~~~~~~p~~gt~l~~~~~~~  251 (328)
                              -+.++--+..+.|+++|+.+    ++-. .+.+|    +.+..+++.  .-+.+|...      +.. -..+
T Consensus       144 --------L~~~~l~~l~~~a~~lgl~~----LvEv-h~~~E----l~~a~~~~a--~iIGINnRn------L~t-~~vd  197 (261)
T PRK00278        144 --------LDDEQLKELLDLAHELGLDV----LVEV-HDEEE----LERALKLGA--PLIGINNRN------LKT-FEVD  197 (261)
T ss_pred             --------CCHHHHHHHHHHHHHHCCEE----EEEE-CCHHH----HHHHHHCCC--CEEEEECCC------CHH-CEEC
T ss_conf             --------58999999999999829907----9776-89999----999984799--889874677------112-0037


Q ss_pred             HHHHHHHHHHHHHHCCCCCCEEEEHHHHHCHHHHHHHHHHCCCEEEECCEEECCCCCCHHHHHHHHHH
Q ss_conf             89999999999996868721423115651656899999809988997786651588898999999998
Q gi|254780485|r  252 PIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTILFNR  319 (328)
Q Consensus       252 ~~e~lr~iAi~RL~lP~~~i~i~~~~~~~~~~~~~~~L~~GaN~~~~g~~~~t~~g~~~~~~~~~i~~  319 (328)
                      ..   ++..++. ++|...+.++-|=.+- ++-......+|+|++++|+.++++..  +.+..+-+..
T Consensus       198 ~~---~~~~L~~-~ip~~~~~VsESGI~~-~~d~~~l~~~G~davLIGeslm~~~d--p~~~l~~L~~  258 (261)
T PRK00278        198 LD---TTERLAP-LIPKDRLLVSESGIFT-PEDLKRLAKAGADAFLVGESLMRADD--PGAALRELFG  258 (261)
T ss_pred             HH---HHHHHHH-HCCCCCEEEECCCCCC-HHHHHHHHHCCCCEEEECHHHHCCCC--HHHHHHHHHH
T ss_conf             89---9999996-4899988997999999-99999999779999998978767999--8999999970


No 186
>cd00452 KDPG_aldolase KDPG and KHG aldolase. This family belongs to the class I adolases whose reaction mechanism involves Schiff base formation between a substrate carbonyl and lysine residue in the active site. 2-keto-3-deoxy-6-phosphogluconate (KDPG) aldolase,  is best known for its role in the Entner-Doudoroff pathway of bacteria, where it catalyzes the reversible cleavage of KDPG to pyruvate and glyceraldehyde-3-phosphate. 2-keto-4-hydroxyglutarate (KHG) aldolase, which has enzymatic specificity toward glyoxylate, forming KHG in the presence of pyruvate, and is capable of regulating glyoxylate levels in the glyoxylate bypass, an alternate pathway when bacteria are grown on acetate carbon sources.
Probab=85.57  E-value=2.8  Score=21.51  Aligned_cols=163  Identities=19%  Similarity=0.234  Sum_probs=100.3

Q ss_pred             CCCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCCCCHHHHHHHHHHHCCCCCCEEEECCC-CCHHHHHHHHCCCCCEEE
Q ss_conf             0006857999999999964983899730368887442899999887621368832410256-999999987415760697
Q gi|254780485|r   85 SKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLGLETCMTLGM-LSFEQAQILSKAGLDYYN  163 (328)
Q Consensus        85 ~~~~~~Eei~~~a~~~~~~G~~~~~l~~~~~~~~~~~~~~~~e~i~~i~~~~~~i~~~~g~-~~~~~~~~Lk~aG~~~~~  163 (328)
                      .+..+.++.+..++.+.+.|++-+-+...  .+.      -.+.++.+++..+.+.+-+|. ++.+++....++|++.+.
T Consensus        10 lr~~~~~~a~~~~~al~~~Gi~~iEitl~--t~~------a~~~i~~l~~~~~~~~iGaGTV~~~~~~~~a~~aGa~Fiv   81 (190)
T cd00452          10 LRGDDAEDALALAEALIEGGIRAIEITLR--TPG------ALEAIRALRKEFPEALIGAGTVLTPEQADAAIAAGAQFIV   81 (190)
T ss_pred             EECCCHHHHHHHHHHHHHCCCCEEEEECC--CCH------HHHHHHHHHHHCCCCEEEECCCCCHHHHHHHHHCCCCEEE
T ss_conf             97799999999999999869988999678--802------9999999998689808965234779999999985998997


Q ss_pred             EECCCCHHHHHCCCCCCCHHHHHHHHHHHHHCCCCCCCEEEECCCCCHHHHHHHHHHHHHCCCCCCEEECCCEEECCCCC
Q ss_conf             51343777732058888989999999999987985577078668989999999999997408888602054112048741
Q gi|254780485|r  164 HNIDTSERFYPHVTTTHTFEDRLQTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSK  243 (328)
Q Consensus       164 ~~let~~~~~~~~~~~~~~~~~l~~~~~a~~~G~~~~sg~l~G~gEt~eeri~~l~~lr~l~~~~~~v~~~~~~p~~gt~  243 (328)
                           +|.        .+    -++++.+++.|++.-.|.+     |+-|...-+    +.+.  ..+-   |+|..  .
T Consensus        82 -----sP~--------~~----~~v~~~a~~~~~~~iPGv~-----TpsEi~~A~----~~G~--~~vK---~FPa~--~  128 (190)
T cd00452          82 -----SPG--------LD----PEVVKAANRAGIPLLPGVA-----TPTEIMQAL----ELGA--DIVK---LFPAE--A  128 (190)
T ss_pred             -----CCC--------CC----HHHHHHHHHCCCCEECCCC-----CHHHHHHHH----HCCC--CEEE---ECCCC--C
T ss_conf             -----377--------99----9999999982996657879-----999999999----8799--9899---89551--1


Q ss_pred             CCCCCCCCHHHHHHHHHHHHHHCCCCCCEEEEHHHHHCHHHHHHHHHHCCCEEEECCE
Q ss_conf             2445687989999999999996868721423115651656899999809988997786
Q gi|254780485|r  244 FEENKKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDT  301 (328)
Q Consensus       244 l~~~~~~~~~e~lr~iAi~RL~lP~~~i~i~~~~~~~~~~~~~~~L~~GaN~~~~g~~  301 (328)
                            ..+ .++|.   .+=.+|+..+. .+|=.  ..+....-|.+|+...-.|..
T Consensus       129 ------~G~-~~lka---l~~pfp~~~~~-ptGGI--~~~N~~~yl~~gv~avG~g~~  173 (190)
T cd00452         129 ------VGP-AYIKA---LKGPFPQVRFM-PTGGV--SLDNAAEWLAAGVVAVGGGSL  173 (190)
T ss_pred             ------CCH-HHHHH---HHCCCCCCCEE-EECCC--CHHHHHHHHHCCCEEEEECHH
T ss_conf             ------499-99999---85548999389-96799--988899999689989995412


No 187
>COG3589 Uncharacterized conserved protein [Function unknown]
Probab=85.52  E-value=2.8  Score=21.50  Aligned_cols=113  Identities=17%  Similarity=0.195  Sum_probs=69.9

Q ss_pred             CHHHHHHHHHHHHHCCCEEEEEECCCCCC-CCCCHHHHHHHHHHHCCCCCCEEEECCCC-------CHHHHHHHHCCCCC
Q ss_conf             85799999999996498389973036888-74428999998876213688324102569-------99999987415760
Q gi|254780485|r   89 NVDQVLKEAKNAKENGATRYCMGAAWREP-KERDLSIIVDMIKGVKSLGLETCMTLGML-------SFEQAQILSKAGLD  160 (328)
Q Consensus        89 ~~Eei~~~a~~~~~~G~~~~~l~~~~~~~-~~~~~~~~~e~i~~i~~~~~~i~~~~g~~-------~~~~~~~Lk~aG~~  160 (328)
                      ..|+.....+.+.+.|++++........+ ....+.++.++++..+..++.+.+-+.+.       +...+..+++.|++
T Consensus        14 ~~~~~~~Yi~~~~~~Gf~~IFtsl~~~~~~~~~~~~~~~ell~~Anklg~~vivDvnPsil~~l~~S~~~l~~f~e~G~~   93 (360)
T COG3589          14 PKEKDIAYIDRMHKYGFKRIFTSLLIPEEDAELYFHRFKELLKEANKLGLRVIVDVNPSILKELNISLDNLSRFQELGVD   93 (360)
T ss_pred             CCHHHHHHHHHHHHCCCCCEEEECCCCCCHHHHHHHHHHHHHHHHHHCCCEEEEECCHHHHHHCCCCHHHHHHHHHHHHH
T ss_conf             61667999999987380113442666883277899999999999986596899974877775527986778999873113


Q ss_pred             EEEEECCCC-----------------------------------------HHHHHCCCCCCCHHHHHHHHHHHHHCCCCC
Q ss_conf             697513437-----------------------------------------777320588889899999999999879855
Q gi|254780485|r  161 YYNHNIDTS-----------------------------------------ERFYPHVTTTHTFEDRLQTLENVRKSGIKV  199 (328)
Q Consensus       161 ~~~~~let~-----------------------------------------~~~~~~~~~~~~~~~~l~~~~~a~~~G~~~  199 (328)
                      .+-+....+                                         -.+|+.--++-|++..++.-+..|+.|+++
T Consensus        94 glRlD~gfS~eei~~ms~~~lkieLN~S~it~~l~~l~~~~an~~nl~~cHNyYPr~yTGLS~e~f~~kn~~fk~~~i~t  173 (360)
T COG3589          94 GLRLDYGFSGEEIAEMSKNPLKIELNASTITELLDSLLAYKANLENLEGCHNYYPRPYTGLSREHFKRKNEIFKEYNIKT  173 (360)
T ss_pred             HEEECCCCCHHHHHHHHCCCEEEEECHHHHHHHHHHHHHHCCCHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCE
T ss_conf             26523668888999972588089973425189999999735355542001045688666746999999889988559745


Q ss_pred             CC
Q ss_conf             77
Q gi|254780485|r  200 CC  201 (328)
Q Consensus       200 ~s  201 (328)
                      .+
T Consensus       174 ~A  175 (360)
T COG3589         174 AA  175 (360)
T ss_pred             EE
T ss_conf             89


No 188
>PRK06552 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional
Probab=85.50  E-value=2.8  Score=21.49  Aligned_cols=182  Identities=18%  Similarity=0.203  Sum_probs=110.5

Q ss_pred             CCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCCCCHHHHHHHHHHHCCCCCCEEEECCC-CCHHHHHHHHCCCCCEEEE
Q ss_conf             006857999999999964983899730368887442899999887621368832410256-9999999874157606975
Q gi|254780485|r   86 KLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLGLETCMTLGM-LSFEQAQILSKAGLDYYNH  164 (328)
Q Consensus        86 ~~~~~Eei~~~a~~~~~~G~~~~~l~~~~~~~~~~~~~~~~e~i~~i~~~~~~i~~~~g~-~~~~~~~~Lk~aG~~~~~~  164 (328)
                      +..+.|+.+..++.+.+.|++-+-+..  +.+.   ....++.++......+.+.+-+|. ++.++++...++|++.+. 
T Consensus        20 r~~~~~~a~~~~~al~~gGi~~iEITl--~tp~---a~~~i~~l~~~~~~~p~~~iGaGTV~~~e~~~~a~~aGA~FiV-   93 (209)
T PRK06552         20 RGESKEEALKISLAVIKGGIKAIEVTY--TNPF---ASEVIKELVERYKDDPEVLIGAGTVLDAVTARQAILAGAQFIV-   93 (209)
T ss_pred             ECCCHHHHHHHHHHHHHCCCCEEEEEC--CCCC---HHHHHHHHHHHHCCCCCEEEEEECCCCHHHHHHHHHCCCCEEE-
T ss_conf             728999999999999987998899967--8975---9999999999817799818988727489999999985998897-


Q ss_pred             ECCCCHHHHHCCCCCCCHHHHHHHHHHHHHCCCCCCCEEEECCCCCHHHHHHHHHHHHHCCCCCCEEECCCEEECCCCCC
Q ss_conf             13437777320588889899999999999879855770786689899999999999974088886020541120487412
Q gi|254780485|r  165 NIDTSERFYPHVTTTHTFEDRLQTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKF  244 (328)
Q Consensus       165 ~let~~~~~~~~~~~~~~~~~l~~~~~a~~~G~~~~sg~l~G~gEt~eeri~~l~~lr~l~~~~~~v~~~~~~p~~gt~l  244 (328)
                          +|        ..+    .++++.+++.|++.-.|.+     |+-|...-+    +++.  ..+-   ++|  ... 
T Consensus        94 ----SP--------~~~----~~v~~~a~~~~i~~iPG~~-----TpsEi~~A~----~~Ga--~~vK---lFP--A~~-  140 (209)
T PRK06552         94 ----SP--------SFN----RETAKICNRYQIPYLPGCM-----TVTEIVTAL----EAGV--DIVK---LFP--GST-  140 (209)
T ss_pred             ----CC--------CCC----HHHHHHHHHCCCCEECCCC-----CHHHHHHHH----HCCC--CEEE---ECC--HHH-
T ss_conf             ----69--------998----9999999985996417979-----999999999----8699--9588---583--332-


Q ss_pred             CCCCCCCHHHHHHHHHHHHHHCCCCCCEEEEHHHHHCHHHHHHHHHHCCCEEEECCEEECCC-CCCHHHHHHHHH
Q ss_conf             44568798999999999999686872142311565165689999980998899778665158-889899999999
Q gi|254780485|r  245 EENKKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAK-NPSYNKDTILFN  318 (328)
Q Consensus       245 ~~~~~~~~~e~lr~iAi~RL~lP~~~i~i~~~~~~~~~~~~~~~L~~GaN~~~~g~~~~t~~-g~~~~~~~~~i~  318 (328)
                           ..+ .|+|-+   |=.+|+..+.-++|   +..+....-|.+|++..-+|.+++.-. ....+++.+..+
T Consensus       141 -----~G~-~yikal---~~p~p~~~~~ptGG---V~~~N~~~~l~aG~~~vgvGs~l~~~~~~~d~~~I~~~A~  203 (209)
T PRK06552        141 -----VGP-SFISAI---KGPLPQVNIMVTGG---VSLDNVKDWFAAGADAVGIGGELNKLASQGDYDLITEKAA  203 (209)
T ss_pred             -----CCH-HHHHHH---HCCCCCCCEEECCC---CCHHHHHHHHHCCCCEEEECHHHCCCHHCCCHHHHHHHHH
T ss_conf             -----489-999998---66489992886389---9988899999879988998657708254189999999999


No 189
>TIGR00007 TIGR00007 phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase; InterPro: IPR006063   1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase (5.3.1.16 from EC), also known as Phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase or HisA, catalyses the fourth step in histidine biosynthesis. HisA from Lactococcus lactis was found to be inactive . The putative HisA from Thermotoga maritima, is a conspicuous outlier to the set of all other HisA, including experimental HisA from the bacterium E. coli and the Archaeaon Methanococcus voltae. Neighbor joining shows HisA from Thermotoga maritima to be within the HisA family (with HisF as an outgroup) but with a long branch. ; GO: 0003949 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino]imidazole-4-carboxamide isomerase activity, 0000105 histidine biosynthetic process.
Probab=85.47  E-value=2.9  Score=21.48  Aligned_cols=182  Identities=20%  Similarity=0.207  Sum_probs=96.8

Q ss_pred             CHHHHHHHHHHHHH-CCCEEEEEECCCCCCCCCCHHHHHHHHHHHC-CCCCCEEEECCCCCHHHHHHHHCCCCCEEEEEC
Q ss_conf             85799999999996-4983899730368887442899999887621-368832410256999999987415760697513
Q gi|254780485|r   89 NVDQVLKEAKNAKE-NGATRYCMGAAWREPKERDLSIIVDMIKGVK-SLGLETCMTLGMLSFEQAQILSKAGLDYYNHNI  166 (328)
Q Consensus        89 ~~Eei~~~a~~~~~-~G~~~~~l~~~~~~~~~~~~~~~~e~i~~i~-~~~~~i~~~~g~~~~~~~~~Lk~aG~~~~~~~l  166 (328)
                      ..+...+.|+.-.+ +|++.+|+| -...-... -..-.++|+.|. ....+|.+-=|..+.+..++|.++|++++.+.=
T Consensus        26 y~d~P~~~A~~~~~~~GA~~iHvV-DLDGA~~g-~~~N~~~i~~I~~~~~~~vQvGGGIRs~e~v~~ll~~Gv~RVI~GT  103 (241)
T TIGR00007        26 YSDDPVEAAKKWEEFQGAKRIHVV-DLDGALEG-GPVNLEVIKKIVEELGVPVQVGGGIRSLEDVEKLLDLGVDRVIIGT  103 (241)
T ss_pred             EECCHHHHHHHHHHCCCCCEEEEE-ECCHHHCC-CCCHHHHHHHHHHHCCCCEEECCCCCCHHHHHHHHHCCCCEEEEEE
T ss_conf             308989999999841697159998-45100068-6200789999998618517981751688999999973985799733


Q ss_pred             CC--CHHHHHCCCCCCCHHHHHHHHHHHHHC-------CCCCCCE-----E-EE-C-CCCCHHHHHHHHHHHHHCC-CCC
Q ss_conf             43--777732058888989999999999987-------9855770-----7-86-6-8989999999999997408-888
Q gi|254780485|r  167 DT--SERFYPHVTTTHTFEDRLQTLENVRKS-------GIKVCCG-----G-IL-G-LGEMIDDRIDMLLTLANLS-TPP  228 (328)
Q Consensus       167 et--~~~~~~~~~~~~~~~~~l~~~~~a~~~-------G~~~~sg-----~-l~-G-~gEt~eeri~~l~~lr~l~-~~~  228 (328)
                      =.  .|+++.               +.+++.       |+..--|     . .+ | .-+|.-..++.+.++.+++ .. 
T Consensus       104 ~A~~~~~~v~---------------~~~~~~g~~~i~V~lD~~~g~~G~~~V~v~GW~E~s~~~~~~~~~~~~~~G~~~-  167 (241)
T TIGR00007       104 AAVENPDLVK---------------ELLKEYGPERIVVSLDARDGEEGVKEVAVKGWKEKSEVSLEELAKRLEELGELE-  167 (241)
T ss_pred             EEECCHHHHH---------------HHHHHHCCCCEEEEEEEECCCCCEEEEEEEEEECCCCCCHHHHHHHHHHCCCCC-
T ss_conf             2210869999---------------999984899659998631488751788874041135627999999985158633-


Q ss_pred             CEEECCCEEECCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCEEEEHHHHHCHHHHHHHHH--HCCCEEEECC
Q ss_conf             60205411204874124456879899999999999968687214231156516568999998--0998899778
Q gi|254780485|r  229 ESIPINLLIPIPGSKFEENKKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFF--SGANSIFVGD  300 (328)
Q Consensus       229 ~~v~~~~~~p~~gt~l~~~~~~~~~e~lr~iAi~RL~lP~~~i~i~~~~~~~~~~~~~~~L~--~GaN~~~~g~  300 (328)
                       ++- .-=+-..||-.-..-.++. +..+       -+++..+..|+| ++--.|.+.+ =.  .|+.++++|-
T Consensus       168 -~ii-~TdI~~DGtl~G~n~~~~~-~~~~-------~~~~~~viaSGG-v~s~~D~~~L-~~~~~G~~GvIvGk  229 (241)
T TIGR00007       168 -GII-YTDISRDGTLSGPNFELTK-ELVK-------ALVNVPVIASGG-VSSIDDLRAL-KEIELGVYGVIVGK  229 (241)
T ss_pred             -EEE-EEEEECCCCEECCCCCHHH-HHHH-------HHCCCEEEEECC-CCCHHHHHHH-HHCCCCCCEEEEEE
T ss_conf             -689-9752006720078732889-9998-------735841899426-5788999999-97159832799862


No 190
>PRK05718 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional
Probab=84.76  E-value=3.1  Score=21.27  Aligned_cols=181  Identities=16%  Similarity=0.172  Sum_probs=102.5

Q ss_pred             CCCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCCCCHHHHHHHHHHHCCCCCCEEEECCC-CCHHHHHHHHCCCCCEEE
Q ss_conf             0006857999999999964983899730368887442899999887621368832410256-999999987415760697
Q gi|254780485|r   85 SKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLGLETCMTLGM-LSFEQAQILSKAGLDYYN  163 (328)
Q Consensus        85 ~~~~~~Eei~~~a~~~~~~G~~~~~l~~~~~~~~~~~~~~~~e~i~~i~~~~~~i~~~~g~-~~~~~~~~Lk~aG~~~~~  163 (328)
                      .+..+.|+....++.+.+.|++-+-+..  +.+.      -.+.|+.+++..+.+.+-+|. ++.+++++..++|++.+.
T Consensus        21 lr~~~~~~a~~i~~al~~gGi~~iEiTl--~tp~------a~~~I~~l~~~~p~~~vGaGTV~~~e~~~~a~~aGA~FiV   92 (212)
T PRK05718         21 IVINKLEDAVPLAKALVAGGLPVLEVTL--RTPA------ALEAIRAIRKEVPEALIGAGTVLNPEQLAQAIEAGAQFIV   92 (212)
T ss_pred             EECCCHHHHHHHHHHHHHCCCCEEEEEC--CCCH------HHHHHHHHHHHCCCCEEEEEEECCHHHHHHHHHCCCCEEE
T ss_conf             9748999999999999987997899957--8961------9999999997589817965331348899999984998998


Q ss_pred             EECCCCHHHHHCCCCCCCHHHHHHHHHHHHHCCCCCCCEEEECCCCCHHHHHHHHHHHHHCCCCCCEEECCCEEECCCCC
Q ss_conf             51343777732058888989999999999987985577078668989999999999997408888602054112048741
Q gi|254780485|r  164 HNIDTSERFYPHVTTTHTFEDRLQTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSK  243 (328)
Q Consensus       164 ~~let~~~~~~~~~~~~~~~~~l~~~~~a~~~G~~~~sg~l~G~gEt~eeri~~l~~lr~l~~~~~~v~~~~~~p~~gt~  243 (328)
                           +|        ..+    .++++.+++.|++.-.|.+     |+-|...-+    +.+.  +.+-   |+|..   
T Consensus        93 -----SP--------~~~----~~v~~~a~~~~i~~iPGv~-----TpsEi~~A~----~~G~--~~vK---~FPA~---  138 (212)
T PRK05718         93 -----SP--------GLT----PPLLKACQDGPIPLIPGVN-----TPSELMLAM----ELGL--RTFK---FFPAE---  138 (212)
T ss_pred             -----CC--------CCC----HHHHHHHHHCCCCEECCCC-----CHHHHHHHH----HCCC--CEEE---ECCCC---
T ss_conf             -----48--------998----9999999981997657869-----999999999----8799--9899---78761---


Q ss_pred             CCCCCCCCHHHHHHHHHHHHHHCCCCCCEEEEHHHHHCHHHHHHHHHHCCCEEEECCEEECCC----CCCHHHHHHHHHH
Q ss_conf             244568798999999999999686872142311565165689999980998899778665158----8898999999998
Q gi|254780485|r  244 FEENKKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAK----NPSYNKDTILFNR  319 (328)
Q Consensus       244 l~~~~~~~~~e~lr~iAi~RL~lP~~~i~i~~~~~~~~~~~~~~~L~~GaN~~~~g~~~~t~~----g~~~~~~~~~i~~  319 (328)
                           ....-.++|.   .|=-+|+..+.-++| +  ..+...--| ..+|..-.|+..+..+    ....+++.+..++
T Consensus       139 -----~~gG~~~lka---l~~p~p~i~~~ptGG-V--~~~N~~~yl-~~~~v~avgGS~l~~~~~v~~~d~~~I~~~a~~  206 (212)
T PRK05718        139 -----ASGGVKMLKA---LAGPFSDVRFCPTGG-I--SPANYRDYL-ALPNVLCIGGSWMVPKDAIENGDWDRITRLARE  206 (212)
T ss_pred             -----CCCCHHHHHH---HHCCCCCCEEEECCC-C--CHHHHHHHH-CCCCEEEEECHHHCCHHHHHCCCHHHHHHHHHH
T ss_conf             -----0179999999---856589982886599-8--987899998-178869998735289999864899999999999


No 191
>cd00739 DHPS DHPS subgroup of Pterin binding enzymes. DHPS (dihydropteroate synthase), a functional homodimer, catalyzes the condensation of p-aminobenzoic acid (pABA) in the de novo biosynthesis of folate, which is an essential cofactor in both nucleic acid and protein biosynthesis. Prokaryotes (and some lower eukaryotes) must synthesize folate de novo, while higher eukaryotes are able to utilize dietary folate and therefore lack DHPS.  Sulfonamide drugs, which are substrate analogs of pABA, target DHPS.
Probab=84.19  E-value=3.2  Score=21.11  Aligned_cols=138  Identities=17%  Similarity=0.284  Sum_probs=85.7

Q ss_pred             CCCHHHHHHHHHHHHHCCCEEEEEECCC-CC-----CCCCCHHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHCCCCC
Q ss_conf             0685799999999996498389973036-88-----87442899999887621368832410256999999987415760
Q gi|254780485|r   87 LINVDQVLKEAKNAKENGATRYCMGAAW-RE-----PKERDLSIIVDMIKGVKSLGLETCMTLGMLSFEQAQILSKAGLD  160 (328)
Q Consensus        87 ~~~~Eei~~~a~~~~~~G~~~~~l~~~~-~~-----~~~~~~~~~~e~i~~i~~~~~~i~~~~g~~~~~~~~~Lk~aG~~  160 (328)
                      ..+.+++++.+++..+.|+.-+-+++-- ++     +...+++++...++.+++.. .+.+|+-+...+.+++--++|++
T Consensus        20 ~~~~~~a~~~a~~~i~~GAdiIDIGaeSTrPg~~~is~~eE~~Rl~pvi~~l~~~~-~~~iSIDT~~~~Va~~al~~Ga~   98 (257)
T cd00739          20 FLSLDKAVAHAEKMIAEGADIIDIGGESTRPGADPVSVEEELERVIPVLEALRGEL-DVLISVDTFRAEVARAALEAGAD   98 (257)
T ss_pred             CCCHHHHHHHHHHHHHCCCCEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCC-CCCEEEECCCHHHHHHHHHCCCC
T ss_conf             88999999999999987998999798758999986998888988999999998607-98289979975999999984998


Q ss_pred             EEE-E-ECCCCHHHHHC-------C---C----CC-----CCHH-------HHH-HHHHHHHHCCCCCCCEEE---ECCC
Q ss_conf             697-5-13437777320-------5---8----88-----8989-------999-999999987985577078---6689
Q gi|254780485|r  161 YYN-H-NIDTSERFYPH-------V---T----TT-----HTFE-------DRL-QTLENVRKSGIKVCCGGI---LGLG  208 (328)
Q Consensus       161 ~~~-~-~let~~~~~~~-------~---~----~~-----~~~~-------~~l-~~~~~a~~~G~~~~sg~l---~G~g  208 (328)
                      .++ + .+...++.+..       +   |    |.     ..|+       +|+ +.++.+.+.|++..-=++   +|.|
T Consensus        99 iINDisg~~~d~~m~~~va~~~~~~ilmH~~g~p~~m~~~~~~~dv~~~i~~~f~~~i~~l~~~Gi~~~~IiiDPG~GFg  178 (257)
T cd00739          99 IINDVSGGSDDPAMLEVAAEYGAPLVLMHMRGTPKTMQENPYYEDVVDEVLSFLEARLEAAESAGVARNRIILDPGIGFG  178 (257)
T ss_pred             EEECCCCCCCCHHHHHHHHHHCCCEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCCCEEEEECCCCCC
T ss_conf             99753424477789999998499999976899842223378633099999999999999999879982519970887878


Q ss_pred             CCHHHHHHHHHHHHHCC
Q ss_conf             89999999999997408
Q gi|254780485|r  209 EMIDDRIDMLLTLANLS  225 (328)
Q Consensus       209 Et~eeri~~l~~lr~l~  225 (328)
                      -|.++=++.|..|..+.
T Consensus       179 Kt~~~n~~ll~~l~~f~  195 (257)
T cd00739         179 KTPEHNLELLRRLDELK  195 (257)
T ss_pred             CCHHHHHHHHHHHHHHH
T ss_conf             88799999999899995


No 192
>PRK12581 oxaloacetate decarboxylase; Provisional
Probab=83.98  E-value=3.3  Score=21.05  Aligned_cols=174  Identities=16%  Similarity=0.153  Sum_probs=80.5

Q ss_pred             CHHHHHHHHHHHHHCCCEEEEEECCCCCCCCCCHHHHHHHHHHHCCCCCCEEEECCC-CCHHHHHHHHCCCCCEEEEECC
Q ss_conf             857999999999964983899730368887442899999887621368832410256-9999999874157606975134
Q gi|254780485|r   89 NVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLGLETCMTLGM-LSFEQAQILSKAGLDYYNHNID  167 (328)
Q Consensus        89 ~~Eei~~~a~~~~~~G~~~~~l~~~~~~~~~~~~~~~~e~i~~i~~~~~~i~~~~g~-~~~~~~~~Lk~aG~~~~~~~le  167 (328)
                      +.|--++.|+++.+.|+..+|+--...-..+.....++..+|..-..++++|.|... +....+-.-.+||+|.+-..+.
T Consensus       161 t~~yy~~~ak~l~~~Gad~I~iKDmaGlL~P~~a~~LV~~lK~~~~iPI~~HtH~t~Gla~a~~laAieAGaDiVD~Ai~  240 (468)
T PRK12581        161 TLNYYLSLVKELVEMGADSICIKDMAGILTPKAAKELVSGIKAMTNLPLIVHTHATSGISQMTYLAAVEAGADRIDTALS  240 (468)
T ss_pred             CHHHHHHHHHHHHHCCCCEEEEECCCCCCCHHHHHHHHHHHHHCCCCCEEEEECCCCCHHHHHHHHHHHCCCCEEEECCC
T ss_conf             49999999999997399989984787776889999999999836798659982588754999999999819999974464


Q ss_pred             CCHHHHHCCCCCCCHHHHHHHH-HHHHHCCCCCCCEEEECC-CCCHHHHHHHHHHHHHCCC--C---CCE--E-ECCCEE
Q ss_conf             3777732058888989999999-999987985577078668-9899999999999974088--8---860--2-054112
Q gi|254780485|r  168 TSERFYPHVTTTHTFEDRLQTL-ENVRKSGIKVCCGGILGL-GEMIDDRIDMLLTLANLST--P---PES--I-PINLLI  237 (328)
Q Consensus       168 t~~~~~~~~~~~~~~~~~l~~~-~~a~~~G~~~~sg~l~G~-gEt~eeri~~l~~lr~l~~--~---~~~--v-~~~~~~  237 (328)
                      ..-.     .+.+..   ++++ ..++..|..+      |+ .+-.++..+++..+|+...  .   +..  . +-....
T Consensus       241 ~~s~-----gtSqP~---~~s~v~~l~~~~~~~------~ld~~~l~~~~~y~~~vr~~y~~~~~~~~~~~~~d~~v~~h  306 (468)
T PRK12581        241 PFSE-----GTSQPA---TESMYLALKEAGYDI------TLDETLLEQAANHLRQARQKYLADGILDPSLLFPDPRTLQY  306 (468)
T ss_pred             CCCC-----CCCCCC---HHHHHHHHHCCCCCC------CCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHCC
T ss_conf             5357-----988866---999999973389887------66889999999999999998742355786556788145316


Q ss_pred             ECCCCCCCCC----CC--C--CHHHHHHHHHHHHHHCCCCCCEEEEHH
Q ss_conf             0487412445----68--7--989999999999996868721423115
Q gi|254780485|r  238 PIPGSKFEEN----KK--V--DPIEHVRIISVARILMPKSRLRLAAGR  277 (328)
Q Consensus       238 p~~gt~l~~~----~~--~--~~~e~lr~iAi~RL~lP~~~i~i~~~~  277 (328)
                      +.||.-+.+.    ..  .  .-.|.++.++-.|-.+-+. +.++-+.
T Consensus       307 qiPGGm~sNl~~Ql~~~g~~dr~~eV~~e~~~Vr~~lG~~-~~VTPsS  353 (468)
T PRK12581        307 QVPGGMLSNMLSQLKQANAESKLEEVLAEVPRVRKDLGYP-PLVTPLS  353 (468)
T ss_pred             CCCHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHCCCC-CEECCHH
T ss_conf             6823478889999997783645999999999999966999-8369754


No 193
>PRK08091 ribulose-phosphate 3-epimerase; Validated
Probab=83.79  E-value=3.4  Score=21.00  Aligned_cols=198  Identities=9%  Similarity=0.053  Sum_probs=101.5

Q ss_pred             HHHHHHHHHHHHHCCCEEEEE-ECCCCCCCCCCHHHHHHHHHHHCCC-CCCEEEECCCCCHHHHHHHHCCCCCEEEEECC
Q ss_conf             579999999999649838997-3036888744289999988762136-88324102569999999874157606975134
Q gi|254780485|r   90 VDQVLKEAKNAKENGATRYCM-GAAWREPKERDLSIIVDMIKGVKSL-GLETCMTLGMLSFEQAQILSKAGLDYYNHNID  167 (328)
Q Consensus        90 ~Eei~~~a~~~~~~G~~~~~l-~~~~~~~~~~~~~~~~e~i~~i~~~-~~~i~~~~g~~~~~~~~~Lk~aG~~~~~~~le  167 (328)
                      .-.+.++++.+.+.|+..+++ +.-|+--+..  ..-...++.++.. ...+|.-+- -.+..+..+.++|++.+..-.|
T Consensus        24 ~~~L~~ei~~l~~~g~d~lHiDIMDG~FVPNi--tfg~~~v~~l~~~~~~DvHLMV~-~P~~~i~~~~~aGad~it~H~E  100 (235)
T PRK08091         24 WLALHRYLQQLEALNQPLLHFDIMDGQFSPQF--TVGPWAVGQFPQTFIKDVHLMVA-DQWTVAKACVKAGAHCITLQAE  100 (235)
T ss_pred             HHHHHHHHHHHHHCCCCEEEECCCCCCCCCCC--CCCHHHHHHHCCCCCCCEEEEEC-CHHHHHHHHHHCCCCEEEECCC
T ss_conf             99999999999977999999818588767843--22899999737499972664338-8899999999759989997545


Q ss_pred             CCHHHHHCCCCCCCHHHHHHHHHHHHHCCCCC---CCEEEECC---CCCHHHHHHHHHHHHHCCCCCCEEECCCEEECCC
Q ss_conf             37777320588889899999999999879855---77078668---9899999999999974088886020541120487
Q gi|254780485|r  168 TSERFYPHVTTTHTFEDRLQTLENVRKSGIKV---CCGGILGL---GEMIDDRIDMLLTLANLSTPPESIPINLLIPIPG  241 (328)
Q Consensus       168 t~~~~~~~~~~~~~~~~~l~~~~~a~~~G~~~---~sg~l~G~---gEt~eeri~~l~~lr~l~~~~~~v~~~~~~p~~g  241 (328)
                      +....             .++++..++.+.+.   ..++..|+   .+|+-+.++.++.  ++    +.|-+.-.  .||
T Consensus       101 a~~~~-------------~~~i~~i~~~~~~~~~~~~~~~~GlAlnP~Tpve~l~~~L~--~v----D~VLvMtV--~PG  159 (235)
T PRK08091        101 GDIHL-------------HHTLSWLGQQTVPVIGGEMPVLRGISLCPATPLDVLIPYLS--DV----DVIQLLTL--DPR  159 (235)
T ss_pred             CCCCH-------------HHHHHHHHHHCCHHHHHHCCCCCEEEECCCCCHHHHHHHHH--HC----CEEEEEEE--CCC
T ss_conf             55588-------------99999999834202222207501389799998899999870--53----99999876--689


Q ss_pred             CCCCCCCCCCHHHHHHHHHHHHHHCCCC----CCEEEEHHHHHCHHHHHHHHHHCCCEEEECCEEECCCCCCHHHHHHHH
Q ss_conf             4124456879899999999999968687----214231156516568999998099889977866515888989999999
Q gi|254780485|r  242 SKFEENKKVDPIEHVRIISVARILMPKS----RLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTILF  317 (328)
Q Consensus       242 t~l~~~~~~~~~e~lr~iAi~RL~lP~~----~i~i~~~~~~~~~~~~~~~L~~GaN~~~~g~~~~t~~g~~~~~~~~~i  317 (328)
                        +.+..-. + +.+.-|.-+|-++++.    .|.+-+   .+..+....+..+|||.++.|.++-.+  ..+.+-++-+
T Consensus       160 --fgGQ~fi-~-~~l~KI~~l~~~~~~~~~~~~I~VDG---GI~~~ti~~~~~aGad~~V~GS~iF~~--~d~~e~i~~l  230 (235)
T PRK08091        160 --YGSKMRS-S-DLHERVAQLLCLLGDKREGKLIVIDG---SMTQDQLPSLIAQGIDWVVSGSALFSD--DRLVENLRSW  230 (235)
T ss_pred             --CCCCCCC-H-HHHHHHHHHHHHHHHCCCCCEEEEEC---CCCHHHHHHHHHCCCCEEEECHHHCCC--CCHHHHHHHH
T ss_conf             --8888678-7-89999999999999649991599848---989888999998399999978243379--9999999999


Q ss_pred             HHC
Q ss_conf             982
Q gi|254780485|r  318 NRL  320 (328)
Q Consensus       318 ~~~  320 (328)
                      |++
T Consensus       231 k~l  233 (235)
T PRK08091        231 KAM  233 (235)
T ss_pred             HHH
T ss_conf             985


No 194
>cd00381 IMPDH IMPDH: The catalytic domain of the inosine monophosphate dehydrogenase. IMPDH catalyzes the NAD-dependent oxidation of inosine 5'-monophosphate (IMP) to xanthosine 5' monophosphate (XMP). It is a rate-limiting step in the de novo synthesis of the guanine nucleotides. There is often a CBS domain inserted in the middle of this domain, which is proposed to play a regulatory role. IMPDH is a key enzyme in the regulation of cell proliferation and differentiation. It has been identified as an attractive target for developing chemotherapeutic agents.
Probab=83.34  E-value=3.5  Score=20.88  Aligned_cols=99  Identities=18%  Similarity=0.160  Sum_probs=49.6

Q ss_pred             HHHHHHHCCCEEEEEECCCCCCCCCCHHHHHHHHHHHCCCCCCEEEECCCC--CHHHHHHHHCCCCCEEEEECCCCHHHH
Q ss_conf             999999649838997303688874428999998876213688324102569--999999874157606975134377773
Q gi|254780485|r   96 EAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLGLETCMTLGML--SFEQAQILSKAGLDYYNHNIDTSERFY  173 (328)
Q Consensus        96 ~a~~~~~~G~~~~~l~~~~~~~~~~~~~~~~e~i~~i~~~~~~i~~~~g~~--~~~~~~~Lk~aG~~~~~~~let~~~~~  173 (328)
                      -|....+.|.-.+.    +   ....++.+.+.++.++.. ..+.+++|..  ..+.+..|.++|++.+.  ++++.   
T Consensus        50 mA~~la~~Gglgvl----h---r~~~~e~~~~~v~~vk~~-~~v~aaig~~~~~~~r~~~l~~ag~d~i~--IDvAh---  116 (325)
T cd00381          50 MAIAMARLGGIGVI----H---RNMSIEEQAEEVRKVKGR-LLVGAAVGTREDDKERAEALVEAGVDVIV--IDSAH---  116 (325)
T ss_pred             HHHHHHHCCCEEEE----E---CCCCHHHHHHHHHHHHCC-EEEEEEECCCHHHHHHHHHHHHCCCCEEE--EECHH---
T ss_conf             99999977996899----4---358889999999975047-69999976686289999999976998999--87000---


Q ss_pred             HCCCCCCCHHHHHHHHHHHHHCCCCCCCEEEECCCCCHHHHH
Q ss_conf             205888898999999999998798557707866898999999
Q gi|254780485|r  174 PHVTTTHTFEDRLQTLENVRKSGIKVCCGGILGLGEMIDDRI  215 (328)
Q Consensus       174 ~~~~~~~~~~~~l~~~~~a~~~G~~~~sg~l~G~gEt~eeri  215 (328)
                           .|+ +.-++.++..++.--  ...+|.|=.-|.+-..
T Consensus       117 -----G~~-~~~~~~ik~ir~~~p--~~~IiaGNV~T~e~a~  150 (325)
T cd00381         117 -----GHS-VYVIEMIKFIKKKYP--NVDVIAGNVVTAEAAR  150 (325)
T ss_pred             -----CCC-HHHHHHHHHHHHHCC--CCCEEECCCCCHHHHH
T ss_conf             -----345-889999999997689--9756864566899999


No 195
>pfam00809 Pterin_bind Pterin binding enzyme. This family includes a variety of pterin binding enzymes that all adopt a TIM barrel fold. The family includes dihydropteroate synthase EC:2.5.1.15 as well as a group methyltransferase enzymes including methyltetrahydrofolate, corrinoid iron-sulfur protein methyltransferase (MeTr) that catalyses a key step in the Wood-Ljungdahl pathway of carbon dioxide fixation. It transfers the N5-methyl group from methyltetrahydrofolate (CH3-H4folate) to a cob(I)amide centre in another protein, the corrinoid iron-sulfur protein. MeTr is a member of a family of proteins that includes methionine synthase and methanogenic enzymes that activate the methyl group of methyltetra-hydromethano(or -sarcino)pterin.
Probab=83.10  E-value=3.6  Score=20.82  Aligned_cols=75  Identities=24%  Similarity=0.380  Sum_probs=54.5

Q ss_pred             CCCHHHHHHHHHHHHHCCCEEEEEECCC-CC-----CCCCCHHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHCCCCC
Q ss_conf             0685799999999996498389973036-88-----87442899999887621368832410256999999987415760
Q gi|254780485|r   87 LINVDQVLKEAKNAKENGATRYCMGAAW-RE-----PKERDLSIIVDMIKGVKSLGLETCMTLGMLSFEQAQILSKAGLD  160 (328)
Q Consensus        87 ~~~~Eei~~~a~~~~~~G~~~~~l~~~~-~~-----~~~~~~~~~~e~i~~i~~~~~~i~~~~g~~~~~~~~~Lk~aG~~  160 (328)
                      ..+.+..++.|+...+.|+.-+-+++-. ++     +...+++++...++.++...  +.+|+-+...+.+++--++|++
T Consensus        15 ~~~~~~a~~~a~~~i~~GAdiIDIG~eSTrPga~~v~~~eE~~Rl~pvl~~l~~~~--~~iSIDT~~~~v~~~al~~G~~   92 (208)
T pfam00809        15 FLSPDKALEQAREMVEEGADIIDIGGESTRPGAGMVSGEEELERLVPVLEALRDQD--VPISIDTFNAEVAEAALKAGAD   92 (208)
T ss_pred             CCCHHHHHHHHHHHHHCCCCEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHHHCCC--CCEEEECCCHHHHHHHHHCCCC
T ss_conf             78999999999999987998998689768999864688999999999999863579--8289979849999999981993


Q ss_pred             EEE
Q ss_conf             697
Q gi|254780485|r  161 YYN  163 (328)
Q Consensus       161 ~~~  163 (328)
                      .++
T Consensus        93 iIN   95 (208)
T pfam00809        93 IIN   95 (208)
T ss_pred             EEE
T ss_conf             898


No 196
>PRK09776 putative sensor protein; Provisional
Probab=82.86  E-value=3.7  Score=20.76  Aligned_cols=14  Identities=7%  Similarity=-0.116  Sum_probs=7.7

Q ss_pred             HHHHHHHHHHCCCC
Q ss_conf             89999999982985
Q gi|254780485|r  310 YNKDTILFNRLGLI  323 (328)
Q Consensus       310 ~~~~~~~i~~~G~~  323 (328)
                      ..+..+.++++|..
T Consensus      1000 ~~~~l~~Lr~lGi~ 1013 (1116)
T PRK09776       1000 ASRLVQKLRLAGCR 1013 (1116)
T ss_pred             HHHHHHHHHHCCCE
T ss_conf             99999999978999


No 197
>PRK09358 adenosine deaminase; Provisional
Probab=82.83  E-value=3.7  Score=20.75  Aligned_cols=22  Identities=9%  Similarity=0.237  Sum_probs=9.8

Q ss_pred             CHHHHHHHHHHHHHCCCCCCCE
Q ss_conf             9899999999999879855770
Q gi|254780485|r  181 TFEDRLQTLENVRKSGIKVCCG  202 (328)
Q Consensus       181 ~~~~~l~~~~~a~~~G~~~~sg  202 (328)
                      ++.+.....+.|++.|++++.+
T Consensus       175 ~~~~f~~~f~~ar~~gl~~t~H  196 (333)
T PRK09358        175 PPSKFARAFDIARDAGLRLTAH  196 (333)
T ss_pred             CHHHHHHHHHHHHHCCCCEEEE
T ss_conf             8687999999999859923330


No 198
>COG0826 Collagenase and related proteases [Posttranslational modification, protein turnover, chaperones]
Probab=82.45  E-value=3.8  Score=20.66  Aligned_cols=77  Identities=13%  Similarity=0.163  Sum_probs=44.2

Q ss_pred             CCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCCCCHHHHHHHHH-------------------HHCCCC--CCEEEEC--
Q ss_conf             06857999999999964983899730368887442899999887-------------------621368--8324102--
Q gi|254780485|r   87 LINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIK-------------------GVKSLG--LETCMTL--  143 (328)
Q Consensus        87 ~~~~Eei~~~a~~~~~~G~~~~~l~~~~~~~~~~~~~~~~e~i~-------------------~i~~~~--~~i~~~~--  143 (328)
                      -.+.+++.+.++.+++.|.+-++.+...-  .....+.+.+.++                   .+++.+  +.+|+|.  
T Consensus        45 nfs~~~l~e~i~~ah~~gkk~~V~~N~~~--~~~~~~~~~~~l~~l~e~GvDaviv~Dpg~i~l~~e~~p~l~ih~S~q~  122 (347)
T COG0826          45 NFSVEDLAEAVELAHSAGKKVYVAVNTLL--HNDELETLERYLDRLVELGVDAVIVADPGLIMLARERGPDLPIHVSTQA  122 (347)
T ss_pred             CCCHHHHHHHHHHHHHCCCEEEEEECCCC--CCCHHHHHHHHHHHHHHCCCCEEEECCHHHHHHHHHHCCCCCEEEEEEE
T ss_conf             48989999999999986994999965541--6410568999999999759878997188999999975899868996567


Q ss_pred             CCCCHHHHHHHHCCCCCEEEEE
Q ss_conf             5699999998741576069751
Q gi|254780485|r  144 GMLSFEQAQILSKAGLDYYNHN  165 (328)
Q Consensus       144 g~~~~~~~~~Lk~aG~~~~~~~  165 (328)
                      ...+.+.++-+++.|+.++.+-
T Consensus       123 ~v~N~~~~~f~~~~G~~rvVl~  144 (347)
T COG0826         123 NVTNAETAKFWKELGAKRVVLP  144 (347)
T ss_pred             ECCCHHHHHHHHHCCCEEEEEC
T ss_conf             2178999999997698799817


No 199
>PRK09426 methylmalonyl-CoA mutase; Reviewed
Probab=82.37  E-value=3.8  Score=20.64  Aligned_cols=14  Identities=7%  Similarity=-0.036  Sum_probs=6.4

Q ss_pred             EECCCEEECCCCCC
Q ss_conf             20541120487412
Q gi|254780485|r  231 IPINLLIPIPGSKF  244 (328)
Q Consensus       231 v~~~~~~p~~gt~l  244 (328)
                      |.+|.|......|+
T Consensus       455 VGVN~y~~~~e~~l  468 (715)
T PRK09426        455 VGVNKYRLEKEDPI  468 (715)
T ss_pred             EECCCCCCCCCCCC
T ss_conf             83589998666766


No 200
>TIGR03572 WbuZ glycosyl amidation-associated protein WbuZ. This clade of sequences is highly similar to the HisF protein, but generally represents the second HisF homolog in the genome where the other is an authentic HisF observed in the context of a complete histidine biosynthesis operon. The similarity between these WbuZ sequences and true HisFs is such that often the closest match by BLAST of a WbuZ is a HisF. Only by making a multiple sequence alignment is the homology relationship among the WbuZ sequences made apparent. WbuZ genes are invariably observed in the presence of a homolog of the HisH protein (designated WbuY) and a proposed N-acetyl sugar amidotransferase designated in WbuX in E. coli, IfnA in P. aeriginosa and PseA in C. jejuni. Similarly, this trio of genes is invariably found in the context of saccharide biosynthesis loci. It has been shown that the WbuYZ homologs are not essential components of the activity expressed by WbuX, leading to the proposal that these to pr
Probab=81.98  E-value=3.9  Score=20.54  Aligned_cols=180  Identities=16%  Similarity=0.174  Sum_probs=95.3

Q ss_pred             HHHHHHHHHHHHCCCEEEEEECCCCCCCCCCHHHHHHHHHHH-CCCCCCEEEECCCCCHHHHHHHHCCCCCEEEEECCC-
Q ss_conf             799999999996498389973036888744289999988762-136883241025699999998741576069751343-
Q gi|254780485|r   91 DQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGV-KSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDT-  168 (328)
Q Consensus        91 Eei~~~a~~~~~~G~~~~~l~~~~~~~~~~~~~~~~e~i~~i-~~~~~~i~~~~g~~~~~~~~~Lk~aG~~~~~~~let-  168 (328)
                      ...++.|+...+.|+.+++++--......  -..-.++++.+ ++.++.+.+.-|..+.++.+++-+.|++.+.++-.. 
T Consensus        30 gdP~~~ak~~~~~g~d~lhivDld~a~~~--~~~n~~~I~~i~~~~~ipi~vGGGIrs~e~~~~ll~~GadkViigs~a~  107 (232)
T TIGR03572        30 GDPVNAARIYNAKGADELIVLDIDASKRG--REPLFELISNLAEECFMPLTVGGGIRSLEDAKKLLSLGADKVSINTAAL  107 (232)
T ss_pred             CCHHHHHHHHHHCCCCEEEEEECCCCCCC--CCCHHHHHHHHHHHCCCCEEEEECEEEHHHHHHHHHCCCCEEEECHHHH
T ss_conf             89999999999869999999968764348--8217999999999729858997133038999999976996899345452


Q ss_pred             -CHHHHHCCCCCCCHHHHHHHHHHHHHCCCC-CCCE------------EEECC---CCCHHHHHHHHHHHHHCCCCCCEE
Q ss_conf             -777732058888989999999999987985-5770------------78668---989999999999997408888602
Q gi|254780485|r  169 -SERFYPHVTTTHTFEDRLQTLENVRKSGIK-VCCG------------GILGL---GEMIDDRIDMLLTLANLSTPPESI  231 (328)
Q Consensus       169 -~~~~~~~~~~~~~~~~~l~~~~~a~~~G~~-~~sg------------~l~G~---gEt~eeri~~l~~lr~l~~~~~~v  231 (328)
                       .|.+..               +.+.+.|-+ +...            -++-.   ..+..+..+++..+.+++.  ..+
T Consensus       108 ~~p~~~~---------------~~~~~~G~q~ivvsiD~k~~~~~~~~~v~~~g~~~~~~~~~~~~i~~~~~~g~--gei  170 (232)
T TIGR03572       108 ENPDLIE---------------EAARRFGSQCVVVSIDVKKELDGSDYKVYSDNGRRATGRDPVEWAREAEQLGA--GEI  170 (232)
T ss_pred             HCCHHHH---------------HHHHHCCCCCEEEEEEEECCCCCCCEEEEECCCCCCCCCCHHHHHHHHHHCCC--CEE
T ss_conf             1935778---------------99998699458999998416778727999667763579879999999873599--899


Q ss_pred             ECCCEEECCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCEEEEHHHHHCHHHHHHHHHHCCCEEEECC
Q ss_conf             054112048741244568798999999999999686872142311565165689999980998899778
Q gi|254780485|r  232 PINLLIPIPGSKFEENKKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGD  300 (328)
Q Consensus       232 ~~~~~~p~~gt~l~~~~~~~~~e~lr~iAi~RL~lP~~~i~i~~~~~~~~~~~~~~~L~~GaN~~~~g~  300 (328)
                      -+ .-+-..|| +.+   + ..+.++-++   -.. +..+.+++| .+-..++.++.-..|++++.+|.
T Consensus       171 i~-tdI~~DG~-~~G---~-d~~l~~~i~---~~~-~~piiasGG-i~~~~di~~l~~~~~~~gv~~gs  228 (232)
T TIGR03572       171 LL-NSIDRDGT-MKG---Y-DLELIKTVS---DAV-SIPVIALGG-AGSLDDLVEVALEAGASAVAAAS  228 (232)
T ss_pred             EE-EEECCCCC-CCC---C-CHHHHHHHH---HHC-CCCEEEECC-CCCHHHHHHHHHHCCCEEEEEEE
T ss_conf             99-88857685-676---8-999999999---868-999999889-89999999999858981999721


No 201
>COG0134 TrpC Indole-3-glycerol phosphate synthase [Amino acid transport and metabolism]
Probab=81.94  E-value=4  Score=20.53  Aligned_cols=177  Identities=16%  Similarity=0.143  Sum_probs=100.3

Q ss_pred             HHHHHHHHHCCCEEEEEECCCCCCCCCCHHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHCCCCCEEEEECCCCHHHH
Q ss_conf             99999999649838997303688874428999998876213688324102569999999874157606975134377773
Q gi|254780485|r   94 LKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFY  173 (328)
Q Consensus        94 ~~~a~~~~~~G~~~~~l~~~~~~~~~~~~~~~~e~i~~i~~~~~~i~~~~g~~~~~~~~~Lk~aG~~~~~~~let~~~~~  173 (328)
                      .+.|+.....|+.-+.+.+ ....+...++++.. ++.  ...+.+...-+..++.+...-+.+|+|.+.+=+..-    
T Consensus        69 ~~ia~~Ye~~GAa~iSVLT-d~~~F~Gs~e~L~~-v~~--~v~~PvL~KDFiiD~yQI~~Ar~~GADavLLI~~~L----  140 (254)
T COG0134          69 VEIAKAYEEGGAAAISVLT-DPKYFQGSFEDLRA-VRA--AVDLPVLRKDFIIDPYQIYEARAAGADAVLLIVAAL----  140 (254)
T ss_pred             HHHHHHHHHHCCEEEEEEC-CCCCCCCCHHHHHH-HHH--HCCCCEEECCCCCCHHHHHHHHHCCCCCHHHHHHHC----
T ss_conf             9999999973984899963-76646987899999-998--558982644677889999999980856199999963----


Q ss_pred             HCCCCCCCHHHHHHHHHHHHHCCCCCCCEEEECCCCCHHHHHHHHHHHHHCCCCCCEEECCCEEECCCCCCCCCCCCCHH
Q ss_conf             20588889899999999999879855770786689899999999999974088886020541120487412445687989
Q gi|254780485|r  174 PHVTTTHTFEDRLQTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPI  253 (328)
Q Consensus       174 ~~~~~~~~~~~~l~~~~~a~~~G~~~~sg~l~G~gEt~eeri~~l~~lr~l~~~~~~v~~~~~~p~~gt~l~~~~~~~~~  253 (328)
                             +.++--+..+.|+++||.+    ++-. .+.+    .+.+.-+++.  .-|++|.      ..+..     ..
T Consensus       141 -------~~~~l~el~~~A~~LGm~~----LVEV-h~~e----El~rAl~~ga--~iIGINn------RdL~t-----f~  191 (254)
T COG0134         141 -------DDEQLEELVDRAHELGMEV----LVEV-HNEE----ELERALKLGA--KIIGINN------RDLTT-----LE  191 (254)
T ss_pred             -------CHHHHHHHHHHHHHCCCCE----EEEE-CCHH----HHHHHHHCCC--CEEEEEC------CCCCH-----HE
T ss_conf             -------9999999999999769923----8997-8999----9999996799--8899837------88402-----10


Q ss_pred             HHHHHHHHHHHHCCCCCCEEEEHHHHHCHHHHHHHHHHCCCEEEECCEEECCCCC
Q ss_conf             9999999999968687214231156516568999998099889977866515888
Q gi|254780485|r  254 EHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNP  308 (328)
Q Consensus       254 e~lr~iAi~RL~lP~~~i~i~~~~~~~~~~~~~~~L~~GaN~~~~g~~~~t~~g~  308 (328)
                      -.+.+..-..=++|.-.+.|+-|=.. .++--.....+|||+.++|+.+..+.+.
T Consensus       192 vdl~~t~~la~~~p~~~~~IsESGI~-~~~dv~~l~~~ga~a~LVG~slM~~~~~  245 (254)
T COG0134         192 VDLETTEKLAPLIPKDVILISESGIS-TPEDVRRLAKAGADAFLVGEALMRADDP  245 (254)
T ss_pred             ECHHHHHHHHHHCCCCCEEEECCCCC-CHHHHHHHHHCCCCEEEECHHHHCCCCH
T ss_conf             06889999884487775899617989-9999999997489989963888569998


No 202
>PRK09432 metF 5,10-methylenetetrahydrofolate reductase; Provisional
Probab=81.69  E-value=4  Score=20.47  Aligned_cols=188  Identities=16%  Similarity=0.180  Sum_probs=94.3

Q ss_pred             CCHHHHHHHHHHHHHCCCEEEEEECCCCCCCC--CCHHHHHHHHHHHCCC-CCCEEEECC------CCC-HHH---HHHH
Q ss_conf             68579999999999649838997303688874--4289999988762136-883241025------699-999---9987
Q gi|254780485|r   88 INVDQVLKEAKNAKENGATRYCMGAAWREPKE--RDLSIIVDMIKGVKSL-GLETCMTLG------MLS-FEQ---AQIL  154 (328)
Q Consensus        88 ~~~Eei~~~a~~~~~~G~~~~~l~~~~~~~~~--~~~~~~~e~i~~i~~~-~~~i~~~~g------~~~-~~~---~~~L  154 (328)
                      .+.+++.+.+......|++.++-..|. .|..  ....|-.++++.|++. +..|.+...      ..+ +.+   +++-
T Consensus        94 ~t~~~i~~~L~~~~~~GI~nILALRGD-~P~g~~~~~~yA~dLV~~Ir~~~~f~I~VAaYPE~HPea~~~~~Di~~Lk~K  172 (296)
T PRK09432         94 ATPEELRTIAKDYWNNGIRHIVALRGD-LPPGSGKPEMYASDLVTLLKSVADFDISVAAYPEVHPEAKSAQADLINLKRK  172 (296)
T ss_pred             CCHHHHHHHHHHHHHCCCCEEEECCCC-CCCCCCCCCCCHHHHHHHHHHHCCCCEEEECCCCCCCCCCCHHHHHHHHHHH
T ss_conf             999999999999997597548654898-9999998874689999999983698268742888786510067899999999


Q ss_pred             HCCCCCEEEEECCCCHHHHHCCCCCCCHHHHHHHHHHHHHCCC--CCCCEEEECCCCCHHHHHHHHHHHHHCCCCCCEEE
Q ss_conf             4157606975134377773205888898999999999998798--55770786689899999999999974088886020
Q gi|254780485|r  155 SKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSGI--KVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIP  232 (328)
Q Consensus       155 k~aG~~~~~~~let~~~~~~~~~~~~~~~~~l~~~~~a~~~G~--~~~sg~l~G~gEt~eeri~~l~~lr~l~~~~~~v~  232 (328)
                      -++|++....     .=+       .+.+..++.++.++++|+  ++-.|+|-  .-+..    -+.++.++    .++.
T Consensus       173 vdaGAdf~IT-----Q~F-------FD~e~f~~f~d~~~~~GI~vPIiPGImP--i~~~~----~~~r~~~~----~g~~  230 (296)
T PRK09432        173 VDAGANRAIT-----QFF-------FDVESYLRFRDRCVSAGIDVEIVPGILP--VSNFK----QLKKFADM----TNVR  230 (296)
T ss_pred             HHCCCCEEEE-----EHE-------ECHHHHHHHHHHHHHCCCCCCCCCCEEE--CCCHH----HHHHHHHH----HCCC
T ss_conf             9746664630-----020-------0499999999999985999740123010--25789----99999998----1998


Q ss_pred             CCCEEECCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCEEEEHHHHHCHHHHHHHHHHCCCEEEECCEEECCCCCCHHH
Q ss_conf             54112048741244568798999999999999686872142311565165689999980998899778665158889899
Q gi|254780485|r  233 INLLIPIPGSKFEENKKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNK  312 (328)
Q Consensus       233 ~~~~~p~~gt~l~~~~~~~~~e~lr~iAi~RL~lP~~~i~i~~~~~~~~~~~~~~~L~~GaN~~~~g~~~~t~~g~~~~~  312 (328)
                      +|...-   ..++...  +..+..+.+.          |.+       .-++.+..+..|++++=.   + |- | ..+-
T Consensus       231 iP~~l~---~~le~~~--~d~e~~~~~G----------i~~-------a~~q~~~L~~~Gv~glHf---Y-Tl-N-~~~~  282 (296)
T PRK09432        231 IPSWMA---KMFDGLD--DDAETRKLVG----------ASI-------AMDMVKILSREGVKDFHF---Y-TL-N-RAEL  282 (296)
T ss_pred             CHHHHH---HHHHCCC--CCHHHHHHHH----------HHH-------HHHHHHHHHHCCCCEEEE---E-CC-C-CHHH
T ss_conf             869999---9986018--9999999999----------999-------999999999779995599---3-28-9-8399


Q ss_pred             HHHHHHHCCCCCCC
Q ss_conf             99999982985324
Q gi|254780485|r  313 DTILFNRLGLIPDL  326 (328)
Q Consensus       313 ~~~~i~~~G~~P~~  326 (328)
                      ..+.++.+|+.|-+
T Consensus       283 t~~I~~~LGl~p~~  296 (296)
T PRK09432        283 TYAICHTLGVRPGL  296 (296)
T ss_pred             HHHHHHHHCCCCCC
T ss_conf             99999995899999


No 203
>PRK13129 consensus
Probab=81.43  E-value=4.1  Score=20.42  Aligned_cols=185  Identities=14%  Similarity=0.106  Sum_probs=105.3

Q ss_pred             CHHHHHHHHHHHHHCCCEEEEEECCCCCCCCC-----------------CHHHHHHHHHHHCCC-CCC-EEE---ECC--
Q ss_conf             85799999999996498389973036888744-----------------289999988762136-883-241---025--
Q gi|254780485|r   89 NVDQVLKEAKNAKENGATRYCMGAAWREPKER-----------------DLSIIVDMIKGVKSL-GLE-TCM---TLG--  144 (328)
Q Consensus        89 ~~Eei~~~a~~~~~~G~~~~~l~~~~~~~~~~-----------------~~~~~~e~i~~i~~~-~~~-i~~---~~g--  144 (328)
                      +.|.-++.++.+.+.|+.-+-++ -...++.-                 .++.++++++.+++. ... +.+   |+-  
T Consensus        31 ~~e~s~~~~~~l~~~GaDiiEiG-iPfSDP~ADGpvIq~A~~~AL~~G~~~~~~~~~~~~~r~~~~~PivlM~Y~N~i~~  109 (267)
T PRK13129         31 DLETTAEALLILQENGADLIELG-IPYSDPLADGPVIQAAATRALQSGTTLEKVLEMLESLKGKLTIPIILFTYYNPLLN  109 (267)
T ss_pred             CHHHHHHHHHHHHHCCCCEEEEC-CCCCCCCCCCHHHHHHHHHHHHCCCCHHHHHHHHHHHHCCCCCCEEEEEEHHHHHH
T ss_conf             98999999999997799999979-98888776589999999999976987899999999854347888899861078988


Q ss_pred             CCCHHHHHHHHCCCCCEEEEECCCCHHHHHCCCCCCCHHHHHHHHHHHHHCCCCCCCEEEECCCCCHHHHHHHHHHHHHC
Q ss_conf             69999999874157606975134377773205888898999999999998798557707866898999999999999740
Q gi|254780485|r  145 MLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANL  224 (328)
Q Consensus       145 ~~~~~~~~~Lk~aG~~~~~~~let~~~~~~~~~~~~~~~~~l~~~~~a~~~G~~~~sg~l~G~gEt~eeri~~l~~lr~l  224 (328)
                      .-.+.-+++.+++|++.+++             |.-.+++--+..+.+++.|+..-  .++- --|.++|+..+....  
T Consensus       110 ~G~e~F~~~~~~~GvdGvIi-------------pDLP~eE~~~~~~~~~~~gl~~I--~lva-Ptt~~~Ri~~i~~~~--  171 (267)
T PRK13129        110 RGMERFCEQAAAAGVAGLVV-------------PDLPLEEAEKLSPIAAERGIDLI--LLVA-PTTPAERMKRIAQQS--  171 (267)
T ss_pred             HHHHHHHHHHHHCCCCEEEC-------------CCCCHHHHHHHHHHHHHCCCEEE--EEEC-CCCCHHHHHHHHHCC--
T ss_conf             55999999998669875767-------------89998999999999985398168--9948-999689999998168--


Q ss_pred             CCCCCEEECCCEEECCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCEEEEHHHHHCHHHHHHHHHHCCCEEEECCEEE
Q ss_conf             8888602054112048741244568798999999999999686872142311565165689999980998899778665
Q gi|254780485|r  225 STPPESIPINLLIPIPGSKFEENKKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLL  303 (328)
Q Consensus       225 ~~~~~~v~~~~~~p~~gt~l~~~~~~~~~e~lr~iAi~RL~lP~~~i~i~~~~~~~~~~~~~~~L~~GaN~~~~g~~~~  303 (328)
                         ..++   ..+...|+.-..  ..-+.+....+.-.|-.-   .+++..|-.--.++.......+|||++++|..++
T Consensus       172 ---~gFi---Y~vs~~GvTG~~--~~~~~~~~~~i~~ik~~t---~~Pv~vGFGIs~~e~v~~~~~~~ADGvIVGSaiV  239 (267)
T PRK13129        172 ---RGFT---YLVSVTGVTGER--SQMENRVESLLQQLRQVT---SKPIAVGFGISGPEQARQVREWGADGAIVGSAFV  239 (267)
T ss_pred             ---CCEE---EEEECCCCCCCC--CCCCHHHHHHHHHHHHHC---CCCEEEEECCCCHHHHHHHHHCCCCEEEECHHHH
T ss_conf             ---9808---987346656765--445088999999999834---8981788447999999999854999999878999


No 204
>PRK01033 imidazole glycerol phosphate synthase subunit HisF; Provisional
Probab=81.43  E-value=4.1  Score=20.41  Aligned_cols=181  Identities=17%  Similarity=0.172  Sum_probs=97.6

Q ss_pred             HHHHHHHHHHHCCCEEEEEECCCCCCCCCCHHHHHHHHHHH-CCCCCCEEEECCCCCHHHHHHHHCCCCCEEEEECCC--
Q ss_conf             99999999996498389973036888744289999988762-136883241025699999998741576069751343--
Q gi|254780485|r   92 QVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGV-KSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDT--  168 (328)
Q Consensus        92 ei~~~a~~~~~~G~~~~~l~~~~~~~~~~~~~~~~e~i~~i-~~~~~~i~~~~g~~~~~~~~~Lk~aG~~~~~~~let--  168 (328)
                      ..++.|+...+.|+.+++++--........  .-.++++.+ ++.++.+.+.-|..+.++.+++.++|++.+.++=-.  
T Consensus        31 dP~~~ak~f~~~GadelhivDld~a~~g~~--~n~~~I~~I~~~~~ipi~vGGGIrs~e~~~~ll~~GadkViigs~a~~  108 (253)
T PRK01033         31 DPINAVRIFNEKEADELIVLDIDASRKGRE--PNYELIENLASECFMPLCYGGGIKTVEQAKRIFSLGVEKVSISTAALE  108 (253)
T ss_pred             CHHHHHHHHHHCCCCEEEEEECCCCCCCCC--CHHHHHHHHHHHCCCCEEEECCCCCHHHHHHHHHCCCCEEEECCHHHH
T ss_conf             999999999987999899994745424880--169999999987699889868812168889998679866999987863


Q ss_pred             CHHHHHCCCCCCCHHHHHHHHHHHHHCCCC-CCCEE-------------EEC-CCCCHHHHHHHHHHHHHCCCCCCEEEC
Q ss_conf             777732058888989999999999987985-57707-------------866-898999999999999740888860205
Q gi|254780485|r  169 SERFYPHVTTTHTFEDRLQTLENVRKSGIK-VCCGG-------------ILG-LGEMIDDRIDMLLTLANLSTPPESIPI  233 (328)
Q Consensus       169 ~~~~~~~~~~~~~~~~~l~~~~~a~~~G~~-~~sg~-------------l~G-~gEt~eeri~~l~~lr~l~~~~~~v~~  233 (328)
                      .|.+..+               .+.+.|-+ +...+             +-| --.+.-+..+++..+.+++.  ..+-+
T Consensus       109 ~p~~i~~---------------~~~~fG~q~IvvsiD~k~~~~~~~~v~~~g~~~~t~~~~~~~~~~~~~~g~--geil~  171 (253)
T PRK01033        109 DPKLITE---------------AAEIYGSQSVVVSIDVKKRLFGRYDVYTHNGTKKTGLDPVEFAKQAEELGA--GEIVL  171 (253)
T ss_pred             CCHHHHH---------------HHHHCCCCCEEEEEEEECCCCCCEEEEEECCCCCCCCCHHHHHHHHHHCCC--CEEEE
T ss_conf             7416578---------------998779976999999824877834789867953678558999999874697--79999


Q ss_pred             CCEEECCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCEEEEHHHHHCHHHHHHHHHHCCCEEEECCEE
Q ss_conf             411204874124456879899999999999968687214231156516568999998099889977866
Q gi|254780485|r  234 NLLIPIPGSKFEENKKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTL  302 (328)
Q Consensus       234 ~~~~p~~gt~l~~~~~~~~~e~lr~iAi~RL~lP~~~i~i~~~~~~~~~~~~~~~L~~GaN~~~~g~~~  302 (328)
                       .-+-..|| +.   .++ .+.++-++  .. . +..+.+++| .+-..++..+--..|++++++|.-+
T Consensus       172 -TdI~rDGt-~~---G~d-~~l~~~i~--~~-~-~ipiIasGG-i~s~~di~~l~~~~~v~gv~~gs~F  229 (253)
T PRK01033        172 -NSIDRDGV-MK---GYD-LELIKKIS--SA-V-KIPVTALGG-AGSLDDIADLIQEAGASAAAAGSLF  229 (253)
T ss_pred             -EEECCCCC-CC---CCC-HHHHHHHH--HH-C-CCCEEEECC-CCCHHHHHHHHHHCCCEEEEEEEEE
T ss_conf             -87848897-66---879-99999999--87-8-999999789-8999999999986797399783168


No 205
>cd03465 URO-D_like The URO-D _like protein superfamily includes bacterial and eukaryotic uroporphyrinogen decarboxylases (URO-D), coenzyme M methyltransferases and other putative bacterial methyltransferases. Uroporphyrinogen decarboxylase (URO-D) decarboxylates the four acetate side chains of uroporphyrinogen III (uro-III) to create coproporphyrinogen III, an important branching point of the tetrapyrrole biosynthetic pathway. The methyltransferases represented here are important for ability of methanogenic organisms to use other compounds than carbon dioxide for reduction to methane.
Probab=81.18  E-value=4.2  Score=20.36  Aligned_cols=180  Identities=14%  Similarity=0.066  Sum_probs=72.7

Q ss_pred             CHHHHHHHHHHHHHHHCCCCEEEEEEEEEECCCCCCCCCCCCCCCCC--C---------CCCCCCCCC------CCHHHH
Q ss_conf             91899999999988862898569998645307868342321243354--7---------775641000------685799
Q gi|254780485|r   31 PFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQSVH--N---------KSKLKASKL------INVDQV   93 (328)
Q Consensus        31 ~~~el~~~Aa~~~r~~~~g~~V~~~~~in~~TN~C~~~C~fCaf~~~--~---------~~~~~~~~~------~~~Eei   93 (328)
                      .+.+++.+++-.-.+++.-+.+.+.+.+.+-  .=..+|.+ .|...  +         .........      -....+
T Consensus        35 ~d~~~~~e~~~~~~~~~~~D~~~i~~Di~~~--~ea~G~~~-~~~~~~~P~v~~~~~~~~~~~~~~~~~~~~~~~~l~~~  111 (330)
T cd03465          35 TDPELGAEAQIALYKKFGPDAIKVFSDLFVE--AEAFGAEI-RYPEDDTPSVEGPLIEDEEEDDDLLPPDPGDSPRLPEL  111 (330)
T ss_pred             CCHHHHHHHHHHHHHHHCCCEEEECCCCHHH--HHHCCCEE-EECCCCCCCCCCCCCCCHHHHHHCCCCCHHHHHHHHHH
T ss_conf             6999999999999998098889705640267--99849737-76799898778888887888863379962255569999


Q ss_pred             HHHHHHHHHC-CCEEEEEECCCCCCCCCCHHHHH---HHHHHHCCCCCCEEE---ECCCCCHHHHHHHHCCCCCEEEEEC
Q ss_conf             9999999964-98389973036888744289999---988762136883241---0256999999987415760697513
Q gi|254780485|r   94 LKEAKNAKEN-GATRYCMGAAWREPKERDLSIIV---DMIKGVKSLGLETCM---TLGMLSFEQAQILSKAGLDYYNHNI  166 (328)
Q Consensus        94 ~~~a~~~~~~-G~~~~~l~~~~~~~~~~~~~~~~---e~i~~i~~~~~~i~~---~~g~~~~~~~~~Lk~aG~~~~~~~l  166 (328)
                      ++.++...+. |-....++..+ .|.. -..|+.   +.++.+++..-.++.   -+.....+.++...++|++.+.+..
T Consensus       112 ~eai~~l~~~~~~~~plig~~g-gP~T-la~~l~g~~~~~~~l~~~p~~~~~ll~~~t~~~~~~~~~qi~aGad~i~i~d  189 (330)
T cd03465         112 LEAIRLLKEELGDRVPVIGAVG-GPFT-LASLLMGASKFLMLLYTDPELVHKLLEKCTEFIIRYADALIEAGADGIYISD  189 (330)
T ss_pred             HHHHHHHHHHCCCCCCEEEECC-CHHH-HHHHHCCHHHHHHHHHHCHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEC
T ss_conf             9999999997289874797556-5799-9887318489999999799999999999999999999999963998899835


Q ss_pred             CC------CHHHHHCCCCCCCHHHHHHHHHHHHHCCCCCCCEEEECCCCCHHHHHHHHHHHHHCCC
Q ss_conf             43------7777320588889899999999999879855770786689899999999999974088
Q gi|254780485|r  167 DT------SERFYPHVTTTHTFEDRLQTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLST  226 (328)
Q Consensus       167 et------~~~~~~~~~~~~~~~~~l~~~~~a~~~G~~~~sg~l~G~gEt~eeri~~l~~lr~l~~  226 (328)
                      ..      +++.|.+..    +..-.++++.+++.+.++   +++=-|.+.    .++..+++++.
T Consensus       190 ~~a~~~~ls~~~f~~f~----~p~~k~i~~~~~~~~~~~---ilh~~g~~~----~~l~~~~~~~~  244 (330)
T cd03465         190 PWASSSILSPEDFKEFS----LPYLKKVFDAIKALGGPV---IHHNCGDTA----PILELMADLGA  244 (330)
T ss_pred             CCCCCCCCCHHHHHHHH----HHHHHHHHHHHHHCCCCE---EEECCCCHH----HHHHHHHHCCC
T ss_conf             66665569999999998----999999999977549983---674078628----79999986588


No 206
>TIGR01361 DAHP_synth_Bsub phospho-2-dehydro-3-deoxyheptonate aldolase; InterPro: IPR006268   These sequences are one of at least three types of phospho-2-dehydro-3-deoxyheptonate aldolase (DAHP synthase). This enzyme catalyzes the first of 7 steps in the biosynthesis of chorismate, that last common precursor of all three aromatic amino acids and of PABA, ubiquinone and menaquinone. Some members of this family, including an experimentally characterised member from Bacillus subtilis, are bifunctional, with a chorismate mutase domain N-terminal to this region. The member of this family from Synechocystis PCC 6803, CcmA, was shown to be essential for carboxysome formation. However, no other candidate for this enzyme is present in that species, chorismate biosynthesis does occur, other species having this protein lack carboxysomes but appear to make chorismate, and a requirement of CcmA for carboxysome formation does not prohibit a role in chorismate biosynthesis.; GO: 0016832 aldehyde-lyase activity, 0009073 aromatic amino acid family biosynthetic process.
Probab=81.13  E-value=4.2  Score=20.35  Aligned_cols=202  Identities=16%  Similarity=0.211  Sum_probs=117.2

Q ss_pred             CCHHHHHHHHHHHHHCCCEEEEEECCCCCCCCCCH------HHHHHHHHHHC-CCCCCEEEECCCCCHHHHHHHHCCCCC
Q ss_conf             68579999999999649838997303688874428------99999887621-368832410256999999987415760
Q gi|254780485|r   88 INVDQVLKEAKNAKENGATRYCMGAAWREPKERDL------SIIVDMIKGVK-SLGLETCMTLGMLSFEQAQILSKAGLD  160 (328)
Q Consensus        88 ~~~Eei~~~a~~~~~~G~~~~~l~~~~~~~~~~~~------~~~~e~i~~i~-~~~~~i~~~~g~~~~~~~~~Lk~aG~~  160 (328)
                      -+.|++.+.|+..++.|++-+  =+|-+.|..+++      +.=+..++..+ +.++.+-..  .++.+++....+. +|
T Consensus        36 Es~eq~~~~A~~vk~~Ga~~L--RGGAfKPRTSPYsFQGlg~~gl~~l~~A~~~~GL~~vTE--vmd~~d~e~~~~y-~D  110 (262)
T TIGR01361        36 ESEEQIVETARFVKEAGAKIL--RGGAFKPRTSPYSFQGLGEEGLKLLRRAADETGLPVVTE--VMDPRDVEIVAEY-AD  110 (262)
T ss_pred             CCHHHHHHHHHHHHHCCCCEE--ECCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCEEEEE--EECHHHHHHHHHH-HH
T ss_conf             887999999999986674043--066348888884124741899999999998609948988--6362567778765-11


Q ss_pred             EEEEECCCCHHHHHCCCCCCCHHHHHHHHHHHHHCCCCCCCEEEE--CCCCCHHHHHHHHHHHHHCCCCCCEEEC--CCE
Q ss_conf             697513437777320588889899999999999879855770786--6898999999999999740888860205--411
Q gi|254780485|r  161 YYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSGIKVCCGGIL--GLGEMIDDRIDMLLTLANLSTPPESIPI--NLL  236 (328)
Q Consensus       161 ~~~~~let~~~~~~~~~~~~~~~~~l~~~~~a~~~G~~~~sg~l~--G~gEt~eeri~~l~~lr~l~~~~~~v~~--~~~  236 (328)
                      .+    .          =+-.-.+=.+-++.+.+.+-|+    |.  |++-|.+|++.-.++|-.-+..++-|-+  ...
T Consensus       111 ~l----Q----------iGARNmQNF~LL~~vG~~~KPV----LLKRG~~aTi~EwL~AAEYIl~~GsN~~ViLCERGIR  172 (262)
T TIGR01361       111 IL----Q----------IGARNMQNFELLKEVGKQGKPV----LLKRGMGATIEEWLEAAEYILSEGSNGNVILCERGIR  172 (262)
T ss_pred             HH----H----------HCCCCCCCHHHHHHHHHCCCCE----EEECCCCHHHHHHHHHHHHHHHCCCCCCEEEEECCCC
T ss_conf             34----2----------2254122569999972237975----5307721589999999999984688995489975856


Q ss_pred             EECCCCCCCCCCCCCHHHHHHHHHHHHHH--CCC-CCCEEEEHHHHHCHHHHHHHHHHCCCEEEECC-----EEECCCC-
Q ss_conf             20487412445687989999999999996--868-72142311565165689999980998899778-----6651588-
Q gi|254780485|r  237 IPIPGSKFEENKKVDPIEHVRIISVARIL--MPK-SRLRLAAGRAMMSDELQALCFFSGANSIFVGD-----TLLTAKN-  307 (328)
Q Consensus       237 ~p~~gt~l~~~~~~~~~e~lr~iAi~RL~--lP~-~~i~i~~~~~~~~~~~~~~~L~~GaN~~~~g~-----~~~t~~g-  307 (328)
                      ++-+-|+        -.-++-.|+++|-+  ||= +.+.=++||=.+-..+..-|+-+|||++|+|=     +=+ +++ 
T Consensus       173 TfE~~TR--------~TLD~saV~~~K~~tHLPi~VDPSH~~GrRdLV~plA~AA~A~GADgl~iEVHp~Pe~AL-SD~~  243 (262)
T TIGR01361       173 TFEKSTR--------NTLDLSAVPLLKKETHLPIIVDPSHAAGRRDLVLPLAKAAIAAGADGLMIEVHPDPEKAL-SDSK  243 (262)
T ss_pred             CCCCHHH--------HHHHHHHHHHHHHCCCCCEEECCCCCCCHHHHHHHHHHHHHHHCCCEEEEEECCCHHHHC-CCCC
T ss_conf             7630024--------533378999998605898787187987624578899999897574736898667833320-7871


Q ss_pred             --CCH-HHHHHHHHHCC
Q ss_conf             --898-99999999829
Q gi|254780485|r  308 --PSY-NKDTILFNRLG  321 (328)
Q Consensus       308 --~~~-~~~~~~i~~~G  321 (328)
                        -++ ++...+++++.
T Consensus       244 Qql~~c~~f~~~~~~~~  260 (262)
T TIGR01361       244 QQLTPCEEFKRLVKELR  260 (262)
T ss_pred             CCCCHHHHHHHHHHHHC
T ss_conf             14466788999999850


No 207
>COG0685 MetF 5,10-methylenetetrahydrofolate reductase [Amino acid transport and metabolism]
Probab=80.96  E-value=4.3  Score=20.31  Aligned_cols=100  Identities=18%  Similarity=0.095  Sum_probs=58.5

Q ss_pred             CCCCHHHHHHHHHHHHHCCCEEEEEECCCCC--CCCCC-HHHHHHHHHHHCCCC---CCEEE--ECCCC-C----HHH--
Q ss_conf             0068579999999999649838997303688--87442-899999887621368---83241--02569-9----999--
Q gi|254780485|r   86 KLINVDQVLKEAKNAKENGATRYCMGAAWRE--PKERD-LSIIVDMIKGVKSLG---LETCM--TLGML-S----FEQ--  150 (328)
Q Consensus        86 ~~~~~Eei~~~a~~~~~~G~~~~~l~~~~~~--~~~~~-~~~~~e~i~~i~~~~---~~i~~--~~g~~-~----~~~--  150 (328)
                      ...+.+++.+.++.+.+.|+++++..+|..+  +.... +.|-.++++.+|...   ..+.+  ++..- .    ..+  
T Consensus        87 ~d~n~~~i~~~l~~~~~~Gi~~ilaLrGDpp~g~~~~~~~~~s~dLv~lik~~~~~~f~i~~A~~Pe~h~~s~~~~~d~~  166 (291)
T COG0685          87 RDRNRIEIISILKGAAALGIRNILALRGDPPAGDKPGGKDLYSVDLVELIKKMRGGIFDIGVAAYPEGHPESKDVKEDIK  166 (291)
T ss_pred             CCCCHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHCCCCEEEEEEECCCCCCCCHHHHHHHH
T ss_conf             68898999999999998188559994589877788786546899999999985689735899867887844100578999


Q ss_pred             -HHHHHCCCCCEEEEECCCCHHHHHCCCCCCCHHHHHHHHHHHHHCCC
Q ss_conf             -99874157606975134377773205888898999999999998798
Q gi|254780485|r  151 -AQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSGI  197 (328)
Q Consensus       151 -~~~Lk~aG~~~~~~~let~~~~~~~~~~~~~~~~~l~~~~~a~~~G~  197 (328)
                       +++=.++|++.+..-     -       -.+.+.+....+..+.+|+
T Consensus       167 ~lkrKv~aGAd~~iTQ-----~-------~fd~e~~~~~~~~~~~~g~  202 (291)
T COG0685         167 RLKRKVDAGADFFITQ-----F-------FFDVEAFERFAERVRAAGI  202 (291)
T ss_pred             HHHHHHHCCCCEEEEE-----E-------CCCHHHHHHHHHHHHHCCC
T ss_conf             9999986588657642-----0-------1689999999999986389


No 208
>COG2876 AroA 3-deoxy-D-arabino-heptulosonate 7-phosphate (DAHP) synthase [Amino acid transport and metabolism]
Probab=80.14  E-value=4.5  Score=20.13  Aligned_cols=201  Identities=14%  Similarity=0.181  Sum_probs=106.5

Q ss_pred             CCHHHHHHHHHHHHHCCCEEEEEECCCCCCCCCCH------HHHHHHHHHHC-CCCCCEEEECCCCCHHHHHHHHCCCCC
Q ss_conf             68579999999999649838997303688874428------99999887621-368832410256999999987415760
Q gi|254780485|r   88 INVDQVLKEAKNAKENGATRYCMGAAWREPKERDL------SIIVDMIKGVK-SLGLETCMTLGMLSFEQAQILSKAGLD  160 (328)
Q Consensus        88 ~~~Eei~~~a~~~~~~G~~~~~l~~~~~~~~~~~~------~~~~e~i~~i~-~~~~~i~~~~g~~~~~~~~~Lk~aG~~  160 (328)
                      -+.|++...|+..+..|+.-+.  +|-..|..+++      +.-+...+..+ +.++.+...  .++..++....+. +|
T Consensus        56 Es~E~i~~~A~~vk~~Ga~~lR--GgafKPRTSPYsFQGlge~gL~~l~~a~~~~Gl~vvtE--vm~~~~~e~~~~y-~D  130 (286)
T COG2876          56 ESEEQVRETAESVKAAGAKALR--GGAFKPRTSPYSFQGLGEEGLKLLKRAADETGLPVVTE--VMDVRDVEAAAEY-AD  130 (286)
T ss_pred             CCHHHHHHHHHHHHHCCHHHCC--CCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCEEEEE--ECCHHHHHHHHHH-HH
T ss_conf             7799999999999873622313--77678889953336657788999999888729905889--5489899999866-16


Q ss_pred             EEEEECCCCHHHHHCCCCCCCHHHHHHHHHHHHHCCCCCCCEEEE--CCCCCHHHHHHHHHHHHHCCCCCCEEEC--CCE
Q ss_conf             697513437777320588889899999999999879855770786--6898999999999999740888860205--411
Q gi|254780485|r  161 YYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSGIKVCCGGIL--GLGEMIDDRIDMLLTLANLSTPPESIPI--NLL  236 (328)
Q Consensus       161 ~~~~~let~~~~~~~~~~~~~~~~~l~~~~~a~~~G~~~~sg~l~--G~gEt~eeri~~l~~lr~l~~~~~~v~~--~~~  236 (328)
                      .+-+              +...-+-++.++.+.+.+.++    ++  |++-|.||.+.-...+-.-+ .++-|-+  ...
T Consensus       131 ilqv--------------GARNMQNF~LLke~G~~~kPv----LLKRg~~aTieEwL~AAEYI~s~G-N~~vILCERGIR  191 (286)
T COG2876         131 ILQV--------------GARNMQNFALLKEVGRQNKPV----LLKRGLSATIEEWLNAAEYILSHG-NGNVILCERGIR  191 (286)
T ss_pred             HHHH--------------CCCCHHHHHHHHHHCCCCCCE----EEECCCCCCHHHHHHHHHHHHHCC-CCCEEEEECCCC
T ss_conf             9886--------------332005169999823559976----972474124999999999999679-995799714433


Q ss_pred             EECCCCCCCCCCCCCHHHHHHHHHHHHHH--CCC-CCCEEEEHHHHHCHHHHHHHHHHCCCEEEECCE-----EECCC--
Q ss_conf             20487412445687989999999999996--868-721423115651656899999809988997786-----65158--
Q gi|254780485|r  237 IPIPGSKFEENKKVDPIEHVRIISVARIL--MPK-SRLRLAAGRAMMSDELQALCFFSGANSIFVGDT-----LLTAK--  306 (328)
Q Consensus       237 ~p~~gt~l~~~~~~~~~e~lr~iAi~RL~--lP~-~~i~i~~~~~~~~~~~~~~~L~~GaN~~~~g~~-----~~t~~--  306 (328)
                      +.-..|++        .-++-.|++.|-.  ||= +.+.=++||-.+-..+...++-+|||++|++-.     -+.-+  
T Consensus       192 tfe~~TRn--------tLDi~aV~~~kq~THLPVivDpSH~~Grr~lv~pla~AA~AaGAdglmiEVHp~P~~AlsD~~Q  263 (286)
T COG2876         192 TFEKATRN--------TLDISAVPILKQETHLPVIVDPSHATGRRDLVEPLAKAAIAAGADGLMIEVHPDPEKALSDAKQ  263 (286)
T ss_pred             CCCCCCCC--------EECHHHHHHHHHHCCCCEEECCCCCCCCHHHHHHHHHHHHHCCCCEEEEEECCCCCCCCCCCCC
T ss_conf             45556664--------2236888888761578779878776553135788899998616773699964795434576000


Q ss_pred             CCCHHHHHHHHHHC
Q ss_conf             88989999999982
Q gi|254780485|r  307 NPSYNKDTILFNRL  320 (328)
Q Consensus       307 g~~~~~~~~~i~~~  320 (328)
                      -.++++..++.+++
T Consensus       264 ql~~~~f~~l~~~~  277 (286)
T COG2876         264 QLTPEEFEELVKEL  277 (286)
T ss_pred             CCCHHHHHHHHHHH
T ss_conf             17999999999999


No 209
>PRK13119 consensus
Probab=79.82  E-value=4.6  Score=20.06  Aligned_cols=201  Identities=18%  Similarity=0.205  Sum_probs=110.1

Q ss_pred             CHHHHHHHHHHHHHCCCEEEEEECCCCCCC-C---------------CCHHHHHHHHHHHCCCCC---CEEEE---C-CC
Q ss_conf             857999999999964983899730368887-4---------------428999998876213688---32410---2-56
Q gi|254780485|r   89 NVDQVLKEAKNAKENGATRYCMGAAWREPK-E---------------RDLSIIVDMIKGVKSLGL---ETCMT---L-GM  145 (328)
Q Consensus        89 ~~Eei~~~a~~~~~~G~~~~~l~~~~~~~~-~---------------~~~~~~~e~i~~i~~~~~---~i~~~---~-g~  145 (328)
                      +.|.-++.++.+.+.|+.-+-++.-.-+|. +               -.++.++++++.+++.+.   .+.++   + ..
T Consensus        27 ~~e~s~~~l~~l~~~GadiiElGiPFSDP~ADGPvIq~A~~rAL~~G~~~~~~~~~~~~ir~~~~~~pivlMtY~N~i~~  106 (261)
T PRK13119         27 DIRTTLALMHGMVANGADILELGVPFSDPMADGPVIQRAAERALANGISLRDVLDVVRKFRETDTQTPVVLMGYLNPVHK  106 (261)
T ss_pred             CHHHHHHHHHHHHHCCCCEEEECCCCCCCCCCCHHHHHHHHHHHHCCCCHHHHHHHHHHHHCCCCCCCEEEEECHHHHHH
T ss_conf             98999999999996699999978988886665899999999999779978899999998651489989899840378988


Q ss_pred             C-CHHHHHHHHCCCCCEEEEECCCCHHHHHCCCCCCCHHHHHHHHHHHHHCCCCCCCEEEECCCCCHHHHHHHHHHHHHC
Q ss_conf             9-999999874157606975134377773205888898999999999998798557707866898999999999999740
Q gi|254780485|r  146 L-SFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANL  224 (328)
Q Consensus       146 ~-~~~~~~~Lk~aG~~~~~~~let~~~~~~~~~~~~~~~~~l~~~~~a~~~G~~~~sg~l~G~gEt~eeri~~l~~lr~l  224 (328)
                      . -+.-++.++++|++.+.+             |.-.+++.-+..+.+++.|+..   +.+=---|.++|+..+..... 
T Consensus       107 yG~e~F~~~~~~~GvdGvIi-------------pDLP~ee~~~~~~~~~~~gl~~---I~lvaPtt~~~Ri~~i~~~a~-  169 (261)
T PRK13119        107 MGYREFAQEAAKAGVDGVLT-------------VDSPVETIDPLYRELKDNGVDC---IFLIAPTTTEDRIKTIAELAG-  169 (261)
T ss_pred             HHHHHHHHHHHHCCCCEEEE-------------CCCCHHHHHHHHHHHHHCCCCE---EEEECCCCCHHHHHHHHHHCC-
T ss_conf             62999999999759857983-------------6899788799999999759976---443079998999999997289-


Q ss_pred             CCCCCEEECCCEEECCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCEEEEHHHHHCHHHHHHHHHHCCCEEEECCEEE-
Q ss_conf             8888602054112048741244568798999999999999686872142311565165689999980998899778665-
Q gi|254780485|r  225 STPPESIPINLLIPIPGSKFEENKKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLL-  303 (328)
Q Consensus       225 ~~~~~~v~~~~~~p~~gt~l~~~~~~~~~e~lr~iAi~RL~lP~~~i~i~~~~~~~~~~~~~~~L~~GaN~~~~g~~~~-  303 (328)
                          .++-   .+...|+.-  .......+..+.+.-.|=..   .+++..|-.--.++ +-..+..+||++++|..++ 
T Consensus       170 ----gFiY---~vs~~GvTG--~~~~~~~~~~~~i~~ik~~t---~~Pv~vGFGIs~~e-~v~~~~~~aDGvIVGSaiV~  236 (261)
T PRK13119        170 ----GFVY---YVSLKGVTG--AASLDTDEVSRKIEYLHQYI---DIPIGVGFGISNAE-SARKIGRVADAVIVGSRIVK  236 (261)
T ss_pred             ----CEEE---EEECCCCCC--CCCCCHHHHHHHHHHHHHCC---CCCEEEEECCCCHH-HHHHHHCCCCEEEECHHHHH
T ss_conf             ----8199---973666668--77555488999999998636---99879983659999-99998734999998289999


Q ss_pred             ---CCCCCCHHHHHHHHHH
Q ss_conf             ---1588898999999998
Q gi|254780485|r  304 ---TAKNPSYNKDTILFNR  319 (328)
Q Consensus       304 ---t~~g~~~~~~~~~i~~  319 (328)
                         ..++.......+++++
T Consensus       237 ~i~~~~~~~~~~v~~~vk~  255 (261)
T PRK13119        237 EIENNAGNEAAAVGALVKE  255 (261)
T ss_pred             HHHHCCCCHHHHHHHHHHH
T ss_conf             9986688768999999999


No 210
>PRK13396 3-deoxy-7-phosphoheptulonate synthase; Provisional
Probab=79.46  E-value=4.8  Score=19.99  Aligned_cols=200  Identities=15%  Similarity=0.230  Sum_probs=100.7

Q ss_pred             CCHHHHHHHHHHHHHCCCEEEEEECCCCCCCCCC--H----HHHHHHHHHHC-CCCCCEEEECCCCCHHHHHHHHCCCCC
Q ss_conf             6857999999999964983899730368887442--8----99999887621-368832410256999999987415760
Q gi|254780485|r   88 INVDQVLKEAKNAKENGATRYCMGAAWREPKERD--L----SIIVDMIKGVK-SLGLETCMTLGMLSFEQAQILSKAGLD  160 (328)
Q Consensus        88 ~~~Eei~~~a~~~~~~G~~~~~l~~~~~~~~~~~--~----~~~~e~i~~i~-~~~~~i~~~~g~~~~~~~~~Lk~aG~~  160 (328)
                      -|.|++++.|+..++.|++-+  -+|-..|..++  |    +.=+++++.++ +.++.+...  ..+.+++....+. +|
T Consensus       112 Es~eq~~~~A~~vk~~Ga~~l--RgGa~KPRTsPysFqGlGeeGL~~L~~ak~e~GLpvvTE--V~~~~~ve~v~~~-~D  186 (352)
T PRK13396        112 ENEEMIVETAKRVKAAGAKFL--RGGAYKPRTSPYAFQGHGESALELLAAAREATGLGIITE--VMDAADLDKIAEV-AD  186 (352)
T ss_pred             CCHHHHHHHHHHHHHCCCCEE--CCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCEEEE--ECCHHHHHHHHHH-CC
T ss_conf             899999999999998399878--265024789985435870879999999999869972688--6799999999865-88


Q ss_pred             EEEEECCCCHHHHHCCCCCCCHHHHHHHHHHHHHCCCCCCCEEEE--CCCCCHHHHHHHHHHHHHCCCCCCEEECCCEEE
Q ss_conf             697513437777320588889899999999999879855770786--689899999999999974088886020541120
Q gi|254780485|r  161 YYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSGIKVCCGGIL--GLGEMIDDRIDMLLTLANLSTPPESIPINLLIP  238 (328)
Q Consensus       161 ~~~~~let~~~~~~~~~~~~~~~~~l~~~~~a~~~G~~~~sg~l~--G~gEt~eeri~~l~~lr~l~~~~~~v~~~~~~p  238 (328)
                      .+-+.--+.          ..    .+.++.+.+.+.++    ++  |+.-|.+|.+.-..++..-+- .+-+-+     
T Consensus       187 ilQIGARn~----------qN----f~LL~~~g~t~kPV----llKrg~~~ti~ewl~AaEyi~~~Gn-~~viLc-----  242 (352)
T PRK13396        187 VIQVGARNM----------QN----FSLLKKVGAQDKPV----LLKRGMSATIDEWLMAAEYILAAGN-PNVILC-----  242 (352)
T ss_pred             EEEECCHHH----------CC----HHHHHHHHCCCCEE----EECCCCCCCHHHHHHHHHHHHHCCC-CCEEEE-----
T ss_conf             899892540----------59----99999985469807----9737888999999869999997699-858999-----


Q ss_pred             CCCC-CCCCC-CCCCHHHHHHHHHHHHHH--CCCCC-C-EEEEHHHHHCHHHHHHHHHHCCCEEEECCEEE----CCCC-
Q ss_conf             4874-12445-687989999999999996--86872-1-42311565165689999980998899778665----1588-
Q gi|254780485|r  239 IPGS-KFEEN-KKVDPIEHVRIISVARIL--MPKSR-L-RLAAGRAMMSDELQALCFFSGANSIFVGDTLL----TAKN-  307 (328)
Q Consensus       239 ~~gt-~l~~~-~~~~~~e~lr~iAi~RL~--lP~~~-i-~i~~~~~~~~~~~~~~~L~~GaN~~~~g~~~~----t~~g-  307 (328)
                      .-|. .++.. ..-+.  +++.+.+.|-+  +|=.. . +++ |+-.+-+.+.+.++.+|||++|++-.--    -++| 
T Consensus       243 ERGirtfe~~~~Rntl--Dl~aip~~k~~thlPVi~DPSH~~-G~r~~V~~la~AAva~GaDGL~iEvHp~P~~AlSDg~  319 (352)
T PRK13396        243 ERGIRTFDRQYTRNTL--DLSVIPVLRSLTHLPIMIDPSHGT-GKSEYVPSMAMAAIAAGTDSLMIEVHPNPAKALSDGP  319 (352)
T ss_pred             ECCCCCCCCCCCCCCC--CHHHHHHHHHCCCCCEEECCCCCC-CCHHHHHHHHHHHHHHCCCEEEEEECCCCCCCCCCCC
T ss_conf             4897756676546775--578879997489998897898645-7872799999999983998899984688011578752


Q ss_pred             --CCHHHHHHHHHH
Q ss_conf             --898999999998
Q gi|254780485|r  308 --PSYNKDTILFNR  319 (328)
Q Consensus       308 --~~~~~~~~~i~~  319 (328)
                        -++++..+|+++
T Consensus       320 Q~l~p~~f~~l~~~  333 (352)
T PRK13396        320 QSLTPERFDRLMQE  333 (352)
T ss_pred             CCCCHHHHHHHHHH
T ss_conf             35899999999999


No 211
>cd04731 HisF The cyclase subunit of imidazoleglycerol phosphate synthase (HisF). Imidazole glycerol phosphate synthase (IGPS) catalyzes the fifth step of histidine biosynthesis, the formation of the imidazole ring. IGPS converts N1-(5'-phosphoribulosyl)-formimino-5-aminoimidazole-4-carboxamide ribonucleotide (PRFAR) to imidazole glycerol phosphate (ImGP) and 5'-(5-aminoimidazole-4-carboxamide) ribonucleotide (AICAR). This conversion involves two tightly coupled reactions in distinct active sites of IGPS. The two catalytic domains can be fused, like in fungi and plants, or peformed by a heterodimer (HisH-glutaminase and HisF-cyclase), like in bacteria.
Probab=79.20  E-value=4.9  Score=19.94  Aligned_cols=197  Identities=15%  Similarity=0.173  Sum_probs=106.1

Q ss_pred             HHHHHHHHHHHCCCEEEEEECCCCCCCCCCHHHHHHHHHHH-CCCCCCEEEECCCCCHHHHHHHHCCCCCEEEEECCC--
Q ss_conf             99999999996498389973036888744289999988762-136883241025699999998741576069751343--
Q gi|254780485|r   92 QVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGV-KSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDT--  168 (328)
Q Consensus        92 ei~~~a~~~~~~G~~~~~l~~~~~~~~~~~~~~~~e~i~~i-~~~~~~i~~~~g~~~~~~~~~Lk~aG~~~~~~~let--  168 (328)
                      ..++.|+...+.|+.+++++--.......  ..-.+.++.+ ++.++.+.+.-|..+.++.+++.++|++.+.++-..  
T Consensus        28 dP~~~a~~~~~~gadelhivDld~a~~g~--~~n~~~i~~i~~~~~~pi~vGGGIrs~~~~~~~l~~GadkVvigs~~~~  105 (243)
T cd04731          28 DPVELAKRYNEQGADELVFLDITASSEGR--ETMLDVVERVAEEVFIPLTVGGGIRSLEDARRLLRAGADKVSINSAAVE  105 (243)
T ss_pred             CHHHHHHHHHHCCCCEEEEECCCCCCCCC--CCHHHHHHHHHHHCCCCEEEEEEEEEHHHHHHHHHCCCCEEEECCCCCC
T ss_conf             99999999998699999997067320377--0079999999986798689985066479999999779978998984423


Q ss_pred             CHHHHHCCCCCCCHHHHHHHHHHHHHCCCC-CC-----------CEEEECCC---CCHHHHHHHHHHHHHCCCCCCEEEC
Q ss_conf             777732058888989999999999987985-57-----------70786689---8999999999999740888860205
Q gi|254780485|r  169 SERFYPHVTTTHTFEDRLQTLENVRKSGIK-VC-----------CGGILGLG---EMIDDRIDMLLTLANLSTPPESIPI  233 (328)
Q Consensus       169 ~~~~~~~~~~~~~~~~~l~~~~~a~~~G~~-~~-----------sg~l~G~g---Et~eeri~~l~~lr~l~~~~~~v~~  233 (328)
                      .|.+..++               +.+.|=+ +.           -+.++-.+   .+..+..+++..+.+++.  ..+-+
T Consensus       106 n~~~~~~~---------------~~~~Gsq~Iv~siD~k~~~~~~~~v~~~~~~~~~~~~~~~~i~~~~~~G~--geil~  168 (243)
T cd04731         106 NPELIREI---------------AKRFGSQCVVVSIDAKRRGDGGYEVYTHGGRKPTGLDAVEWAKEVEELGA--GEILL  168 (243)
T ss_pred             CCCHHHHH---------------HHHCCCCCEEEEEEEEECCCCCEEEEECCCCCCCHHHHHHHHHHHHHCCC--CEEEE
T ss_conf             77143578---------------87569930999999765378962898469844126789999999984698--78999


Q ss_pred             CCEEECCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCEEEEHHHHHCHHHHHHHHHHCCCEEEECCEEECCCCCCHHHH
Q ss_conf             41120487412445687989999999999996868721423115651656899999809988997786651588898999
Q gi|254780485|r  234 NLLIPIPGSKFEENKKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKD  313 (328)
Q Consensus       234 ~~~~p~~gt~l~~~~~~~~~e~lr~iAi~RL~lP~~~i~i~~~~~~~~~~~~~~~L~~GaN~~~~g~~~~t~~g~~~~~~  313 (328)
                       .-+-..|| +.+   + ..+.++-++- ..   +..+.+++|- +-..+.....-..|++++++|.-+ .-+.-+.++.
T Consensus       169 -tdI~~DGt-~~G---~-d~~l~~~i~~-~~---~~piI~sGGi-~~~~di~~~l~~~~~~gv~~g~~~-~~~~~~l~~~  236 (243)
T cd04731         169 -TSMDRDGT-KKG---Y-DLELIRAVSS-AV---NIPVIASGGA-GKPEHFVEAFEEGGADAALAASIF-HFGEYTIAEL  236 (243)
T ss_pred             -EEECCCCC-CCC---C-CHHHHHHHHH-HC---CCCEEEECCC-CCHHHHHHHHHHCCCEEEEEHHHH-HCCCCCHHHH
T ss_conf             -87257685-665---7-9999999998-68---9999998899-999999999987898299882276-7699899999


Q ss_pred             HHHHHH
Q ss_conf             999998
Q gi|254780485|r  314 TILFNR  319 (328)
Q Consensus       314 ~~~i~~  319 (328)
                      .+.+++
T Consensus       237 k~~L~~  242 (243)
T cd04731         237 KEYLAE  242 (243)
T ss_pred             HHHHHH
T ss_conf             999861


No 212
>PRK06015 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional
Probab=79.09  E-value=4.9  Score=19.92  Aligned_cols=181  Identities=17%  Similarity=0.177  Sum_probs=103.4

Q ss_pred             CCCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCCCCHHHHHHHHHHHCCCCCCEEEECCC-CCHHHHHHHHCCCCCEEE
Q ss_conf             0006857999999999964983899730368887442899999887621368832410256-999999987415760697
Q gi|254780485|r   85 SKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLGLETCMTLGM-LSFEQAQILSKAGLDYYN  163 (328)
Q Consensus        85 ~~~~~~Eei~~~a~~~~~~G~~~~~l~~~~~~~~~~~~~~~~e~i~~i~~~~~~i~~~~g~-~~~~~~~~Lk~aG~~~~~  163 (328)
                      .+..+.|+....++.+.+.|++-+-+..  +.+.      -.+.++.+++..+.+.+-+|. ++.+++++..++|++.+.
T Consensus        21 lr~~~~~~a~~~~~al~~gGi~~iEITl--rt~~------a~~~I~~l~~~~p~~~vGaGTVl~~e~~~~a~~aGA~FiV   92 (212)
T PRK06015         21 LLIDDVEHAVPLARALARGGLPAIEITL--RTPA------ALDAIRAVAAEVEEAIVGAGTILNAKQFEDAAKAGSRFIV   92 (212)
T ss_pred             EECCCHHHHHHHHHHHHHCCCCEEEEEC--CCCC------HHHHHHHHHHHCCCCEEEEEECCCHHHHHHHHHCCCCEEE
T ss_conf             9779999999999999987998899968--9951------9999999998699967954211569999999984998998


Q ss_pred             EECCCCHHHHHCCCCCCCHHHHHHHHHHHHHCCCCCCCEEEECCCCCHHHHHHHHHHHHHCCCCCCEEECCCEEECCCCC
Q ss_conf             51343777732058888989999999999987985577078668989999999999997408888602054112048741
Q gi|254780485|r  164 HNIDTSERFYPHVTTTHTFEDRLQTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSK  243 (328)
Q Consensus       164 ~~let~~~~~~~~~~~~~~~~~l~~~~~a~~~G~~~~sg~l~G~gEt~eeri~~l~~lr~l~~~~~~v~~~~~~p~~gt~  243 (328)
                           +|        ..+    .++++.+++.|++.-.|.+     |+-|...-+    +.+.  ..+-   |+|..   
T Consensus        93 -----SP--------~~~----~~v~~~a~~~~i~~iPGv~-----TpsEi~~A~----~~G~--~~vK---lFPA~---  138 (212)
T PRK06015         93 -----SP--------GTT----QELLAAANDSDVPLLPGAI-----TPSEVMALR----EEGY--TVLK---FFPAE---  138 (212)
T ss_pred             -----CC--------CCC----HHHHHHHHHCCCCEECCCC-----CHHHHHHHH----HCCC--CEEE---ECCCC---
T ss_conf             -----58--------999----9999999983997737869-----999999999----8799--9899---78430---


Q ss_pred             CCCCCCCCHHHHHHHHHHHHHHCCCCCCEEEEHHHHHCHHHHHHHHHHCCCEEEECCEEECCC----CCCHHHHHHHHHH
Q ss_conf             244568798999999999999686872142311565165689999980998899778665158----8898999999998
Q gi|254780485|r  244 FEENKKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAK----NPSYNKDTILFNR  319 (328)
Q Consensus       244 l~~~~~~~~~e~lr~iAi~RL~lP~~~i~i~~~~~~~~~~~~~~~L~~GaN~~~~g~~~~t~~----g~~~~~~~~~i~~  319 (328)
                           ....-.++|-+   +=-+|+..+.-++|   +..+....-|.+| |....|+..+...    ....+++.+..++
T Consensus       139 -----~~gG~~~lkal---~~p~p~~~~~ptGG---V~~~N~~~yl~~~-~v~~vgGs~l~~~~~i~~~dw~~I~~~a~e  206 (212)
T PRK06015        139 -----QAGGAAFLKAL---SSPLAGTFFCPTGG---ISLKNARDYLSLP-NVVCVGGSWVAPKELVAAGDWAAITKLAAE  206 (212)
T ss_pred             -----CCCCHHHHHHH---HCCCCCCCEEECCC---CCHHHHHHHHCCC-CEEEEECHHHCCHHHHHCCCHHHHHHHHHH
T ss_conf             -----01689999998---57799998886289---8988899998089-819998835389999971899999999999


No 213
>COG0106 HisA Phosphoribosylformimino-5-aminoimidazole carboxamide ribonucleotide (ProFAR) isomerase [Amino acid transport and metabolism]
Probab=79.03  E-value=4.9  Score=19.90  Aligned_cols=196  Identities=15%  Similarity=0.136  Sum_probs=96.0

Q ss_pred             HHHHHHHHHHHHCCCEEEEEECC--CCCCCCCCHHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHCCCCCEEEEECCC
Q ss_conf             79999999999649838997303--6888744289999988762136883241025699999998741576069751343
Q gi|254780485|r   91 DQVLKEAKNAKENGATRYCMGAA--WREPKERDLSIIVDMIKGVKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDT  168 (328)
Q Consensus        91 Eei~~~a~~~~~~G~~~~~l~~~--~~~~~~~~~~~~~e~i~~i~~~~~~i~~~~g~~~~~~~~~Lk~aG~~~~~~~let  168 (328)
                      +...+.|+.-.+.|++.+|++--  -........+.+.++++   .....+.+.-|..+.+..+.|.++|++++.+.--.
T Consensus        31 ~~P~~~a~~~~~~Ga~~lHlVDLdgA~~g~~~n~~~i~~i~~---~~~~~vQvGGGIRs~~~v~~ll~~G~~rViiGt~a  107 (241)
T COG0106          31 DDPLEVAKKWSDQGAEWLHLVDLDGAKAGGPRNLEAIKEILE---ATDVPVQVGGGIRSLEDVEALLDAGVARVIIGTAA  107 (241)
T ss_pred             CCHHHHHHHHHHCCCCEEEEEECCCCCCCCCCCHHHHHHHHH---HCCCCEEEECCCCCHHHHHHHHHCCCCEEEEECCE
T ss_conf             998999999998099589886266321587554999999998---57997784087678999999998799889980312


Q ss_pred             --CHHHHHCCCCCCCHHHHHHHHHHHHHCCCCCCCEEE--EC--CCCCHH-----HHHHHHHHHHHCCCCCCEEECCCEE
Q ss_conf             --777732058888989999999999987985577078--66--898999-----9999999997408888602054112
Q gi|254780485|r  169 --SERFYPHVTTTHTFEDRLQTLENVRKSGIKVCCGGI--LG--LGEMID-----DRIDMLLTLANLSTPPESIPINLLI  237 (328)
Q Consensus       169 --~~~~~~~~~~~~~~~~~l~~~~~a~~~G~~~~sg~l--~G--~gEt~e-----eri~~l~~lr~l~~~~~~v~~~~~~  237 (328)
                        .|++..               +.+++.|-++-.+.=  -|  ..+.|.     +..+.+..+.+.+.  ..|- .-=+
T Consensus       108 v~~p~~v~---------------~~~~~~g~rivv~lD~r~g~vav~GW~e~s~~~~~~l~~~~~~~g~--~~ii-~TdI  169 (241)
T COG0106         108 VKNPDLVK---------------ELCEEYGDRIVVALDARDGKVAVSGWQEDSGVELEELAKRLEEVGL--AHIL-YTDI  169 (241)
T ss_pred             ECCHHHHH---------------HHHHHCCCCEEEEEECCCCCCCCCCCHHCCCCCHHHHHHHHHHCCC--CEEE-EEEC
T ss_conf             16999999---------------9999859828999971488532046101256789999999985787--7699-9851


Q ss_pred             ECCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCEEEEHHHHHCHHHHHHHHHH-CCCEEEECCEEECCCCCCHHHHHHH
Q ss_conf             048741244568798999999999999686872142311565165689999980-9988997786651588898999999
Q gi|254780485|r  238 PIPGSKFEENKKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFS-GANSIFVGDTLLTAKNPSYNKDTIL  316 (328)
Q Consensus       238 p~~gt~l~~~~~~~~~e~lr~iAi~RL~lP~~~i~i~~~~~~~~~~~~~~~L~~-GaN~~~~g~~~~t~~g~~~~~~~~~  316 (328)
                      ...|| |.+   ++.+-+.+.....     +..+..|+| .+--.|...+ -.. |+.+.++|--+ -.+.-+.++..+.
T Consensus       170 ~~DGt-l~G---~n~~l~~~l~~~~-----~ipviaSGG-v~s~~Di~~l-~~~~G~~GvIvG~AL-y~g~~~l~ea~~~  237 (241)
T COG0106         170 SRDGT-LSG---PNVDLVKELAEAV-----DIPVIASGG-VSSLDDIKAL-KELSGVEGVIVGRAL-YEGKFTLEEALAC  237 (241)
T ss_pred             CCCCC-CCC---CCHHHHHHHHHHH-----CCCEEEECC-CCCHHHHHHH-HHCCCCCEEEEEHHH-HCCCCCHHHHHHH
T ss_conf             44664-577---7879999999982-----767898668-6879999999-855797289986689-6489789999999


Q ss_pred             HHH
Q ss_conf             998
Q gi|254780485|r  317 FNR  319 (328)
Q Consensus       317 i~~  319 (328)
                      ++.
T Consensus       238 ~~~  240 (241)
T COG0106         238 VRN  240 (241)
T ss_pred             HHC
T ss_conf             862


No 214
>PRK06857 consensus
Probab=78.19  E-value=5.2  Score=19.74  Aligned_cols=181  Identities=14%  Similarity=0.133  Sum_probs=104.7

Q ss_pred             CCCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCCCCHHHHHHHHHHHCCCCCCEEEECCC-CCHHHHHHHHCCCCCEEE
Q ss_conf             0006857999999999964983899730368887442899999887621368832410256-999999987415760697
Q gi|254780485|r   85 SKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLGLETCMTLGM-LSFEQAQILSKAGLDYYN  163 (328)
Q Consensus        85 ~~~~~~Eei~~~a~~~~~~G~~~~~l~~~~~~~~~~~~~~~~e~i~~i~~~~~~i~~~~g~-~~~~~~~~Lk~aG~~~~~  163 (328)
                      .+..+.|+....++.+.+.|++-+-+....  +.      -.+.++.+++..+.+.+-+|. ++.++++...++|++.+.
T Consensus        18 ir~~~~~~a~~~~~al~~gGi~~iEiTlrt--~~------a~~~I~~l~~~~p~~~vGaGTV~~~e~~~~a~~aGA~FiV   89 (209)
T PRK06857         18 IAIDDAEDILPLAKVLAENGLPVAEITFRS--AA------AAEAIRLLREAYPDMLIGAGTVLTPEQVDAAKEAGADFIV   89 (209)
T ss_pred             EECCCHHHHHHHHHHHHHCCCCEEEEECCC--CC------HHHHHHHHHHHCCCCEEEEEECCCHHHHHHHHHCCCCEEE
T ss_conf             975999999999999998799889995899--32------9999999997589948999937679999999983999999


Q ss_pred             EECCCCHHHHHCCCCCCCHHHHHHHHHHHHHCCCCCCCEEEECCCCCHHHHHHHHHHHHHCCCCCCEEECCCEEECCCCC
Q ss_conf             51343777732058888989999999999987985577078668989999999999997408888602054112048741
Q gi|254780485|r  164 HNIDTSERFYPHVTTTHTFEDRLQTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSK  243 (328)
Q Consensus       164 ~~let~~~~~~~~~~~~~~~~~l~~~~~a~~~G~~~~sg~l~G~gEt~eeri~~l~~lr~l~~~~~~v~~~~~~p~~gt~  243 (328)
                           +|        ..+    -++++.+++.|++.-.|.+     |+-|...-+    +.+.  ..+-   |+|..   
T Consensus        90 -----SP--------~~~----~~v~~~a~~~~i~~iPGv~-----TpsEi~~A~----~~G~--~~vK---lFPA~---  135 (209)
T PRK06857         90 -----SP--------GFN----PNTVKYCQQLNIPIVPGVN-----NPSLVEQAL----EMGL--TTLK---FFPAE---  135 (209)
T ss_pred             -----CC--------CCC----HHHHHHHHHCCCCEECCCC-----CHHHHHHHH----HCCC--CEEE---ECCCC---
T ss_conf             -----08--------999----9999999974996547879-----999999999----8799--9899---78662---


Q ss_pred             CCCCCCCCHHHHHHHHHHHHHHCCCCCCEEEEHHHHHCHHHHHHHHHHCCCEEEECC-EEECC---CCCCHHHHHHHHHH
Q ss_conf             244568798999999999999686872142311565165689999980998899778-66515---88898999999998
Q gi|254780485|r  244 FEENKKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGD-TLLTA---KNPSYNKDTILFNR  319 (328)
Q Consensus       244 l~~~~~~~~~e~lr~iAi~RL~lP~~~i~i~~~~~~~~~~~~~~~L~~GaN~~~~g~-~~~t~---~g~~~~~~~~~i~~  319 (328)
                           ...+..|+|-   .|=-+|+..+.-++|   +..+...--|.+|+ ....|+ .+...   .....+++.+..++
T Consensus       136 -----~~gG~~~lka---l~~p~p~~~~~ptGG---V~~~N~~~yl~~~~-v~~~gGS~l~~~~~i~~~d~~~I~~~a~~  203 (209)
T PRK06857        136 -----ASGGVNMLKA---LLAPYPNLQIMPTGG---INPSNIKDYLAIPN-VVACGGTWMVPKKLIDNGNWDEIGRLVRE  203 (209)
T ss_pred             -----CCCCHHHHHH---HHCCCCCCEEEECCC---CCHHHHHHHHCCCC-EEEEECHHHCCHHHHHCCCHHHHHHHHHH
T ss_conf             -----1266999999---865389980996489---88878999985998-89998936589999972899999999999


No 215
>cd00740 MeTr MeTr subgroup of pterin binding enzymes. This family includes cobalamin-dependent methyltransferases such as methyltetrahydrofolate, corrinoid iron-sulfur protein methyltransferase (MeTr) and methionine synthase (MetH).  Cobalamin-dependent methyltransferases catalyze the transfer of a methyl group via a methyl- cob(III)amide intermediate.  These include MeTr, a functional heterodimer, and the folate binding domain of MetH.
Probab=77.46  E-value=5.4  Score=19.60  Aligned_cols=196  Identities=15%  Similarity=0.195  Sum_probs=101.1

Q ss_pred             CCCHHHHHHHHHHHHHCCCEEEEEECCCCC-CCCCCHHHHHHHHHHHCCCCCCEEEECCCCCHHHHH-HHHCCCCCEEEE
Q ss_conf             068579999999999649838997303688-874428999998876213688324102569999999-874157606975
Q gi|254780485|r   87 LINVDQVLKEAKNAKENGATRYCMGAAWRE-PKERDLSIIVDMIKGVKSLGLETCMTLGMLSFEQAQ-ILSKAGLDYYNH  164 (328)
Q Consensus        87 ~~~~Eei~~~a~~~~~~G~~~~~l~~~~~~-~~~~~~~~~~e~i~~i~~~~~~i~~~~g~~~~~~~~-~Lk~aG~~~~~~  164 (328)
                      --+.+.+++.|++-.+.|+.-+-+-.+... +....+.+++..+...  ....+++  ...+.+.++ .|+...-. -.+
T Consensus        22 ~~d~~~i~~~A~~Q~~~GA~~LDVN~g~~~~de~~~M~~~v~~vq~~--~~~Pl~i--DS~~~~~iEaaLk~~~Gr-~iI   96 (252)
T cd00740          22 AEDYDEALDVARQQVEGGAQILDLNVDYGGLDGVSAMKWLLNLLATE--PTVPLML--DSTNWEVIEAGLKCCQGK-CVV   96 (252)
T ss_pred             CCCHHHHHHHHHHHHHCCCCEEEECCCCCCCCHHHHHHHHHHHHHCC--CCCCEEE--ECCCHHHHHHHHHHCCCC-EEE
T ss_conf             57989999999999984998899528964536599999999998547--8998576--179899999999976998-677


Q ss_pred             ECCCCHHHHHCCCCCCCHHHHH-HHHHHHHHCCCCCCCEEE--ECCCCCHHHHHHHHHHHHHCC-----CCCCEEECCCE
Q ss_conf             1343777732058888989999-999999987985577078--668989999999999997408-----88860205411
Q gi|254780485|r  165 NIDTSERFYPHVTTTHTFEDRL-QTLENVRKSGIKVCCGGI--LGLGEMIDDRIDMLLTLANLS-----TPPESIPINLL  236 (328)
Q Consensus       165 ~let~~~~~~~~~~~~~~~~~l-~~~~~a~~~G~~~~sg~l--~G~gEt~eeri~~l~~lr~l~-----~~~~~v~~~~~  236 (328)
                      |  +       + .-...++++ +.+..|++.|-.+-+-.+  =|+-+|.++|++...++-+.-     ..++-+.+=++
T Consensus        97 N--S-------i-s~e~g~er~~~i~pLakkyga~vI~L~~de~Gip~t~e~R~~ia~~i~~~~~~~~Gi~~edI~~DpL  166 (252)
T cd00740          97 N--S-------I-NLEDGEERFLKVARLAKEHGAAVVVLAFDEQGQAKTRDKKVEIAERAYEALTEFVGFPPEDIIFDPL  166 (252)
T ss_pred             E--C-------C-CCCCCHHHHHHHHHHHHHCCCEEEEEEECCCCCCCCHHHHHHHHHHHHHHHHHHCCCCHHHEEEECC
T ss_conf             4--1-------6-3445488999999999870998999952899998999999999999999999856998899788663


Q ss_pred             EECCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCEEEEHHHHHC----------HHHHHHHHHHCCCEEEE
Q ss_conf             204874124456879899999999999968687214231156516----------56899999809988997
Q gi|254780485|r  237 IPIPGSKFEENKKVDPIEHVRIISVARILMPKSRLRLAAGRAMMS----------DELQALCFFSGANSIFV  298 (328)
Q Consensus       237 ~p~~gt~l~~~~~~~~~e~lr~iAi~RL~lP~~~i~i~~~~~~~~----------~~~~~~~L~~GaN~~~~  298 (328)
                      +..-+|-.+. ......+++++|...|=-+|++.+...-|-.+-|          .-+-.+++.+|-|+-++
T Consensus       167 v~pi~tg~e~-~~~~~~~tleaI~~ik~~~P~~~t~~GlSNiSFGl~~p~R~~lNs~FL~~a~~~GLd~AI~  237 (252)
T cd00740         167 ILPIATGIEE-HRPYALETIDAIRMIKERLPAVKISLGVSNVSFGFNPAAREALNSVFLYEAIKAGLDMAIV  237 (252)
T ss_pred             HHHHHCCCHH-HHHHHHHHHHHHHHHHHHCCCCCEEEEEEHHCCCCCHHHHHHHHHHHHHHHHHCCCCCEEC
T ss_conf             5776457467-8889999999999999878998377885221178882689999999999999859973003


No 216
>PRK08673 3-deoxy-7-phosphoheptulonate synthase; Reviewed
Probab=76.54  E-value=5.8  Score=19.44  Aligned_cols=202  Identities=18%  Similarity=0.266  Sum_probs=105.5

Q ss_pred             CCHHHHHHHHHHHHHCCCEEEEEECCCCCCCCCC--H----HHHHHHHHHHC-CCCCCEEEECCCCCHHHHHHHHCCCCC
Q ss_conf             6857999999999964983899730368887442--8----99999887621-368832410256999999987415760
Q gi|254780485|r   88 INVDQVLKEAKNAKENGATRYCMGAAWREPKERD--L----SIIVDMIKGVK-SLGLETCMTLGMLSFEQAQILSKAGLD  160 (328)
Q Consensus        88 ~~~Eei~~~a~~~~~~G~~~~~l~~~~~~~~~~~--~----~~~~e~i~~i~-~~~~~i~~~~g~~~~~~~~~Lk~aG~~  160 (328)
                      -|.|++++.|+..++.|++-+. ++.+ .|..++  |    +.=+++++.++ +.++.+...  .++.+++..+.+. +|
T Consensus       104 Es~eq~~~~A~~vk~~ga~~lR-gGa~-KPRTsPysFqGlg~eGL~~L~~~~~e~GlpvvTE--V~~~~~ve~v~~~-vD  178 (335)
T PRK08673        104 ESEEQILEIARAVKEAGAQILR-GGAF-KPRTSPYSFQGLGEEGLKLLAEAREETGLPIVTE--VMDPRDVELVAEY-AD  178 (335)
T ss_pred             CCHHHHHHHHHHHHHCCCCEEC-CCCC-CCCCCCCCCCCCCHHHHHHHHHHHHHHCCCEEEE--ECCHHHHHHHHHH-CC
T ss_conf             8799999999999977996880-6665-7899985414551669999999999869952899--6689999999964-97


Q ss_pred             EEEEECCCCHHHHHCCCCCCCHHHHHHHHHHHHHCCCCCCCEEEE--CCCCCHHHHHHHHHHHHHCCCCCCEEECCCEEE
Q ss_conf             697513437777320588889899999999999879855770786--689899999999999974088886020541120
Q gi|254780485|r  161 YYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSGIKVCCGGIL--GLGEMIDDRIDMLLTLANLSTPPESIPINLLIP  238 (328)
Q Consensus       161 ~~~~~let~~~~~~~~~~~~~~~~~l~~~~~a~~~G~~~~sg~l~--G~gEt~eeri~~l~~lr~l~~~~~~v~~~~~~p  238 (328)
                      .+-+.--...          .    .+.++.+.+.+.++    ++  |+.-|.+|.+.-..++..-+- .+-+-+     
T Consensus       179 ilQIGARnmq----------N----~~LL~evg~~~kPV----llKrg~~~ti~ewl~AaEyi~~~Gn-~~ViLc-----  234 (335)
T PRK08673        179 ILQIGARNMQ----------N----FDLLKEVGKTNKPV----LLKRGMSATIEEWLMAAEYILAEGN-PNVILC-----  234 (335)
T ss_pred             EEEECHHHHC----------C----HHHHHHHHHHCCEE----EECCCCCCCHHHHHHHHHHHHHCCC-CCEEEE-----
T ss_conf             9998915505----------9----99999999729948----9737887889999878999997699-867999-----


Q ss_pred             CCCC-CCCCCCCCCHHHHHHHHHHHHHH--CCCC-CCEEEEHHHHHCHHHHHHHHHHCCCEEEECCEEE----CCCC---
Q ss_conf             4874-12445687989999999999996--8687-2142311565165689999980998899778665----1588---
Q gi|254780485|r  239 IPGS-KFEENKKVDPIEHVRIISVARIL--MPKS-RLRLAAGRAMMSDELQALCFFSGANSIFVGDTLL----TAKN---  307 (328)
Q Consensus       239 ~~gt-~l~~~~~~~~~e~lr~iAi~RL~--lP~~-~i~i~~~~~~~~~~~~~~~L~~GaN~~~~g~~~~----t~~g---  307 (328)
                      .-|. .++....-+.  +++.+.+.|=.  +|=. .+.=++|+-.+-+.+.+.++.+|||++|++-.--    -++|   
T Consensus       235 ERGirtfe~~tRntl--Dl~aip~~k~~thlPVI~DPSH~~G~r~~V~~la~aAiAaGaDGL~iEvHp~P~~AlSDg~Q~  312 (335)
T PRK08673        235 ERGIRTFETATRNTL--DLSAVPVLKKLTHLPVIVDPSHATGKRDLVEPLALAAVAAGADGLIVEVHPDPEKALSDGPQS  312 (335)
T ss_pred             ECCCCCCCCCCCCCC--CHHHHHHHHHCCCCCEEECCCCCCCCHHHHHHHHHHHHHCCCCEEEEEECCCHHHCCCCCCCC
T ss_conf             346545676667877--878889997188988898882203633228999999998099889999568812146874236


Q ss_pred             CCHHHHHHHHHHC
Q ss_conf             8989999999982
Q gi|254780485|r  308 PSYNKDTILFNRL  320 (328)
Q Consensus       308 ~~~~~~~~~i~~~  320 (328)
                      -++++..+|++++
T Consensus       313 l~p~~f~~l~~~l  325 (335)
T PRK08673        313 LTPEEFEELMKKL  325 (335)
T ss_pred             CCHHHHHHHHHHH
T ss_conf             8999999999999


No 217
>PRK13117 consensus
Probab=76.32  E-value=5.8  Score=19.40  Aligned_cols=185  Identities=14%  Similarity=0.059  Sum_probs=106.3

Q ss_pred             CHHHHHHHHHHHHHCCCEEEEEECCCCCCCC-----------------CCHHHHHHHHHHHCCCCC---CEEEE---C-C
Q ss_conf             8579999999999649838997303688874-----------------428999998876213688---32410---2-5
Q gi|254780485|r   89 NVDQVLKEAKNAKENGATRYCMGAAWREPKE-----------------RDLSIIVDMIKGVKSLGL---ETCMT---L-G  144 (328)
Q Consensus        89 ~~Eei~~~a~~~~~~G~~~~~l~~~~~~~~~-----------------~~~~~~~e~i~~i~~~~~---~i~~~---~-g  144 (328)
                      +.|.-++.++.+.+.|+.-+-++ -...++.                 -.++.+.++++.+++...   .+.+.   + .
T Consensus        29 ~~~~t~~~~~~l~~~GaDiiElG-iPfSDP~ADGpvIq~A~~rAL~~G~~~~~~~~~~~~ir~~~~~~pivlM~Y~N~i~  107 (268)
T PRK13117         29 SPELSLKIIDTLIEAGADALELG-IPFSDPLADGPTIQNANLRALAAGVTPAQCFELLAKIRAKYPTIPIGLLLYANLVF  107 (268)
T ss_pred             CHHHHHHHHHHHHHCCCCEEEEC-CCCCCCCCCCHHHHHHHHHHHHCCCCHHHHHHHHHHHHCCCCCCCEEEEECCCHHH
T ss_conf             97999999999996699989978-99888565579999999999845996999999998850047898779973262898


Q ss_pred             CC-CHHHHHHHHCCCCCEEEEECCCCHHHHHCCCCCCCHHHHHHHHHHHHHCCCCCCCEEEECCCCCHHHHHHHHHHHHH
Q ss_conf             69-99999987415760697513437777320588889899999999999879855770786689899999999999974
Q gi|254780485|r  145 ML-SFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLAN  223 (328)
Q Consensus       145 ~~-~~~~~~~Lk~aG~~~~~~~let~~~~~~~~~~~~~~~~~l~~~~~a~~~G~~~~sg~l~G~gEt~eeri~~l~~lr~  223 (328)
                      .. .+.-+++.+++|++.+++             |.-.+++--+..+.+++.|+..-  .++- --|.++|+..+.....
T Consensus       108 ~~G~e~F~~~~~~aGvdGvIi-------------pDLP~eE~~~~~~~~~~~gl~~I--~lv~-Ptt~~~Ri~~i~~~a~  171 (268)
T PRK13117        108 ANGIDNFYARCAEAGVDSVLI-------------ADVPVEESAPFRQAAKKHGIAPI--FICP-PNADDDTLRQIASLGR  171 (268)
T ss_pred             HCCHHHHHHHHHHCCCCEEEE-------------CCCCHHHHHHHHHHHHHCCCCEE--EEEC-CCCCHHHHHHHHHHCC
T ss_conf             717999999999769877985-------------79997885899999986798379--9847-9999999999997479


Q ss_pred             CCCCCCEEECCCEEECCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCEEEEHHHHHCHHHHHHHHHHCCCEEEECCEEE
Q ss_conf             08888602054112048741244568798999999999999686872142311565165689999980998899778665
Q gi|254780485|r  224 LSTPPESIPINLLIPIPGSKFEENKKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLL  303 (328)
Q Consensus       224 l~~~~~~v~~~~~~p~~gt~l~~~~~~~~~e~lr~iAi~RL~lP~~~i~i~~~~~~~~~~~~~~~L~~GaN~~~~g~~~~  303 (328)
                           .++   ..+...|+.-..  ...+.+....+.-.|-+-   .+++..|-.--.++..+..+..|||++++|..++
T Consensus       172 -----GFi---Y~vs~~GvTG~~--~~~~~~~~~~i~~ik~~t---~~Pv~vGFGIs~~e~v~~~~~~~aDGvIVGSaiV  238 (268)
T PRK13117        172 -----GYT---YLLSRAGVTGAE--NKAAAPLNHLVEKLKEYN---APPPLQGFGISEPEQVKAAIKAGAAGAISGSAIV  238 (268)
T ss_pred             -----CEE---EEEECCCCCCCC--CCCCHHHHHHHHHHHHCC---CCCEEEEECCCCHHHHHHHHHCCCCEEEECHHHH
T ss_conf             -----859---998367778898--666277999999999647---9986998378999999999863899899878999


No 218
>PRK08904 consensus
Probab=76.17  E-value=5.9  Score=19.37  Aligned_cols=182  Identities=18%  Similarity=0.155  Sum_probs=103.6

Q ss_pred             CCCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCCCCHHHHHHHHHHHCCCCCCEEEECCC-CCHHHHHHHHCCCCCEEE
Q ss_conf             0006857999999999964983899730368887442899999887621368832410256-999999987415760697
Q gi|254780485|r   85 SKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLGLETCMTLGM-LSFEQAQILSKAGLDYYN  163 (328)
Q Consensus        85 ~~~~~~Eei~~~a~~~~~~G~~~~~l~~~~~~~~~~~~~~~~e~i~~i~~~~~~i~~~~g~-~~~~~~~~Lk~aG~~~~~  163 (328)
                      .+..+.|+.+..++.+.+.|++-+-+..  +.+      .-.+.++.+++..+.+.+-+|. ++.+++++..++|++.+.
T Consensus        16 ir~~~~~~a~~~a~al~~~Gi~~iEiTl--rtp------~a~~~i~~l~~~~p~~~vGaGTVl~~e~~~~a~~aGA~FiV   87 (207)
T PRK08904         16 MAIDDLSTAVDLSRALVEGGIPTLEITL--RTP------VGLDAIRLIAKEVPNAIVGAGTVTNPEQLKAVEDAGAVFAI   87 (207)
T ss_pred             EECCCHHHHHHHHHHHHHCCCCEEEEEC--CCC------HHHHHHHHHHHHCCCCEEEEEECCCHHHHHHHHHCCCCEEE
T ss_conf             9769999999999999987998899957--991------39999999998689876855313689999999984999998


Q ss_pred             EECCCCHHHHHCCCCCCCHHHHHHHHHHHHHCCCCCCCEEEECCCCCHHHHHHHHHHHHHCCCCCCEEECCCEEECCCCC
Q ss_conf             51343777732058888989999999999987985577078668989999999999997408888602054112048741
Q gi|254780485|r  164 HNIDTSERFYPHVTTTHTFEDRLQTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSK  243 (328)
Q Consensus       164 ~~let~~~~~~~~~~~~~~~~~l~~~~~a~~~G~~~~sg~l~G~gEt~eeri~~l~~lr~l~~~~~~v~~~~~~p~~gt~  243 (328)
                           +|        ..+    -++++.+++.|++.-.|.+     |+-|...-+    +.+.  ..+-   |+|  .. 
T Consensus        88 -----SP--------~~~----~~v~~~a~~~~i~~iPGv~-----TpsEi~~A~----~~G~--~~vK---~FP--A~-  133 (207)
T PRK08904         88 -----SP--------GLH----ESLAKAGHNSGIPLIPGVA-----TPGEIQLAL----EHGI--DTLK---LFP--AE-  133 (207)
T ss_pred             -----CC--------CCC----HHHHHHHHHCCCCEECCCC-----CHHHHHHHH----HCCC--CEEE---ECC--CH-
T ss_conf             -----48--------998----9999999983997657869-----999999999----8799--9899---776--22-


Q ss_pred             CCCCCCCCHHHHHHHHHHHHHHCCCCCCEEEEHHHHHCHHHHHHHHHHCCCEEEECCEEECC----CCCCHHHHHHHHHH
Q ss_conf             24456879899999999999968687214231156516568999998099889977866515----88898999999998
Q gi|254780485|r  244 FEENKKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTA----KNPSYNKDTILFNR  319 (328)
Q Consensus       244 l~~~~~~~~~e~lr~iAi~RL~lP~~~i~i~~~~~~~~~~~~~~~L~~GaN~~~~g~~~~t~----~g~~~~~~~~~i~~  319 (328)
                           ......++|.+   +=.+|+..+.-++| +  ..+....-|.. .|....|+..+..    .....+++.+..++
T Consensus       134 -----~~GG~~~lkal---~~pfp~i~~~pTGG-V--~~~N~~~yl~~-~~v~~vgGS~l~~~~~i~~~d~~~I~~~a~~  201 (207)
T PRK08904        134 -----VVGGKAMLKAL---YGPYADVRFCPTGG-I--SLATAPEYLAL-PNVLCVGGSWLTPKEAVKNKDWDTITRLAKE  201 (207)
T ss_pred             -----HCCCHHHHHHH---HCCCCCCEEEECCC-C--CHHHHHHHHHC-CCEEEEECHHHCCHHHHHCCCHHHHHHHHHH
T ss_conf             -----20889999987---46599980886589-8--98789999818-9849998814389999974899999999999


Q ss_pred             C
Q ss_conf             2
Q gi|254780485|r  320 L  320 (328)
Q Consensus       320 ~  320 (328)
                      +
T Consensus       202 a  202 (207)
T PRK08904        202 A  202 (207)
T ss_pred             H
T ss_conf             9


No 219
>PRK13352 thiamine biosynthesis protein ThiC; Provisional
Probab=76.08  E-value=5.9  Score=19.36  Aligned_cols=194  Identities=16%  Similarity=0.167  Sum_probs=93.6

Q ss_pred             CCCCCCCCCCCCCCCC-----CCCCCCCCHHHHHHHHHHHHHCCCEEEEE-ECCCC------------CCCCCCH-----
Q ss_conf             3423212433547775-----64100068579999999999649838997-30368------------8874428-----
Q gi|254780485|r   66 PENCGYCNQSVHNKSK-----LKASKLINVDQVLKEAKNAKENGATRYCM-GAAWR------------EPKERDL-----  122 (328)
Q Consensus        66 ~~~C~fCaf~~~~~~~-----~~~~~~~~~Eei~~~a~~~~~~G~~~~~l-~~~~~------------~~~~~~~-----  122 (328)
                      ..+++.|+....-++.     ..-....+.|+=+++++.+.+.|+-.+.- .+|+.            +.+...+     
T Consensus        48 ~~~~~p~~IG~glrtKVNaNIGtS~~~~d~~~E~eK~~~A~~~GADtiMDLStGGdl~~iR~~il~~s~vpvGTVPiYqa  127 (433)
T PRK13352         48 HRNLKPVGIGEGLRTKVNANIGTSSDISDIEEELEKAKVAVKYGADTIMDLSTGGDLDEIRRAIIEASPVPVGTVPIYQA  127 (433)
T ss_pred             CCCCCEEEECCCCEEEEEECCCCCCCCCCHHHHHHHHHHHHHHCCCEEEECCCCCCHHHHHHHHHHCCCCCCCCHHHHHH
T ss_conf             89887048656864689711168988798899999999999829985786577746699999999649988678019999


Q ss_pred             ----------------HHHHHHHHHHCCCCC-CEEEECCCCCHHHHHHHHCCC----CCEE---------EEECCCCH--
Q ss_conf             ----------------999998876213688-324102569999999874157----6069---------75134377--
Q gi|254780485|r  123 ----------------SIIVDMIKGVKSLGL-ETCMTLGMLSFEQAQILSKAG----LDYY---------NHNIDTSE--  170 (328)
Q Consensus       123 ----------------~~~~e~i~~i~~~~~-~i~~~~g~~~~~~~~~Lk~aG----~~~~---------~~~let~~--  170 (328)
                                      +.+++.++.--+.++ .+.+++|. +.+.+.++++.|    +-+-         .++-.-+|  
T Consensus       128 ~~~~~~~~~~~~~mt~d~~f~~ie~qa~~GVDfmTiH~Gi-~~~~~~~~~~~~R~~giVSRGGs~l~~WM~~n~~ENPly  206 (433)
T PRK13352        128 AIEAARKYGSIVDMTEDDLFDVIEKQAKDGVDFMTIHCGV-TRETLERLKKSGRIMGIVSRGGSFLAAWMLHNNKENPLY  206 (433)
T ss_pred             HHHHHHHCCCHHHCCHHHHHHHHHHHHHHCCCEEEECCCC-HHHHHHHHHHCCCCCCEECCCHHHHHHHHHHCCCCCCHH
T ss_conf             9999880599555999999999999997189879962022-399999998458703513157299999999747758346


Q ss_pred             HHH-----------------HCCCCCC-----C---HHHHH---HHHHHHHHCCCCCCCEEEECCCCCHHHHH-HHHHHH
Q ss_conf             773-----------------2058888-----9---89999---99999998798557707866898999999-999999
Q gi|254780485|r  171 RFY-----------------PHVTTTH-----T---FEDRL---QTLENVRKSGIKVCCGGILGLGEMIDDRI-DMLLTL  221 (328)
Q Consensus       171 ~~~-----------------~~~~~~~-----~---~~~~l---~~~~~a~~~G~~~~sg~l~G~gEt~eeri-~~l~~l  221 (328)
                      +.|                 .-.+|+.     +   +.+.+   +..++|++.|.++   |+=|.|.-+-+-+ ..+...
T Consensus       207 e~fD~lLeI~~~yDVtlSLGDglRPG~i~DA~D~aQi~EL~~lgeL~~rA~e~gVQv---MvEGPGHvPl~~I~~nv~l~  283 (433)
T PRK13352        207 EHFDYLLEILKEYDVTLSLGDGLRPGCIADATDRAQIQELITLGELTKRAREAGVQV---MVEGPGHVPLDQIEANVKLQ  283 (433)
T ss_pred             HHHHHHHHHHHHCCEEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCE---EEECCCCCCHHHHHHHHHHH
T ss_conf             609999999997493687147778875466773889999999999999999839988---98799987789999999999


Q ss_pred             HHCCCCCCEEECCCEEECC-----------------------------CCCCCCCCCCCHHHHHHHHHHHHHHC
Q ss_conf             7408888602054112048-----------------------------74124456879899999999999968
Q gi|254780485|r  222 ANLSTPPESIPINLLIPIP-----------------------------GSKFEENKKVDPIEHVRIISVARILM  266 (328)
Q Consensus       222 r~l~~~~~~v~~~~~~p~~-----------------------------gt~l~~~~~~~~~e~lr~iAi~RL~l  266 (328)
                      +++-.   ..|+..|-|..                             =||-++..-|+.++.-.=+-.+||.-
T Consensus       284 K~lc~---~APfYvLGPLvTDiApGYDHItsAIGgAiAa~~GAdfLCYVTPaEHL~LP~~eDVreGviA~kIAA  354 (433)
T PRK13352        284 KELCH---GAPFYVLGPLVTDIAPGYDHITSAIGGAIAAAAGADFLCYVTPAEHLGLPNVEDVREGVIASKIAA  354 (433)
T ss_pred             HHHHC---CCCCEECCCCCCCCCCCCHHHHHHHHHHHHHHCCCCEEEECCCHHHCCCCCHHHHHHHHHHHHHHH
T ss_conf             99617---998000286100367772088899999999864776375058088548999899999999999999


No 220
>cd01320 ADA Adenosine deaminase (ADA) is a monomeric zinc dependent enzyme which catalyzes the irreversible hydrolytic deamination of both adenosine, as well as desoxyadenosine, to ammonia and inosine or desoxyinosine, respectively. ADA plays an important role in the purine pathway. Low, as well as high levels of ADA activity have been linked to several diseases.
Probab=75.98  E-value=6  Score=19.34  Aligned_cols=22  Identities=14%  Similarity=0.375  Sum_probs=11.8

Q ss_pred             CHHHHHHHHHHHHHCCCCCCCE
Q ss_conf             9899999999999879855770
Q gi|254780485|r  181 TFEDRLQTLENVRKSGIKVCCG  202 (328)
Q Consensus       181 ~~~~~l~~~~~a~~~G~~~~sg  202 (328)
                      ++.++....+.|++.|++++.+
T Consensus       171 ~~~~f~~~f~~a~~~gl~~t~H  192 (325)
T cd01320         171 PPEKFVRAFQRAREAGLRLTAH  192 (325)
T ss_pred             CHHHHHHHHHHHHHCCCEEEEE
T ss_conf             8689999999999859845664


No 221
>PRK13307 bifunctional formaldehyde-activating enzyme/3-hexulose-6-phosphate synthase; Provisional
Probab=75.28  E-value=6.2  Score=19.22  Aligned_cols=177  Identities=16%  Similarity=0.174  Sum_probs=88.9

Q ss_pred             CHHHHHHHHHHHCCCCCCEEEECCCCCH-----HHHHHHHCCCCCEEE-EECCCCH------HHHH----CC--CCCCCH
Q ss_conf             2899999887621368832410256999-----999987415760697-5134377------7732----05--888898
Q gi|254780485|r  121 DLSIIVDMIKGVKSLGLETCMTLGMLSF-----EQAQILSKAGLDYYN-HNIDTSE------RFYP----HV--TTTHTF  182 (328)
Q Consensus       121 ~~~~~~e~i~~i~~~~~~i~~~~g~~~~-----~~~~~Lk~aG~~~~~-~~let~~------~~~~----~~--~~~~~~  182 (328)
                      +++.+..+++.+.+.+ ++.+.+|+.--     +..+++|+.=.+... ..+.|..      +...    .+  .-+...
T Consensus       183 ~~~~~~~~~~~~p~~d-~~IIEaGTPLIK~~G~~aV~~iRe~fPd~~IvADlKTmDaG~lEa~mAa~AGADivtVlG~A~  261 (392)
T PRK13307        183 DLEEVERVLSELPQSD-HIIIEAGTPLIKKFGLEVISKIREVRPDAFIVADLKTLDTGNLEARMAADATADAVVISGLAP  261 (392)
T ss_pred             CHHHHHHHHHHCCCCC-EEEEEECCHHHHHHHHHHHHHHHHHCCCCEEEEEEECCCCCHHHHHHHHHCCCCEEEEECCCC
T ss_conf             8899999997188656-289990858889867899999998789988998542035426888888875998899956798


Q ss_pred             -HHHHHHHHHHHHCCCCCCCEEEECCCCCHHHHHHHHHHHHHCCCCCCEEECCCEEECCCCCCCCCCCCCHHHHHHHHHH
Q ss_conf             -9999999999987985577078668989999999999997408888602054112048741244568798999999999
Q gi|254780485|r  183 -EDRLQTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEHVRIISV  261 (328)
Q Consensus       183 -~~~l~~~~~a~~~G~~~~sg~l~G~gEt~eeri~~l~~lr~l~~~~~~v~~~~~~p~~gt~l~~~~~~~~~e~lr~iAi  261 (328)
                       ..--++++.|++.|..+-.-| ++. +.+.+|++-|    +++.  +-+.   +  |-|...+... .+..+.+++...
T Consensus       262 ~sTI~~aikeA~k~G~~v~vDl-InV-~dpv~ra~eL----klg~--DiI~---l--H~giD~Q~~~-~~~~~l~~i~~~  327 (392)
T PRK13307        262 ISTIEKAIHEAQKTGIYSILDM-LNV-EDPVKLLESL----KVKP--DVVE---L--HRGIDEEGTE-HAWGNIPEIKKA  327 (392)
T ss_pred             HHHHHHHHHHHHHCCCEEEEEE-CCC-CCHHHHHHHH----CCCC--CEEE---E--EECCCHHHCC-CCHHHHHHHHHH
T ss_conf             7899999999997097999983-478-8889999984----4469--8899---9--8541264036-874569999974


Q ss_pred             HHHHCCCCCCEEEEHHHHHCHHHHHHHHHHCCCEEEECCEEECCCCCCHHHHHHHHHHC
Q ss_conf             99968687214231156516568999998099889977866515888989999999982
Q gi|254780485|r  262 ARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTILFNRL  320 (328)
Q Consensus       262 ~RL~lP~~~i~i~~~~~~~~~~~~~~~L~~GaN~~~~g~~~~t~~g~~~~~~~~~i~~~  320 (328)
                      .    .+..+.+++|   +..+....++.+||+-+++|.+++.+.. ..+.-++.++++
T Consensus       328 ~----~~~~VAVAGG---I~~et~~~~~~~gadIvIVG~aIT~S~D-p~~AAreil~~~  378 (392)
T PRK13307        328 A----GKILVAVAGG---VRVEKVEEALKAGADILVVGRAITKSKD-VRRAAEQFLNKL  378 (392)
T ss_pred             C----CCEEEEEECC---CCHHHHHHHHHCCCCEEEECCHHCCCCC-HHHHHHHHHHHC
T ss_conf             2----6805999778---8888899998469989998912137899-899999999873


No 222
>CHL00200 trpA tryptophan synthase alpha subunit; Provisional
Probab=75.27  E-value=6.2  Score=19.22  Aligned_cols=186  Identities=15%  Similarity=0.112  Sum_probs=105.1

Q ss_pred             CHHHHHHHHHHHHHCCCEEEEEECCCCCCC-CC---------------CHHHHHHHHHHHCCC-C-CCEEEE---C-C-C
Q ss_conf             857999999999964983899730368887-44---------------289999988762136-8-832410---2-5-6
Q gi|254780485|r   89 NVDQVLKEAKNAKENGATRYCMGAAWREPK-ER---------------DLSIIVDMIKGVKSL-G-LETCMT---L-G-M  145 (328)
Q Consensus        89 ~~Eei~~~a~~~~~~G~~~~~l~~~~~~~~-~~---------------~~~~~~e~i~~i~~~-~-~~i~~~---~-g-~  145 (328)
                      +.|.-++.++.+.+.|+.-+-++-=.-+|. +.               .++.+.++++.++.. . +.+.++   + . .
T Consensus        27 ~~e~s~~~~~~l~~~GaDiiElGiPfSDP~ADGpvIq~A~~~AL~~G~~~~~~~~~v~~~r~~~~~PivlMtY~N~i~~y  106 (263)
T CHL00200         27 DIVITKKALKILDKKGADIIELGIPYSDPLADGPIIQEASNRALKQGINLNKILSILSEVNGEIKAPIVIFTYYNPVLHY  106 (263)
T ss_pred             CHHHHHHHHHHHHHCCCCEEEECCCCCCCCCCCHHHHHHHHHHHHCCCCHHHHHHHHHHHHHCCCCCEEEEEEHHHHHHC
T ss_conf             87899999999997699999978988886665899999999999779877789999999860679988998620688873


Q ss_pred             CCHHHHHHHHCCCCCEEEEECCCCHHHHHCCCCCCCHHHHHHHHHHHHHCCCCCCCEEEECCCCCHHHHHHHHHHHHHCC
Q ss_conf             99999998741576069751343777732058888989999999999987985577078668989999999999997408
Q gi|254780485|r  146 LSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLS  225 (328)
Q Consensus       146 ~~~~~~~~Lk~aG~~~~~~~let~~~~~~~~~~~~~~~~~l~~~~~a~~~G~~~~sg~l~G~gEt~eeri~~l~~lr~l~  225 (328)
                      -.+.-+++++++|++.+.+             |.-.+++--+....+++.|+..   +.+=-.-|.++|+..+....+  
T Consensus       107 G~e~F~~~~~~~GvdGlIi-------------pDLP~eE~~~~~~~~~~~gl~~---I~lvaPtt~~~Ri~~i~~~a~--  168 (263)
T CHL00200        107 GINKFIKKISQAGVKGLII-------------PDLPYEESDYLISVCNLYNIEL---ILLIAPTSSKSRIQKIARAAP--  168 (263)
T ss_pred             CHHHHHHHHHHCCCCEEEC-------------CCCCHHHHHHHHHHHHHCCCCE---EEEECCCCCHHHHHHHHHHCC--
T ss_conf             8899999999849986874-------------7999788899999998558621---666478996999999997289--


Q ss_pred             CCCCEEECCCEEECCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCEEEEHHHHHCHHHHHHHHHHCCCEEEECCEEE
Q ss_conf             888602054112048741244568798999999999999686872142311565165689999980998899778665
Q gi|254780485|r  226 TPPESIPINLLIPIPGSKFEENKKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLL  303 (328)
Q Consensus       226 ~~~~~v~~~~~~p~~gt~l~~~~~~~~~e~lr~iAi~RL~lP~~~i~i~~~~~~~~~~~~~~~L~~GaN~~~~g~~~~  303 (328)
                         .++   ..+...|+.-...  .-+.+....+...|=.-   .+++..|-.--.++.......+|||++++|..++
T Consensus       169 ---GFi---Y~vs~~GvTG~~~--~~~~~l~~~i~~ik~~t---~~Pv~vGFGIs~~e~v~~~~~~~aDGvIVGSaiV  235 (263)
T CHL00200        169 ---GCI---YLVSTTGVTGLKT--ELDKKLKKLIETIKKMT---NKPIILGFGISTSEQIKQIKGWNINGIVIGSACV  235 (263)
T ss_pred             ---CCE---EEEECCCCCCCCC--CCHHHHHHHHHHHHHHC---CCCEEEECCCCCHHHHHHHHHCCCCEEEECHHHH
T ss_conf             ---808---9853365568754--45187999999999736---9984873587999999999745999999878999


No 223
>TIGR00693 thiE thiamine-phosphate pyrophosphorylase; InterPro: IPR003733   Thiamine monophosphate synthase (TMP) (2.5.1.3 from EC) catalyzes the substitution of the pyrophosphate of 2-methyl-4-amino-5- hydroxymethylpyrimidine pyrophosphate by 4-methyl-5- (beta-hydroxyethyl)thiazole phosphate to yield thiamine phosphate in the thiamine biosynthesis pathway .   TENI, a protein from Bacillus subtilis that regulates the production of several extracellular enzymes by reducing alkaline protease production belongs to this group .; GO: 0004789 thiamin-phosphate diphosphorylase activity, 0009228 thiamin biosynthetic process.
Probab=75.13  E-value=6.3  Score=19.19  Aligned_cols=167  Identities=16%  Similarity=0.225  Sum_probs=104.2

Q ss_pred             HHHHHHHHHHHHCCCEEEEEECCCCCCC-------CCCHHHHHHHHHHH-CCCCCCEEEECCCCCHHHHHHHHCCCCCEE
Q ss_conf             7999999999964983899730368887-------44289999988762-136883241025699999998741576069
Q gi|254780485|r   91 DQVLKEAKNAKENGATRYCMGAAWREPK-------ERDLSIIVDMIKGV-KSLGLETCMTLGMLSFEQAQILSKAGLDYY  162 (328)
Q Consensus        91 Eei~~~a~~~~~~G~~~~~l~~~~~~~~-------~~~~~~~~e~i~~i-~~~~~~i~~~~g~~~~~~~~~Lk~aG~~~~  162 (328)
                      +..+..++.+-+.|++-+-+  =.....       .+.+....+.++.+ ++.+....+|      +...-=.+.|+|.+
T Consensus        15 ~~~~~~ve~Al~GGV~~~Ql--R~K~~~~~~~yGE~~~~~~~A~~l~~lc~~y~~~f~vN------D~vdlA~~~~ADGv   86 (210)
T TIGR00693        15 KDLLARVEAALKGGVTLVQL--RDKGSNALQQYGETRERLELAEKLRELCRKYGVPFIVN------DRVDLALALGADGV   86 (210)
T ss_pred             HHHHHHHHHHHHCCCEEEEE--EECCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCEEEC------CHHHHHHHHCCCEE
T ss_conf             44899999998589629998--40587542125858899999999999998708976882------83999998379877


Q ss_pred             EEECCCCHHHHHCCCCCCCHHHHHHHHHHHHHCCCCCCCEEEECC-CCCHHHHHHHHH-HHHHCCCCCCEEECCCEEECC
Q ss_conf             751343777732058888989999999999987985577078668-989999999999-997408888602054112048
Q gi|254780485|r  163 NHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSGIKVCCGGILGL-GEMIDDRIDMLL-TLANLSTPPESIPINLLIPIP  240 (328)
Q Consensus       163 ~~~let~~~~~~~~~~~~~~~~~l~~~~~a~~~G~~~~sg~l~G~-gEt~eeri~~l~-~lr~l~~~~~~v~~~~~~p~~  240 (328)
                      +++++-.|-                  ..|+++   .+.++++|. ..+.+|..+-.. .+ .-...|  |.+.+++|-+
T Consensus        87 HlGQ~D~p~------------------~~aR~l---~G~~~iiG~S~~~~~e~~~a~~C~~-~~gaDY--~G~Gp~fpT~  142 (210)
T TIGR00693        87 HLGQDDLPV------------------SEARKL---LGPDKIIGVSTHNLEELAEAAACEL-KEGADY--IGVGPIFPTP  142 (210)
T ss_pred             EECCCCCCH------------------HHHHHH---CCCCCEEEEEECCHHHHHHHHHHHH-HCCCCE--EEECCCCCCC
T ss_conf             667888998------------------999985---3899579853379899999998764-078988--8863711588


Q ss_pred             CCCCCCCCCCCHHHHHHHHHHHHH-HCCCCCCEEEEHHHHHCHHHHHHHHHHCCCEEE
Q ss_conf             741244568798999999999999-686872142311565165689999980998899
Q gi|254780485|r  241 GSKFEENKKVDPIEHVRIISVARI-LMPKSRLRLAAGRAMMSDELQALCFFSGANSIF  297 (328)
Q Consensus       241 gt~l~~~~~~~~~e~lr~iAi~RL-~lP~~~i~i~~~~~~~~~~~~~~~L~~GaN~~~  297 (328)
                       | -++.+++-.-|+|+-++-.++ =.|-+  -|-+    +..+.-+..+.+||+++-
T Consensus       143 -T-K~~~~~~~g~e~l~~~~~~~~h~~P~V--AIGG----I~~~n~~~v~~~G~~~vA  192 (210)
T TIGR00693       143 -T-KKDAAPPVGLELLREIAATSIHDIPIV--AIGG----ITLENVAEVLAAGADGVA  192 (210)
T ss_pred             -C-CCCCCCCCCHHHHHHHHHHCCCCCCEE--EECC----CCHHHHHHHHHCCCCEEE
T ss_conf             -7-889877648889999998617887658--8759----887899999972887388


No 224
>TIGR02826 RNR_activ_nrdG3 anaerobic ribonucleoside-triphosphate reductase activating protein; InterPro: IPR014191   Members of this entry represent a set of proteins related to, yet architecturally different from, the activating protein for the glycine radical-containing, oxygen-sensitive ribonucleoside-triphosphate reductase (RNR, see IPR012837 from INTERPRO). Members of this entry are found paired with members of a similarly divergent set of anaerobic ribonucleoside-triphosphate reductases. Identification of these proteins as RNR activating proteins is partly from pairing with the candidate RNR and further supported by the finding that upstream of these operons are examples of a conserved regulatory element that is found in nearly all bacteria and that occurs specifically upstream of operons for all three classes of RNR genes ..
Probab=74.67  E-value=6.4  Score=19.12  Aligned_cols=95  Identities=20%  Similarity=0.364  Sum_probs=55.1

Q ss_pred             HHCCCCEEEEEEEEEECCCCCCCC--CCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCE----EEEEE-CCCCCC
Q ss_conf             862898569998645307868342--32124335477756410006857999999999964983----89973-036888
Q gi|254780485|r   45 KNFEPNHIQLSKLLNIKTGGCPEN--CGYCNQSVHNKSKLKASKLINVDQVLKEAKNAKENGAT----RYCMG-AAWREP  117 (328)
Q Consensus        45 ~~~~g~~V~~~~~in~~TN~C~~~--C~fCaf~~~~~~~~~~~~~~~~Eei~~~a~~~~~~G~~----~~~l~-~~~~~~  117 (328)
                      +.+ +|.|++.  +|+ || |+..  |+=|= |..... ......++.|.+.+..+.. ..-++    .+|++ .||++.
T Consensus        10 qEv-Pde~~LA--~~~-~G-Cp~~PKC~GCH-S~~lW~-~d~G~~Lt~e~~~~~l~~y-~~~I~RYFPK~Cv~FlGGEPL   81 (165)
T TIGR02826        10 QEV-PDEVSLA--FNI-SG-CPLGPKCKGCH-SPELWH-EDEGTPLTEEALAQLLDKY-RSLITRYFPKVCVLFLGGEPL   81 (165)
T ss_pred             EEC-CCCEEEE--EEE-EC-CCCCCCCCCCC-CHHHCC-CCCCCCCCHHHHHHHHHHH-CCCCCHHHHHHEEEECCCCCC
T ss_conf             650-8706787--775-46-78779598888-731113-5679888989999999874-000101210020200478988


Q ss_pred             CCCCHHHHHHHHHHHCCC--CCCEEEECCCCC
Q ss_conf             744289999988762136--883241025699
Q gi|254780485|r  118 KERDLSIIVDMIKGVKSL--GLETCMTLGMLS  147 (328)
Q Consensus       118 ~~~~~~~~~e~i~~i~~~--~~~i~~~~g~~~  147 (328)
                      .+...+.+.+..+.+|+.  ++.++.=.|...
T Consensus        82 APw~~~~l~~Ll~~~k~~~~~L~v~LYTG~~~  113 (165)
T TIGR02826        82 APWEPEALLSLLKLVKEEHAGLKVCLYTGREH  113 (165)
T ss_pred             CCCCHHHHHHHHHHHHHHCCCCEEEEECCCCC
T ss_conf             73376899999999997538866888508854


No 225
>pfam01964 ThiC ThiC family. ThiC is found within the thiamine biosynthesis operon. ThiC is involved in pyrimidine biosynthesis. The precise catalytic function of ThiC is still not known. ThiC participates in the formation of 4-Amino-5-hydroxymethyl-2-methylpyrimidine from AIR, an intermediate in the de novo pyrimidine biosynthesis.
Probab=74.54  E-value=6.5  Score=19.10  Aligned_cols=196  Identities=14%  Similarity=0.134  Sum_probs=93.1

Q ss_pred             CCCCCCCCCCCCCCCCCCC-----CCCCCCCHHHHHHHHHHHHHCCCEEEEE-ECCCC------------CCCCCCH---
Q ss_conf             6834232124335477756-----4100068579999999999649838997-30368------------8874428---
Q gi|254780485|r   64 GCPENCGYCNQSVHNKSKL-----KASKLINVDQVLKEAKNAKENGATRYCM-GAAWR------------EPKERDL---  122 (328)
Q Consensus        64 ~C~~~C~fCaf~~~~~~~~-----~~~~~~~~Eei~~~a~~~~~~G~~~~~l-~~~~~------------~~~~~~~---  122 (328)
                      .-..+++.|+.....++.+     .-....+.|+=+++++.+.+.|+-.+.- .+|+.            +.+...+   
T Consensus        44 ~~h~~~~p~~IG~glrtKVNaNIGtS~~~~d~~~E~~K~~~A~~~GADtvMDLStGgdl~~iR~~il~~s~vpvGTVPiY  123 (421)
T pfam01964        44 INHPELKPMGIGKGLRTKVNANIGTSADISDIDEEVEKAKVAIKYGADTVMDLSTGGDLDEIRRAILENSPVPVGTVPIY  123 (421)
T ss_pred             CCCCCCCEEEECCCCEEEEECCCCCCCCCCCHHHHHHHHHHHHHHCCCEEEECCCCCCHHHHHHHHHHCCCCCCCCCHHH
T ss_conf             99898871486468645896022689887988999999999998399857765777466999999997399867761499


Q ss_pred             ---------------HHHHHHHHHHCCCCC-CEEEECCCCCHHHHHHHHCCC----CCEE---------EEECCCCH--H
Q ss_conf             ---------------999998876213688-324102569999999874157----6069---------75134377--7
Q gi|254780485|r  123 ---------------SIIVDMIKGVKSLGL-ETCMTLGMLSFEQAQILSKAG----LDYY---------NHNIDTSE--R  171 (328)
Q Consensus       123 ---------------~~~~e~i~~i~~~~~-~i~~~~g~~~~~~~~~Lk~aG----~~~~---------~~~let~~--~  171 (328)
                                     +.+++.++.--+.++ .+.+++|. +.+.+.++++.|    +-+-         .++-.-+|  +
T Consensus       124 qa~~~~~~~~~~mt~d~~~~~ie~qa~~GVDfmTiH~Gi-~~~~~~~~~~~~R~~giVSRGGs~la~WM~~n~~ENPlye  202 (421)
T pfam01964       124 QAAERKGGSVVDMTEDDLFDVIEEQAKDGVDFMTIHAGV-TRETLERLKRSGRLTGIVSRGGSFLAAWMLHNGKENPLYE  202 (421)
T ss_pred             HHHHHHCCCHHHCCHHHHHHHHHHHHHHCCCEEEECCCH-HHHHHHHHHHCCCCCCCCCCCCHHHHHHHHHCCCCCCHHH
T ss_conf             999996599454999999999999997288778740001-5999999974587346014662899999997476583466


Q ss_pred             HH-----------------HCCCCCC-----C---HHHHH---HHHHHHHHCCCCCCCEEEECCCCCHHHHH-HHHHHHH
Q ss_conf             73-----------------2058888-----9---89999---99999998798557707866898999999-9999997
Q gi|254780485|r  172 FY-----------------PHVTTTH-----T---FEDRL---QTLENVRKSGIKVCCGGILGLGEMIDDRI-DMLLTLA  222 (328)
Q Consensus       172 ~~-----------------~~~~~~~-----~---~~~~l---~~~~~a~~~G~~~~sg~l~G~gEt~eeri-~~l~~lr  222 (328)
                      .|                 .-.+|+.     +   +.+.+   +..++|++.|.++   |+=|.|.-+-+-+ ..+...+
T Consensus       203 ~fD~lleI~~~yDVtlSLGDglRPG~i~Da~D~aQ~~El~~lgeL~~rA~e~gVQv---MVEGPGHvPl~qI~~nv~l~K  279 (421)
T pfam01964       203 HFDYLLEILKEYDVTLSLGDGLRPGCIADATDRAQIQELITLGELTKRAWEAGVQV---MIEGPGHVPLNQIEANVKLQK  279 (421)
T ss_pred             HHHHHHHHHHHCCEEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCE---EEECCCCCCHHHHHHHHHHHH
T ss_conf             09999999997492686047779875356871889999999999999999819988---987999777899999999999


Q ss_pred             HCCCCCCEEECCCEEECC-----------------------------CCCCCCCCCCCHHHHHHHHHHHHHHC
Q ss_conf             408888602054112048-----------------------------74124456879899999999999968
Q gi|254780485|r  223 NLSTPPESIPINLLIPIP-----------------------------GSKFEENKKVDPIEHVRIISVARILM  266 (328)
Q Consensus       223 ~l~~~~~~v~~~~~~p~~-----------------------------gt~l~~~~~~~~~e~lr~iAi~RL~l  266 (328)
                      +|-   ++.|+..|-|..                             =||-++..-|+.++.-.=+-.+||.-
T Consensus       280 ~lc---~~APfYvLGPLvTDiApGYDHIt~AIGgAiAa~~GAdfLCYVTPaEHL~LP~~eDVreGviA~kIAA  349 (421)
T pfam01964       280 ELC---HGAPFYVLGPLVTDIAPGYDHITSAIGGAIAAAAGADFLCYVTPAEHLGLPNVEDVREGVIAYKIAA  349 (421)
T ss_pred             HHH---CCCCEEECCCCCCCCCCCCHHHHHHHHHHHHHHCCCCEEEECCCHHHCCCCCHHHHHHHHHHHHHHH
T ss_conf             861---7998010286100367772088999999999864776375058088548999899999999999999


No 226
>PRK08883 ribulose-phosphate 3-epimerase; Provisional
Probab=73.49  E-value=6.9  Score=18.93  Aligned_cols=196  Identities=12%  Similarity=0.140  Sum_probs=103.4

Q ss_pred             HHHHHHHHHHHHCCCEEEEE-ECCCCCCCCCCH-HHHHHHHHHH-CCCCCCEEEECCCCCHHHHHHHHCCCCCEEEEECC
Q ss_conf             79999999999649838997-303688874428-9999988762-13688324102569999999874157606975134
Q gi|254780485|r   91 DQVLKEAKNAKENGATRYCM-GAAWREPKERDL-SIIVDMIKGV-KSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNID  167 (328)
Q Consensus        91 Eei~~~a~~~~~~G~~~~~l-~~~~~~~~~~~~-~~~~e~i~~i-~~~~~~i~~~~g~~~~~~~~~Lk~aG~~~~~~~le  167 (328)
                      -.+.++++.+.+.|+..+++ +.-|+.-+...+ -.+++.+|.. ......+|+-+- -.+..+..+.++|++.+..-.|
T Consensus        12 ~~L~~ei~~l~~~g~d~lHiDIMDG~FVPNitfg~~~v~~ir~~~t~~~~DvHLMv~-~P~~~i~~~~~aGad~I~~H~E   90 (220)
T PRK08883         12 ARLGEDVEKVLAAGADVVHFDVMDNHYVPNLTFGAPICKALRDYGITAPIDVHLMVK-PVDRIIPDFAKAGASMITFHVE   90 (220)
T ss_pred             HHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCHHHHHHHHHHCCCCCEEEEEEEC-CHHHHHHHHHHCCCCEEEECCC
T ss_conf             999999999997699989981778985886566989999999658998757899833-8888899999759988998577


Q ss_pred             CCHHHHHCCCCCCCHHHHHHHHHHHHHCCCCCCCEEEECCCCCHHHHHHHHHHHHHCCCCCCEEECCCEEECCCCCCCCC
Q ss_conf             37777320588889899999999999879855770786689899999999999974088886020541120487412445
Q gi|254780485|r  168 TSERFYPHVTTTHTFEDRLQTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEEN  247 (328)
Q Consensus       168 t~~~~~~~~~~~~~~~~~l~~~~~a~~~G~~~~sg~l~G~gEt~eeri~~l~~lr~l~~~~~~v~~~~~~p~~gt~l~~~  247 (328)
                      +.+.             -.++++..++.|++.  |+-+.. .|+-+.++.+.  .+++    .|-+.-.  .||-  .+.
T Consensus        91 a~~~-------------~~~~i~~Ik~~g~k~--GlalnP-~T~~~~l~~~l--~~~D----~VLvMtV--~PGf--~GQ  144 (220)
T PRK08883         91 ASEH-------------VDRTLQLIKEHGCQA--GVVLNP-ATPLAHLEYIM--DKVD----LILLMSV--NPGF--GGQ  144 (220)
T ss_pred             CCCC-------------HHHHHHHHHHCCCCE--EEEECC-CCCHHHHHHHH--HHCC----EEEEEEE--CCCC--CCC
T ss_conf             6549-------------999999999859966--888479-99879999999--7469----7999874--5898--875


Q ss_pred             CCCCHHHHHHHHHHHHHHCCC--CCCEEEEHHHHHCHHHHHHHHHHCCCEEEECCEEECCCCCCHHHHHHHHH
Q ss_conf             687989999999999996868--72142311565165689999980998899778665158889899999999
Q gi|254780485|r  248 KKVDPIEHVRIISVARILMPK--SRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTILFN  318 (328)
Q Consensus       248 ~~~~~~e~lr~iAi~RL~lP~--~~i~i~~~~~~~~~~~~~~~L~~GaN~~~~g~~~~t~~g~~~~~~~~~i~  318 (328)
                      +-.  .+.+.-+.-.|-+.+.  ..+.|+. =..+..+.......+|||.++.|.++-.+.  .+.+.++-+|
T Consensus       145 ~f~--~~~l~Ki~~l~~~~~~~~~~~~I~V-DGGI~~~ti~~l~~aGad~~V~GS~iF~~~--d~~~~i~~lr  212 (220)
T PRK08883        145 SFI--PHTLDKLRAVRKMIDASGRDIRLEI-DGGVKVDNIREIAEAGADMFVAGSAIFGQP--DYKAVIDEMR  212 (220)
T ss_pred             CCC--HHHHHHHHHHHHHHHHCCCCCEEEE-ECCCCHHHHHHHHHCCCCEEEECHHHHCCC--CHHHHHHHHH
T ss_conf             455--7799999999998874499807999-898789999999987999999682674899--9999999999


No 227
>COG5016 Pyruvate/oxaloacetate carboxyltransferase [Energy production and conversion]
Probab=72.96  E-value=7.1  Score=18.85  Aligned_cols=124  Identities=16%  Similarity=0.105  Sum_probs=62.8

Q ss_pred             CCHHHHHHHHHHHHHCCCEEEEEECCCCCCCCCCHHHHHHHHHHHCCCCCCEEEECC-CCCHHHHHHHHCCCCCEEEEEC
Q ss_conf             685799999999996498389973036888744289999988762136883241025-6999999987415760697513
Q gi|254780485|r   88 INVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLGLETCMTLG-MLSFEQAQILSKAGLDYYNHNI  166 (328)
Q Consensus        88 ~~~Eei~~~a~~~~~~G~~~~~l~~~~~~~~~~~~~~~~e~i~~i~~~~~~i~~~~g-~~~~~~~~~Lk~aG~~~~~~~l  166 (328)
                      -+.|.-++.+++..+.|+.-+|+--..+-..+.....++..+|......+++|.+.- -+..-.|-+-.+||+|.    +
T Consensus       153 Ht~e~yv~~akel~~~g~DSIciKDmaGlltP~~ayelVk~iK~~~~~pv~lHtH~TsG~a~m~ylkAvEAGvD~----i  228 (472)
T COG5016         153 HTLEYYVELAKELLEMGVDSICIKDMAGLLTPYEAYELVKAIKKELPVPVELHTHATSGMAEMTYLKAVEAGVDG----I  228 (472)
T ss_pred             CCHHHHHHHHHHHHHCCCCEEEEECCCCCCCHHHHHHHHHHHHHHCCCEEEEECCCCCCHHHHHHHHHHHHCCCH----H
T ss_conf             528999999999997279878840000269868899999999974597069850455561799999999817642----2


Q ss_pred             CCCHHHHHCCCCCCCHHHHHHHHHHH-HHCCCCCCCEEEECCCCCHHHHHHHHHHHHHC
Q ss_conf             43777732058888989999999999-98798557707866898999999999999740
Q gi|254780485|r  167 DTSERFYPHVTTTHTFEDRLQTLENV-RKSGIKVCCGGILGLGEMIDDRIDMLLTLANL  224 (328)
Q Consensus       167 et~~~~~~~~~~~~~~~~~l~~~~~a-~~~G~~~~sg~l~G~gEt~eeri~~l~~lr~l  224 (328)
                      ||+-.-..- .+.|..   .++|-.| +..|+.++-     -.|-.++..+++..+|+-
T Consensus       229 DTAisp~S~-gtsqP~---tEtmv~aL~gt~yDtgl-----d~~~l~~~~~yf~~vrkk  278 (472)
T COG5016         229 DTAISPLSG-GTSQPA---TETMVAALRGTGYDTGL-----DLELLEEIAEYFREVRKK  278 (472)
T ss_pred             HHHHCCCCC-CCCCCC---HHHHHHHHCCCCCCCCC-----CHHHHHHHHHHHHHHHHH
T ss_conf             210045557-888995---89999996279987653-----699999999999999998


No 228
>TIGR01060 eno phosphopyruvate hydratase; InterPro: IPR000941   Enolase (2-phospho-D-glycerate hydrolase) is an essential glycolytic enzyme that catalyses the interconversion of 2-phosphoglycerate and phosphoenolpyruvate , . In vertebrates, there are 3 different, tissue-specific isoenzymes, designated alpha, beta and gamma. Alpha is present in most tissues, beta is localised in muscle tissue, and gamma is found only in nervous tissue. The functional enzyme exists as a dimer of any 2 isoforms. In immature organs and in adult liver, it is usually an alpha homodimer, in adult skeletal muscle, a beta homodimer, and in adult neurons, a gamma homodimer. In developing muscle, it is usually an alpha/beta heterodimer, and in the developing nervous system, an alpha/gamma heterodimer . The tissue specific forms display minor kinetic differences. Tau-crystallin, one of the major lens proteins in some fish, reptiles and birds, has been shown  to be evolutionary related to enolase.   Neuron-specific enolase is released in a variety of neurological diseases, such as multiple sclerosis and after seizures or acute stroke. Several tumour cells have also been found positive for neuron-specific enolase. Beta-enolase deficiency is associated with glycogenosis type XIII defect.; GO: 0004634 phosphopyruvate hydratase activity, 0006096 glycolysis, 0000015 phosphopyruvate hydratase complex.
Probab=72.58  E-value=7.2  Score=18.79  Aligned_cols=38  Identities=26%  Similarity=0.395  Sum_probs=30.3

Q ss_pred             CHHHHHHHHHHHHHCCCCCCCEEEECC--CCCHHHHHHHHHHHH
Q ss_conf             989999999999987985577078668--989999999999997
Q gi|254780485|r  181 TFEDRLQTLENVRKSGIKVCCGGILGL--GEMIDDRIDMLLTLA  222 (328)
Q Consensus       181 ~~~~~l~~~~~a~~~G~~~~sg~l~G~--gEt~eeri~~l~~lr  222 (328)
                      |.-+-+++++.|++.|+..    ++=|  |||...-|.||.---
T Consensus       347 TlTET~~Av~lA~~~gY~~----viSHRSGETEDttIADLAVA~  386 (430)
T TIGR01060       347 TLTETLDAVELAKKAGYTA----VISHRSGETEDTTIADLAVAL  386 (430)
T ss_pred             CHHHHHHHHHHHHHCCCEE----EEEECCCCCHHHHHHHHHHHH
T ss_conf             4888999999999669848----997157898312699999983


No 229
>PRK13209 L-xylulose 5-phosphate 3-epimerase; Reviewed
Probab=72.42  E-value=7.3  Score=18.77  Aligned_cols=137  Identities=12%  Similarity=-0.003  Sum_probs=62.5

Q ss_pred             CCCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCC---CCCHHHHHHHHHHH----CCCCCCEEEEC----CCCCHHHHHH
Q ss_conf             0006857999999999964983899730368887---44289999988762----13688324102----5699999998
Q gi|254780485|r   85 SKLINVDQVLKEAKNAKENGATRYCMGAAWREPK---ERDLSIIVDMIKGV----KSLGLETCMTL----GMLSFEQAQI  153 (328)
Q Consensus        85 ~~~~~~Eei~~~a~~~~~~G~~~~~l~~~~~~~~---~~~~~~~~e~i~~i----~~~~~~i~~~~----g~~~~~~~~~  153 (328)
                      .+..+.|.+.+.+..+.+.|++.+.+.+......   ....+++.+.++.+    .+.++.+++..    +.-+-+++.+
T Consensus        93 ~R~~~~e~~~kaI~lA~~LGi~~I~lag~dv~~~~~~~e~~~~f~e~L~~~~~~A~~~gV~L~iE~~~~~f~~t~~~~~~  172 (283)
T PRK13209         93 VRAQGLEIMRKAIQLAQDLGIRVIQLAGYDVYYEEANNETRRRFIDGLKESVEMASRYSVTLAFEIMDTPFMGSISKALG  172 (283)
T ss_pred             HHHHHHHHHHHHHHHHHHCCCCEEEECCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCEEEEEECCHHHHCCHHHHHH
T ss_conf             99999999999999999809998996887667887859999999999999999999859989994255343215999999


Q ss_pred             -HHCCCCCEEEEECCCCHHHHHCCCCCCCHHHHHHHHH-HHHHCCCCCC-----CEEEECCCCCHHHHHHHHHHHHHCCC
Q ss_conf             -7415760697513437777320588889899999999-9998798557-----70786689899999999999974088
Q gi|254780485|r  154 -LSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLE-NVRKSGIKVC-----CGGILGLGEMIDDRIDMLLTLANLST  226 (328)
Q Consensus       154 -Lk~aG~~~~~~~let~~~~~~~~~~~~~~~~~l~~~~-~a~~~G~~~~-----sg~l~G~gEt~eeri~~l~~lr~l~~  226 (328)
                       .+..+-..+.++.|+..-    ..-..+..+-+.... .....-++-+     -.+.+|.|.  -|..+.+..|++++.
T Consensus       173 ~i~~v~sP~l~v~~D~gn~----~~~~~d~~~~i~~~~~~I~~vH~kD~~~g~~~~vp~G~G~--vdf~~vf~aLk~~gY  246 (283)
T PRK13209        173 YAHYLNSPWFQLYPDIGNL----SAWDNDVQMELQAGIGHIVAFHVKDTKPGVFKNVPFGEGV--VDFERAFKTLKQSGY  246 (283)
T ss_pred             HHHHCCCCCEEEEECHHHH----HHCCCCHHHHHHHHHHHEEEEEECCCCCCCCCCCCCCCCC--CCHHHHHHHHHHHCC
T ss_conf             9996699728999445779----8756999999997244568985314779976757898885--088999999999799


Q ss_pred             C
Q ss_conf             8
Q gi|254780485|r  227 P  227 (328)
Q Consensus       227 ~  227 (328)
                      .
T Consensus       247 ~  247 (283)
T PRK13209        247 C  247 (283)
T ss_pred             C
T ss_conf             7


No 230
>PRK13586 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional
Probab=72.01  E-value=7.4  Score=18.70  Aligned_cols=201  Identities=15%  Similarity=0.064  Sum_probs=103.2

Q ss_pred             EEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCEEEEEECCCCC-CCCCCHHHHHHHHHHH-CCC
Q ss_conf             45307868342321243354777564100068579999999999649838997303688-8744289999988762-136
Q gi|254780485|r   58 LNIKTGGCPENCGYCNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWRE-PKERDLSIIVDMIKGV-KSL  135 (328)
Q Consensus        58 in~~TN~C~~~C~fCaf~~~~~~~~~~~~~~~~Eei~~~a~~~~~~G~~~~~l~~~~~~-~~~~~~~~~~e~i~~i-~~~  135 (328)
                      +-+.-+-|+.-.++= +  . +   ..+  .  ...++.|+...+.|+.+++++--..- ......    ++++.+ +..
T Consensus         7 IDi~~gk~Vrl~~G~-~--~-~---~~~--~--~dP~~~a~~~~~~Ga~~lhvvDLdaa~g~~~N~----~~I~~i~~~~   71 (231)
T PRK13586          7 IDISKGKAVKRIRGV-E--G-T---GLV--L--GDPLKIAEELYNEGYDSIHVVDLDAAEGKGDNE----EYIKRICKIG   71 (231)
T ss_pred             EEEECCEEEECCCCC-C--C-C---CCC--C--CCHHHHHHHHHHCCCCEEEEEECCCCCCCCCHH----HHHHHHHHHC
T ss_conf             997799476897715-7--9-8---876--6--899999999998799989999671568998439----9999999745


Q ss_pred             CCCEEEECCCCCHHHHHHHHCCCCCEEEEECCC--CHHHHHCCCCCCCHHHHHHHHHHHHH----CCCCCCC-EE--EEC
Q ss_conf             883241025699999998741576069751343--77773205888898999999999998----7985577-07--866
Q gi|254780485|r  136 GLETCMTLGMLSFEQAQILSKAGLDYYNHNIDT--SERFYPHVTTTHTFEDRLQTLENVRK----SGIKVCC-GG--ILG  206 (328)
Q Consensus       136 ~~~i~~~~g~~~~~~~~~Lk~aG~~~~~~~let--~~~~~~~~~~~~~~~~~l~~~~~a~~----~G~~~~s-g~--l~G  206 (328)
                      +..+.+.-|..+.+..+.+.++|++.+.++-..  .|.++.+..            +...+    +++.+.- +.  .=|
T Consensus        72 ~~piqvGGGIrs~e~~~~~l~~Ga~kViigS~a~~np~~~~~~~------------~~~G~~~iv~siD~~~~~~v~~~G  139 (231)
T PRK13586         72 FSWIQVGGGIRDVEKAERLLSYDCSAIVMSTLPFTNPDTFRRIV------------AGIGENRVLVSVDYDDRKYVLIKG  139 (231)
T ss_pred             CCCEEEECCCCCHHHHHHHHHCCCCEEEECHHHHHCHHHHHHHH------------HHHCCCCEEEEEEECCCCEEEEEC
T ss_conf             98579856717699999999779988997688876959999999------------984996689999975896899848


Q ss_pred             CCCCHHHHHHHHHHHHHCCCCCCEEECCCEEECCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCEEEEHHHHHCHHHHH
Q ss_conf             89899999999999974088886020541120487412445687989999999999996868721423115651656899
Q gi|254780485|r  207 LGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQA  286 (328)
Q Consensus       207 ~gEt~eeri~~l~~lr~l~~~~~~v~~~~~~p~~gt~l~~~~~~~~~e~lr~iAi~RL~lP~~~i~i~~~~~~~~~~~~~  286 (328)
                      --++-.+..+.+.++.+++..  .+-+ --+-..|| +.+   ++ .+.++.++  +.-.   .+.+++| .+-..+..+
T Consensus       140 w~~~~~~~~~~i~~~~~~g~~--~ii~-TdI~~DGt-~~G---~d-~~l~~~i~--~~~~---~~i~aGG-i~s~~Di~~  205 (231)
T PRK13586        140 WKEKSMKVEDAISHVNSLESL--GVIF-TYVCNEGT-KNG---ID-NNVKRYVK--LVKG---EKEYAGG-IGSIQDLQK  205 (231)
T ss_pred             CCCCCCCHHHHHHHHHHCCCC--EEEE-EEECCHHC-CCC---CC-HHHHHHHH--HCCC---CCEEECC-CCCHHHHHH
T ss_conf             726886699999999975998--8999-76451120-368---99-89999998--7189---9599868-899999999


Q ss_pred             HHHHHCCCEEEECC
Q ss_conf             99980998899778
Q gi|254780485|r  287 LCFFSGANSIFVGD  300 (328)
Q Consensus       287 ~~L~~GaN~~~~g~  300 (328)
                      + ...|+++.++|-
T Consensus       206 L-~~~G~~gaivG~  218 (231)
T PRK13586        206 L-KKMGFDYAIVGM  218 (231)
T ss_pred             H-HHCCCCEEEEEH
T ss_conf             9-867998899997


No 231
>PRK08782 consensus
Probab=71.29  E-value=7.7  Score=18.60  Aligned_cols=163  Identities=17%  Similarity=0.204  Sum_probs=93.6

Q ss_pred             CCCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCCCCHHHHHHHHHHHCCCCCCEEEECCC-CCHHHHHHHHCCCCCEEE
Q ss_conf             0006857999999999964983899730368887442899999887621368832410256-999999987415760697
Q gi|254780485|r   85 SKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLGLETCMTLGM-LSFEQAQILSKAGLDYYN  163 (328)
Q Consensus        85 ~~~~~~Eei~~~a~~~~~~G~~~~~l~~~~~~~~~~~~~~~~e~i~~i~~~~~~i~~~~g~-~~~~~~~~Lk~aG~~~~~  163 (328)
                      .+..+.|+....++.+.+.|++-+-+..  +.+      .-.++++.+++..+.+.+-+|. ++.+++....++|++.+.
T Consensus        23 ir~~~~~~a~~~~eal~~gGi~~iEiTl--rt~------~a~~~i~~l~~~~p~~~vGaGTV~~~e~~~~a~~aGA~FiV   94 (219)
T PRK08782         23 VTVDTLDQARRVADALLEGGLPAIELTL--RTP------VAIEALAMLKRELPNIVIGAGTVLSERQLRQSVDAGADFLV   94 (219)
T ss_pred             EECCCHHHHHHHHHHHHHCCCCEEEEEC--CCC------HHHHHHHHHHHHCCCCEEEEEEECCHHHHHHHHHCCCCEEE
T ss_conf             9759999999999999987998799967--993------39999999998689947999970589999999984998998


Q ss_pred             EECCCCHHHHHCCCCCCCHHHHHHHHHHHHHCCCCCCCEEEECCCCCHHHHHHHHHHHHHCCCCCCEEECCCEEECCCCC
Q ss_conf             51343777732058888989999999999987985577078668989999999999997408888602054112048741
Q gi|254780485|r  164 HNIDTSERFYPHVTTTHTFEDRLQTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSK  243 (328)
Q Consensus       164 ~~let~~~~~~~~~~~~~~~~~l~~~~~a~~~G~~~~sg~l~G~gEt~eeri~~l~~lr~l~~~~~~v~~~~~~p~~gt~  243 (328)
                           +|        ..+    -++++.+++.|++.-.|.+     |+-|...-+    +.+.  ..+-   |+|  .  
T Consensus        95 -----SP--------~~~----~~v~~~a~~~~i~~iPGv~-----TpSEi~~A~----~~G~--~~vK---lFP--A--  139 (219)
T PRK08782         95 -----TP--------GTP----APLARLLADAPIPAVPGAA-----TPTELLTLM----GLGF--RVCK---LFP--A--  139 (219)
T ss_pred             -----CC--------CCC----HHHHHHHHHCCCCEECCCC-----CHHHHHHHH----HCCC--CEEE---ECC--C--
T ss_conf             -----78--------997----9999999981997647859-----999999999----8799--9899---777--3--


Q ss_pred             CCCCCCCCHHHHHHHHHHHHHHCCCCCCEEEEHHHHHCHHHHHHHHHHCCCEEEECCE
Q ss_conf             2445687989999999999996868721423115651656899999809988997786
Q gi|254780485|r  244 FEENKKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDT  301 (328)
Q Consensus       244 l~~~~~~~~~e~lr~iAi~RL~lP~~~i~i~~~~~~~~~~~~~~~L~~GaN~~~~g~~  301 (328)
                          ....+-.++|.+   +=-+|+..+.-++|   +..+....-|.. .|....|+.
T Consensus       140 ----~~~Gg~~~lkal---~~pfp~~~f~pTGG---V~~~N~~~yl~~-~~v~~vgGS  186 (219)
T PRK08782        140 ----TAVGGLQMLKGL---AGPLSELKLCPTGG---ISETNAAEFLSQ-PNVLCIGGS  186 (219)
T ss_pred             ----HHCCCHHHHHHH---HCCCCCCEEEECCC---CCHHHHHHHHHC-CCEEEEECH
T ss_conf             ----220849999998---47699981876799---898789999807-993999882


No 232
>PRK05283 deoxyribose-phosphate aldolase; Provisional
Probab=71.29  E-value=7.7  Score=18.60  Aligned_cols=134  Identities=16%  Similarity=0.205  Sum_probs=79.3

Q ss_pred             CCHHHHHHHHHHHHHCCCEEEEEECCCCCCCCCCHHHHHHHHHHHCCC-----CCCEEEECCCCCHHHHHHHHCCCCCEE
Q ss_conf             685799999999996498389973036888744289999988762136-----883241025699999998741576069
Q gi|254780485|r   88 INVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSL-----GLETCMTLGMLSFEQAQILSKAGLDYY  162 (328)
Q Consensus        88 ~~~Eei~~~a~~~~~~G~~~~~l~~~~~~~~~~~~~~~~e~i~~i~~~-----~~~i~~~~g~~~~~~~~~Lk~aG~~~~  162 (328)
                      .+.+..+.+++.+.+.|+.++-+|.........+.++..+.++.+++.     .+.+.+..+.+++++.-          
T Consensus        81 ~~~~~k~~E~~~Ai~~GAdEIDmVin~~~~~~g~~~~v~~~i~~v~~a~~~~~~LKVIlET~~L~~~e~I----------  150 (258)
T PRK05283         81 DDIAIALAETRAAIAYGADEVDVVFPYRALMAGNEQVGFELVKACKEACAANVLLKVIIETGELKDEALI----------  150 (258)
T ss_pred             CCHHHHHHHHHHHHHCCCCEEEEEEEHHHHHCCCHHHHHHHHHHHHHHCCCCCEEEEEEEECCCCCHHHH----------
T ss_conf             9577899999999987995665445089885788799999999999980898438999740347858999----------


Q ss_pred             EEECCCCHHHHHCCCCCCCHHHHHHHHHHHHHCCC---CCCCEEEECCCCCHHHHHHHHHHHHHCCCCCCEEECCCEEEC
Q ss_conf             75134377773205888898999999999998798---557707866898999999999999740888860205411204
Q gi|254780485|r  163 NHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSGI---KVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPI  239 (328)
Q Consensus       163 ~~~let~~~~~~~~~~~~~~~~~l~~~~~a~~~G~---~~~sg~l~G~gEt~eeri~~l~~lr~l~~~~~~v~~~~~~p~  239 (328)
                                             ....+.+.++|-   +|++|. -+.|=|.++..-++..+|+.... ..+.   +.+-
T Consensus       151 -----------------------~~As~~a~~aGADFVKTSTGk-~~~gAT~e~v~~M~~aI~~~~~G-~~vG---vKas  202 (258)
T PRK05283        151 -----------------------RKASEIAIKAGADFIKTSTGK-VPVNATLEAARIMLEVIRDMGVG-KTVG---FKPA  202 (258)
T ss_pred             -----------------------HHHHHHHHHHCCCEEECCCCC-CCCCCCHHHHHHHHHHHHHHCCC-CCEE---EEEC
T ss_conf             -----------------------999999999697988889998-99997999999999999986458-8656---7625


Q ss_pred             CCCCCCCCCCCCHHHHHHHHHHHHHHC
Q ss_conf             874124456879899999999999968
Q gi|254780485|r  240 PGSKFEENKKVDPIEHVRIISVARILM  266 (328)
Q Consensus       240 ~gt~l~~~~~~~~~e~lr~iAi~RL~l  266 (328)
                      -|       --+.++.++.+++.+-.|
T Consensus       203 GG-------Irt~~dA~~yl~L~~~~l  222 (258)
T PRK05283        203 GG-------VRTAEDAAQYLALADEIL  222 (258)
T ss_pred             CC-------CCCHHHHHHHHHHHHHHH
T ss_conf             88-------689999999999999972


No 233
>pfam09370 TIM-br_sig_trns TIM-barrel signal transduction protein. This domain is likely to have a TIM barrel fold related to IGPS. Although this family of proteins are functionally uncharacterized this domain is found as an N-terminal domain of sigma 54 -dependent transcriptional activators (enhancer-binding proteins) suggesting a potential role in signal recognition/receiving and signal transduction.
Probab=71.17  E-value=7.7  Score=18.58  Aligned_cols=108  Identities=12%  Similarity=0.119  Sum_probs=55.0

Q ss_pred             CCCCHHHHHHHHHHHHHCCCCCCCEEEECCCCCHHHHHHHHHHHHHCCCCCCEEEC-CCEEECCCCCCCCCCCCCHHHH-
Q ss_conf             88898999999999998798557707866898999999999999740888860205-4112048741244568798999-
Q gi|254780485|r  178 TTHTFEDRLQTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPI-NLLIPIPGSKFEENKKVDPIEH-  255 (328)
Q Consensus       178 ~~~~~~~~l~~~~~a~~~G~~~~sg~l~G~gEt~eeri~~l~~lr~l~~~~~~v~~-~~~~p~~gt~l~~~~~~~~~e~-  255 (328)
                      ++.+|+.=+|.++.||+.|+-+++-.     -+.+|-..+.    +-+.  +-+-. .-++ ..|+ .......|.++. 
T Consensus       132 tGmgy~~EVEmIr~A~~~dl~T~~yv-----f~~e~a~~Ma----~AGa--DiIv~H~GlT-~gG~-iG~~~a~sl~~a~  198 (268)
T pfam09370       132 TGMGYDLEVEMIRLAHEKGLLTTPYV-----FNVEEARAMA----EAGA--DIIVAHMGLT-TGGT-IGADTALSLDDCV  198 (268)
T ss_pred             CCCCHHHHHHHHHHHHHCCCCCCCEE-----CCHHHHHHHH----HCCC--CEEEECCCCC-CCCC-CCCCCCCCHHHHH
T ss_conf             08867999999999997798333132-----6899999999----7499--8999767767-7767-4677767899999


Q ss_pred             ---HHHHHHHHHHCCCCCCEEEEHHHHHCHHHHHHHHHH--CCCEEEEC
Q ss_conf             ---999999999686872142311565165689999980--99889977
Q gi|254780485|r  256 ---VRIISVARILMPKSRLRLAAGRAMMSDELQALCFFS--GANSIFVG  299 (328)
Q Consensus       256 ---lr~iAi~RL~lP~~~i~i~~~~~~~~~~~~~~~L~~--GaN~~~~g  299 (328)
                         -++...+|=+-|++++-.-+| .--.|+-.+..|..  |+.+.+-+
T Consensus       199 ~~~~~i~~aa~~v~~diIvLchGG-pI~~P~Da~~vl~~t~~~~Gf~Ga  246 (268)
T pfam09370       199 ELINAIARAARSVNPDVIVLCHGG-PIATPEDAQYVLDRTPGCHGFYGA  246 (268)
T ss_pred             HHHHHHHHHHHHHCCCEEEEECCC-CCCCHHHHHHHHHCCCCCCEEECC
T ss_conf             999999999998599869995178-889989999999739777667633


No 234
>TIGR00735 hisF imidazoleglycerol phosphate synthase, cyclase subunit; InterPro: IPR004651 Histidine is formed by several complex and distinct biochemical reactions catalysed by eight enzymes. Proteins involved in steps 4 and 6 of the histidine biosynthesis pathway are contained in one family. These enzymes are called His6 and His7 in eukaryotes and HisA and HisF in prokaryotes. HisA is a phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase (), involved in the fourth step of histidine biosynthesis. The bacterial HisF protein is a cyclase which catalyzes the cyclization reaction that produces D-erythro-imidazole glycerol phosphate during the sixth step of histidine biosynthesis. The yeast His7 protein is a bifunctional protein which catalyzes an amido-transferase reaction that generates imidazole-glycerol phosphate and 5-aminoimidazol-4-carboxamide. The latter is the ribonucleotide used for purine biosynthesis. The enzyme also catalyzes the cyclization reaction that produces D-erythro-imidazole glycerol phosphate, and is involved in the fifth and sixth steps in histidine biosynthesis.    This family describes the histidine biosynthesis protein, HisF. ; GO: 0000107 imidazoleglycerol-phosphate synthase activity, 0000105 histidine biosynthetic process, 0005737 cytoplasm, 0009382 imidazoleglycerol-phosphate synthase complex.
Probab=71.15  E-value=7.7  Score=18.58  Aligned_cols=72  Identities=24%  Similarity=0.303  Sum_probs=34.8

Q ss_pred             HHHHHHHHHHHCCCEEEEE--ECCCCC-CCCCCHHHHHHHHHHH-CCCCCCEEEECCCCCHHHHH-----------HHHC
Q ss_conf             9999999999649838997--303688-8744289999988762-13688324102569999999-----------8741
Q gi|254780485|r   92 QVLKEAKNAKENGATRYCM--GAAWRE-PKERDLSIIVDMIKGV-KSLGLETCMTLGMLSFEQAQ-----------ILSK  156 (328)
Q Consensus        92 ei~~~a~~~~~~G~~~~~l--~~~~~~-~~~~~~~~~~e~i~~i-~~~~~~i~~~~g~~~~~~~~-----------~Lk~  156 (328)
                      .+++.|+...+.|+-|+.+  .+..++ |..+  +-.++.++.+ ...++.+++--|..+-+++.           +|-.
T Consensus        43 DPVeLA~~Y~~eGADELVFLDITAS~ecPl~R--~~m~~Vv~r~Ae~VfiPlTVGGGI~~~eD~~GtkiPalevas~~L~  120 (312)
T TIGR00735        43 DPVELAQRYDEEGADELVFLDITASSECPLGR--ETMIDVVERTAEKVFIPLTVGGGIKSIEDVKGTKIPALEVASKLLR  120 (312)
T ss_pred             CHHHHHHHHHHCCCCEEEECCCCCCCCCCCCC--CCHHHHHHHHHHHCCCCEEECCCCCCHHHCCCCCCCHHHHHHHHHH
T ss_conf             82378999876289589851411366678888--0116788887521452222168888432045644427899999985


Q ss_pred             CCCCEEEEE
Q ss_conf             576069751
Q gi|254780485|r  157 AGLDYYNHN  165 (328)
Q Consensus       157 aG~~~~~~~  165 (328)
                      +|+|-+.+|
T Consensus       121 aGADKvSiN  129 (312)
T TIGR00735       121 AGADKVSIN  129 (312)
T ss_pred             CCCCEEEEC
T ss_conf             489846328


No 235
>COG0274 DeoC Deoxyribose-phosphate aldolase [Nucleotide transport and metabolism]
Probab=71.00  E-value=7.8  Score=18.56  Aligned_cols=120  Identities=22%  Similarity=0.229  Sum_probs=67.4

Q ss_pred             CHHHHHHHHHHHHHCCCEEEEEECCCCCCCCCCHHHHHHHHHHHCC-----CCCCEEEECCCCCHHHHHH----HHCCCC
Q ss_conf             8579999999999649838997303688874428999998876213-----6883241025699999998----741576
Q gi|254780485|r   89 NVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKS-----LGLETCMTLGMLSFEQAQI----LSKAGL  159 (328)
Q Consensus        89 ~~Eei~~~a~~~~~~G~~~~~l~~~~~~~~~~~~~~~~e~i~~i~~-----~~~~i~~~~g~~~~~~~~~----Lk~aG~  159 (328)
                      +.+.-+.+++.+.+.|+.++-++--.......+.+++.+-|+.+++     ..+.+.+..+.+++++..+    -.++|+
T Consensus        75 ~t~~K~~Ea~~ai~~GAdEiDmVinig~~k~g~~~~V~~eI~~v~~a~~~~~~lKVIlEt~~Lt~ee~~~A~~i~~~aGA  154 (228)
T COG0274          75 TTAVKAAEAREAIENGADEIDMVINIGALKSGNWEAVEREIRAVVEACADAVVLKVILETGLLTDEEKRKACEIAIEAGA  154 (228)
T ss_pred             HHHHHHHHHHHHHHCCCCEEEEEEEHHHHHCCCHHHHHHHHHHHHHHHCCCCEEEEEEECCCCCHHHHHHHHHHHHHHCC
T ss_conf             38889999999998499702564008998369889999999999998287744899974255697999999999999589


Q ss_pred             CEEEEECCCCHHHHHCCCCCCCHHHHHHHHHHHHH--CCCCCCCEEEECCCCCHHHHHHHHHHH
Q ss_conf             06975134377773205888898999999999998--798557707866898999999999999
Q gi|254780485|r  160 DYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRK--SGIKVCCGGILGLGEMIDDRIDMLLTL  221 (328)
Q Consensus       160 ~~~~~~let~~~~~~~~~~~~~~~~~l~~~~~a~~--~G~~~~sg~l~G~gEt~eeri~~l~~l  221 (328)
                      |.+.    |+-...    +....-+.+..|+..-.  .|++-.     |=+-|.+|....+..-
T Consensus       155 dFVK----TSTGf~----~~gAT~edv~lM~~~vg~~vgvKaS-----GGIrt~eda~~~i~ag  205 (228)
T COG0274         155 DFVK----TSTGFS----AGGATVEDVKLMKETVGGRVGVKAS-----GGIRTAEDAKAMIEAG  205 (228)
T ss_pred             CEEE----CCCCCC----CCCCCHHHHHHHHHHHCCCCEEECC-----CCCCCHHHHHHHHHHH
T ss_conf             9898----477878----9898799999999985657105326-----8848899999999975


No 236
>TIGR01108 oadA oxaloacetate decarboxylase alpha subunit; InterPro: IPR005776    This family describes the bacterial oxaloacetate decarboxylase alpha subunit and its equivalents in archaea . The oxaloacetate decarboxylase Na+ pump is the paradigm of the family of Na+ transport decarboxylases that present in bacteria and archaea. It a multi subunit enzyme consisting of a peripheral alpha-subunit and integral membrane subunits beta and gamma. The energy released by the decarboxylation reaction of oxaloacetate is coupled to Na+ ion pumping across the membrane.; GO: 0008948 oxaloacetate decarboxylase activity, 0006814 sodium ion transport.
Probab=70.70  E-value=7.9  Score=18.51  Aligned_cols=118  Identities=22%  Similarity=0.270  Sum_probs=61.0

Q ss_pred             CHHHHHHHHHHHHHCCCEEEEE--ECCCCCCCCCCHHHHHHHHHHHCC-CC-CCEEEECCCC---CHHHHHHHHCCCCCE
Q ss_conf             8579999999999649838997--303688874428999998876213-68-8324102569---999999874157606
Q gi|254780485|r   89 NVDQVLKEAKNAKENGATRYCM--GAAWREPKERDLSIIVDMIKGVKS-LG-LETCMTLGML---SFEQAQILSKAGLDY  161 (328)
Q Consensus        89 ~~Eei~~~a~~~~~~G~~~~~l--~~~~~~~~~~~~~~~~e~i~~i~~-~~-~~i~~~~g~~---~~~~~~~Lk~aG~~~  161 (328)
                      +.|.-++.|+++.+.|+--+||  .+|.=.|.     .-.|++++||+ .+ +.||+|...-   .+-.+.+=.+||+|.
T Consensus       148 Tl~~yl~la~~L~~~G~DSI~IKDMaGlLTP~-----~AYELV~alK~~~~n~pvhLH~H~TtGmA~~AllkA~EAG~d~  222 (616)
T TIGR01108       148 TLEKYLELAKELLEMGVDSICIKDMAGLLTPK-----VAYELVSALKKEFGNLPVHLHSHATTGMAEMALLKAIEAGADM  222 (616)
T ss_pred             HHHHHHHHHHHHHHHCCCEEEEECCCCCCCHH-----HHHHHHHHHHHHCCCEEEEEECCCCHHHHHHHHHHHHHCCCCC
T ss_conf             78889999999998188605520200464415-----8999999997423974688632472337999999888707880


Q ss_pred             EEEECCCCHHHHHCCCCCCCHHHHHHHH-HHHHHCCCCCCCEEEECCCCCHHHHHHHHHHHHHC
Q ss_conf             9751343777732058888989999999-99998798557707866898999999999999740
Q gi|254780485|r  162 YNHNIDTSERFYPHVTTTHTFEDRLQTL-ENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANL  224 (328)
Q Consensus       162 ~~~~let~~~~~~~~~~~~~~~~~l~~~-~~a~~~G~~~~sg~l~G~gEt~eeri~~l~~lr~l  224 (328)
                          +||+=.-+.- -+.|++   -|+| ....+.|+.++--     .+-.+++.+++..+|+-
T Consensus       223 ----iDTAisS~S~-gtSHPp---tE~lv~~L~~~gyD~gld-----~~~L~~i~~YFr~VRkK  273 (616)
T TIGR01108       223 ----IDTAISSMSG-GTSHPP---TETLVAALRGTGYDTGLD-----IELLLEIADYFRKVRKK  273 (616)
T ss_pred             ----CHHCCCCCCC-CCCCCH---HHHHHHHHHCCCCCCHHH-----HHHHHHHHHHHHHHHHH
T ss_conf             ----0200552347-888874---799999970578743102-----79999999999999999


No 237
>PRK07114 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional
Probab=70.44  E-value=8  Score=18.48  Aligned_cols=188  Identities=15%  Similarity=0.171  Sum_probs=111.5

Q ss_pred             CCCCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCCCCHHHHHHHHHHHCCCCCCEEEECCC-CCHHHHHHHHCCCCCEE
Q ss_conf             10006857999999999964983899730368887442899999887621368832410256-99999998741576069
Q gi|254780485|r   84 ASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLGLETCMTLGM-LSFEQAQILSKAGLDYY  162 (328)
Q Consensus        84 ~~~~~~~Eei~~~a~~~~~~G~~~~~l~~~~~~~~~~~~~~~~e~i~~i~~~~~~i~~~~g~-~~~~~~~~Lk~aG~~~~  162 (328)
                      -.+..+.|+.+..++.+.+.|++-+-+..  +.+.  ..+-+.++.+..++..+.+++-+|+ ++.+++....++|++.+
T Consensus        21 Vvr~~~~e~a~~~a~aL~~gGi~~iEiTl--rt~~--a~~~i~~l~~~~~~~~p~~~iGaGTVl~~~~~~~a~~aGA~Fi   96 (223)
T PRK07114         21 VFYHSDIEVAKKVVKACYDGGVRAFEFTN--RGDF--AHEVFGELVKYAAKECPEMILGVGSIVDAATAALYIQLGANFV   96 (223)
T ss_pred             EEEECCHHHHHHHHHHHHHCCCCEEEEEC--CCCC--HHHHHHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHCCCCEE
T ss_conf             99828999999999999988998899958--8965--8999999999998668980896551889999999998599899


Q ss_pred             EEECCCCHHHHHCCCCCCCHHHHHHHHHHHHHCCCCCCCEEEECCCCCHHHHHHHHHHHHHCCCCCCEEECCCEEECCCC
Q ss_conf             75134377773205888898999999999998798557707866898999999999999740888860205411204874
Q gi|254780485|r  163 NHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGS  242 (328)
Q Consensus       163 ~~~let~~~~~~~~~~~~~~~~~l~~~~~a~~~G~~~~sg~l~G~gEt~eeri~~l~~lr~l~~~~~~v~~~~~~p~~gt  242 (328)
                      .     +|        ..+    -++++.+++.|++.-.|.+     |+-|...-+    +++.  ..+-   |+|  ..
T Consensus        97 V-----SP--------~~~----~~v~~~~~~~~~~~iPGv~-----TptEi~~A~----~~G~--~~vK---~FP--a~  143 (223)
T PRK07114         97 V-----GP--------LFN----EDIAKVCNRRKIPYSPGCG-----SVSEIGFAE----ELGC--EIVK---IFP--GD  143 (223)
T ss_pred             E-----CC--------CCC----HHHHHHHHHCCCCCCCCCC-----CHHHHHHHH----HCCC--CEEE---ECC--CC
T ss_conf             9-----99--------999----9999999983997537319-----999999999----8799--9798---897--32


Q ss_pred             CCCCCCCCCHHHHHHHHHHHHHHCCCCCCEEEEHHHHHCHHHHHHHHHHCCCEEEECCEEECC---CCCCHHHHHHHHHH
Q ss_conf             124456879899999999999968687214231156516568999998099889977866515---88898999999998
Q gi|254780485|r  243 KFEENKKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTA---KNPSYNKDTILFNR  319 (328)
Q Consensus       243 ~l~~~~~~~~~e~lr~iAi~RL~lP~~~i~i~~~~~~~~~~~~~~~L~~GaN~~~~g~~~~t~---~g~~~~~~~~~i~~  319 (328)
                            ...+ .++|-+   +=-+|+..+.-++| ++-..+.....|.+|+...-+|..+...   .....+++.+..++
T Consensus       144 ------~~G~-~~lkal---~~p~p~~~~~PtGG-V~ps~~N~~~~l~ag~~~vG~GS~l~~~~~i~~~d~~~I~~~a~~  212 (223)
T PRK07114        144 ------VYGP-EFVKAI---KGPMPWTSIMPTGG-VEPTEENLKSWFKAGATCVGMGSKLFPKDKLAAKDWAGITKKVKE  212 (223)
T ss_pred             ------CCCH-HHHHHH---HCCCCCCCEEECCC-CCCCHHHHHHHHHCCCEEEEECHHHCCHHHHHCCCHHHHHHHHHH
T ss_conf             ------3599-999998---46499996887999-887355099999689979998846389999865899999999999


No 238
>PRK02145 consensus
Probab=70.00  E-value=8.2  Score=18.42  Aligned_cols=201  Identities=15%  Similarity=0.190  Sum_probs=109.1

Q ss_pred             HHHHHHHHHHHCCCEEEEEECCCCCCCCCCHHHHHHHHHHH-CCCCCCEEEECCCCCHHHHHHHHCCCCCEEEEECCC--
Q ss_conf             99999999996498389973036888744289999988762-136883241025699999998741576069751343--
Q gi|254780485|r   92 QVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGV-KSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDT--  168 (328)
Q Consensus        92 ei~~~a~~~~~~G~~~~~l~~~~~~~~~~~~~~~~e~i~~i-~~~~~~i~~~~g~~~~~~~~~Lk~aG~~~~~~~let--  168 (328)
                      ..++.|+...+.|+.+++++--......  -....+.++.+ ++.++.+.+.-|..+.++.+++-++|++.+.++-..  
T Consensus        32 dP~~~a~~~~~~GadelhivDld~a~~~--~~~~~~~I~~i~~~~~iPi~vGGGIrs~e~~~~ll~~GadkVii~s~a~~  109 (257)
T PRK02145         32 DPVEIARRYDEQGADELTFLDITATSDG--RDLILPIIEAVASQVFIPLTVGGGVRAVEDVRRLLNAGADKVSMNSSAVA  109 (257)
T ss_pred             CHHHHHHHHHHCCCCEEEEEECCCCCCC--CHHHHHHHHHHHHHCCCCEEEECCCCCHHHHHHHHHCCCCEEEEHHHHHH
T ss_conf             9999999999879998999978887667--54089999999965687489627730468899999819988984155665


Q ss_pred             CHHHHHCCCCCCCHHHHHHHHHHHHHCCCC-CCCE---------------EEECC---CCCHHHHHHHHHHHHHCCCCCC
Q ss_conf             777732058888989999999999987985-5770---------------78668---9899999999999974088886
Q gi|254780485|r  169 SERFYPHVTTTHTFEDRLQTLENVRKSGIK-VCCG---------------GILGL---GEMIDDRIDMLLTLANLSTPPE  229 (328)
Q Consensus       169 ~~~~~~~~~~~~~~~~~l~~~~~a~~~G~~-~~sg---------------~l~G~---gEt~eeri~~l~~lr~l~~~~~  229 (328)
                      .|++..+.               +.+.|=+ +..+               -++-+   -.|.-+..+.+..+.+++.  .
T Consensus       110 np~~v~~~---------------~~~fG~q~Iv~siD~k~~~~~~~~~~~~v~~~~~~~~t~~~~~~~~~~~~~~G~--g  172 (257)
T PRK02145        110 NPQLVRDA---------------ADKYGSQCIVVAIDAKRVSADGEPPRWEVFTHGGRKATGLDAVEWARKMAELGA--G  172 (257)
T ss_pred             CCCHHHHH---------------HHHCCCCCEEEEEEEEECCCCCCCCEEEEEECCCEECCCCCHHHHHHHHHHCCC--C
T ss_conf             93022457---------------876698344999998733677777508999778714367745576568876187--8


Q ss_pred             EEECCCEEECCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCEEEEHHHHHCHHHHHHHHHHC-CCEEEECCEEECCCCC
Q ss_conf             020541120487412445687989999999999996868721423115651656899999809-9889977866515888
Q gi|254780485|r  230 SIPINLLIPIPGSKFEENKKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSG-ANSIFVGDTLLTAKNP  308 (328)
Q Consensus       230 ~v~~~~~~p~~gt~l~~~~~~~~~e~lr~iAi~RL~lP~~~i~i~~~~~~~~~~~~~~~L~~G-aN~~~~g~~~~t~~g~  308 (328)
                      .+-+ .-+-..|| +.   .++ .+.++-++   -..+ ..+.+++|-- -..++.. ++..| ++++..|.- ..-+.-
T Consensus       173 eil~-tdI~rDG~-~~---G~d-l~l~~~i~---~~~~-ipvIasGGi~-s~~di~~-~~~~~~~~av~~g~~-~~~~~~  239 (257)
T PRK02145        173 EILL-TSMDRDGT-KS---GFD-LALTRAVS---DAVP-VPVIASGGVG-SLQHLAD-GITEGHADAVLAASI-FHYGEH  239 (257)
T ss_pred             EEEE-EEECCCCC-CC---CCC-HHHHHHHH---HCCC-CCEEEECCCC-CHHHHHH-HHHHCCCCEEEEHHH-HHCCCC
T ss_conf             6899-99847787-78---889-79999998---6269-9899986899-9999999-998089848765326-777998


Q ss_pred             CHHHHHHHHHHCCCCC
Q ss_conf             9899999999829853
Q gi|254780485|r  309 SYNKDTILFNRLGLIP  324 (328)
Q Consensus       309 ~~~~~~~~i~~~G~~P  324 (328)
                      ++.+..+.+++.|+.-
T Consensus       240 ~i~e~k~~l~~~~~~v  255 (257)
T PRK02145        240 TVGEAKRFMAERGIAV  255 (257)
T ss_pred             CHHHHHHHHHHCCCCC
T ss_conf             9999999999877960


No 239
>COG2185 Sbm Methylmalonyl-CoA mutase, C-terminal domain/subunit (cobalamin-binding) [Lipid metabolism]
Probab=69.90  E-value=8.2  Score=18.40  Aligned_cols=70  Identities=14%  Similarity=0.240  Sum_probs=37.0

Q ss_pred             CCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCCCCHHHHHHHHHHHCCCCCC-EE-EECCCCCHHHHHHHHCCCCCEEE
Q ss_conf             0685799999999996498389973036888744289999988762136883-24-10256999999987415760697
Q gi|254780485|r   87 LINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLGLE-TC-MTLGMLSFEQAQILSKAGLDYYN  163 (328)
Q Consensus        87 ~~~~Eei~~~a~~~~~~G~~~~~l~~~~~~~~~~~~~~~~e~i~~i~~~~~~-i~-~~~g~~~~~~~~~Lk~aG~~~~~  163 (328)
                      ..++||+...|   .+....-+. +++.....   .+...+++..+++.+.. +. +--|.+..+.+.+|+++|++.+.
T Consensus        49 ~~tp~e~v~aA---~~~dv~vIg-vSsl~g~h---~~l~~~lve~lre~G~~~i~v~~GGvip~~d~~~l~~~G~~~if  120 (143)
T COG2185          49 FQTPEEAVRAA---VEEDVDVIG-VSSLDGGH---LTLVPGLVEALREAGVEDILVVVGGVIPPGDYQELKEMGVDRIF  120 (143)
T ss_pred             CCCHHHHHHHH---HHCCCCEEE-EEECCCHH---HHHHHHHHHHHHHHCCCCEEEEECCCCCCHHHHHHHHHCCCEEE
T ss_conf             58999999999---864798899-97344047---89999999999981975548865686681367999981866546


No 240
>PRK00830 consensus
Probab=69.80  E-value=8.3  Score=18.39  Aligned_cols=218  Identities=14%  Similarity=0.069  Sum_probs=112.8

Q ss_pred             HHHHHHHHHHHHCCCEEEEEECCCCCCCCCCHHHHHHHHHHH-CCCCCCEEEECCCCCHHHHHHHHCCCCCEEEEECCC-
Q ss_conf             799999999996498389973036888744289999988762-136883241025699999998741576069751343-
Q gi|254780485|r   91 DQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGV-KSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDT-  168 (328)
Q Consensus        91 Eei~~~a~~~~~~G~~~~~l~~~~~~~~~~~~~~~~e~i~~i-~~~~~~i~~~~g~~~~~~~~~Lk~aG~~~~~~~let-  168 (328)
                      ...++.|+...+.|+.+++++--......+  ....+.++.+ ++.++.+++--|..+.++.+++-++|++.+.++=-. 
T Consensus        34 gdP~~~ak~~~~~gadelhivDld~a~~g~--~~~~~~I~~i~~~~~~pi~vGGGIrs~e~~~~ll~~GadkVvIgS~a~  111 (273)
T PRK00830         34 GDPVELAKRYYEDGADELVFLDITASHEGR--ATMIDVIERTAEEVFIPLTVGGGIRSIEDIRQILRAGADKVSVNTAAV  111 (273)
T ss_pred             CCHHHHHHHHHHCCCCEEEEEEEECCCCCC--CCHHHHHHHHHHHCCCCEEEECCEEECCCHHHHHHCCCCEEECHHHHH
T ss_conf             899999999998799989999532464688--427999999998669958960884377328999976986398379898


Q ss_pred             -CHHHHHCCCCCCCHHHH---HHHHH------------HHHHCCCCCC-CEEEEC-CCCCHHHHHHHHHHHHHCCCCCCE
Q ss_conf             -77773205888898999---99999------------9998798557-707866-898999999999999740888860
Q gi|254780485|r  169 -SERFYPHVTTTHTFEDR---LQTLE------------NVRKSGIKVC-CGGILG-LGEMIDDRIDMLLTLANLSTPPES  230 (328)
Q Consensus       169 -~~~~~~~~~~~~~~~~~---l~~~~------------~a~~~G~~~~-sg~l~G-~gEt~eeri~~l~~lr~l~~~~~~  230 (328)
                       .|++..+.......+-.   +++-+            ...+-|.+.. --.+.| --.|.-+.++.+..+.+++.  ..
T Consensus       112 ~np~~v~~~~~~fGsq~IvvsiD~k~~~~~~~~~~~~~~~~~~g~~~w~~v~~~g~~~~t~~~~~~~~~~~~~~G~--ge  189 (273)
T PRK00830        112 KNPEFIREASDIFGSQCIVVAIDCKRNYNPKDNPDKTIVELEDGTCAWYEVVIYGGREFTGIDAVQWAKKVEELGA--GE  189 (273)
T ss_pred             HCCHHHHHHHHHCCCCEEEEEEEEECCCCCCCCCCCEEEECCCCCCCEEEEEEECCCCCCCCCHHHHHHHHHHCCC--CE
T ss_conf             5907789999876990599999843376654567621454047874228999707803378679999999986498--86


Q ss_pred             EECCCEEECCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCEEEEHHHHHCHHHHHHHHHHCCCEEEECCEEECCCCCCH
Q ss_conf             20541120487412445687989999999999996868721423115651656899999809988997786651588898
Q gi|254780485|r  231 IPINLLIPIPGSKFEENKKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSY  310 (328)
Q Consensus       231 v~~~~~~p~~gt~l~~~~~~~~~e~lr~iAi~RL~lP~~~i~i~~~~~~~~~~~~~~~L~~GaN~~~~g~~~~t~~g~~~  310 (328)
                      +-+ .-+-..|| +    .....+.++-++-  .  -+..+.+++|- .-..+..+..-..+++++.+|.-+ .-+.-++
T Consensus       190 il~-tdI~rDGt-~----~G~d~~l~~~i~~--~--~~iPvIasGGv-~~~~di~~~~~~~~~~~v~~gs~f-~~~~~si  257 (273)
T PRK00830        190 ILL-TSMDRDGT-K----DGYDIPITKKISE--E--VDIPVIASGGV-GNPEHIYEGFSDGKADAALAASIF-HFNEYSI  257 (273)
T ss_pred             EEE-EEECCCCC-C----CCCCHHHHHHHHH--C--CCCCEEEECCC-CCHHHHHHHHHHCCCCEEEEEHHH-HCCCCCH
T ss_conf             888-78757796-5----6889699999986--3--79988998899-999999999983898688770056-6699799


Q ss_pred             HHHHHHHHHCCCCC
Q ss_conf             99999999829853
Q gi|254780485|r  311 NKDTILFNRLGLIP  324 (328)
Q Consensus       311 ~~~~~~i~~~G~~P  324 (328)
                      .+..+.+++.|+.-
T Consensus       258 ~e~k~~L~~~~i~v  271 (273)
T PRK00830        258 REVKEYLRERGIPV  271 (273)
T ss_pred             HHHHHHHHHCCCCC
T ss_conf             99999999877963


No 241
>PRK13753 dihydropteroate synthase; Provisional
Probab=69.42  E-value=8.4  Score=18.33  Aligned_cols=155  Identities=16%  Similarity=0.234  Sum_probs=89.7

Q ss_pred             EEEEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCEEEEEECC-CCCC-----CCCCHHHH
Q ss_conf             69998645307868342321243354777564100068579999999999649838997303-6888-----74428999
Q gi|254780485|r   52 IQLSKLLNIKTGGCPENCGYCNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAA-WREP-----KERDLSII  125 (328)
Q Consensus        52 V~~~~~in~~TN~C~~~C~fCaf~~~~~~~~~~~~~~~~Eei~~~a~~~~~~G~~~~~l~~~-~~~~-----~~~~~~~~  125 (328)
                      |.+-+++|+ |.-        +||-       ....++.++.++.+++..+.|+.-+-+++- .++.     ...+++++
T Consensus         2 v~IMGIlNv-TPD--------SFsD-------gg~~~~~~~a~~~a~~mi~~GAdIIDIGgeSTRPga~~vs~eeE~~Rv   65 (279)
T PRK13753          2 VTVFGILNL-TED--------SFFD-------ESRRLDPAGAVTAAIEMLRVGSDVVDVGPAASHPDARPVSPADEIRRI   65 (279)
T ss_pred             CEEEEEEEC-CCC--------CCCC-------CCCCCCHHHHHHHHHHHHHCCCCEEEECCCCCCCCCCCCCHHHHHHHH
T ss_conf             549999848-999--------9988-------875789999999999999879969997987789999808999999999


Q ss_pred             HHHHHHHCCCCCCEEEECCCCCHHHHHHHHCCCCCEEEE--ECCCCHHHHHC----------CC----C----C--C-C-
Q ss_conf             998876213688324102569999999874157606975--13437777320----------58----8----8--8-9-
Q gi|254780485|r  126 VDMIKGVKSLGLETCMTLGMLSFEQAQILSKAGLDYYNH--NIDTSERFYPH----------VT----T----T--H-T-  181 (328)
Q Consensus       126 ~e~i~~i~~~~~~i~~~~g~~~~~~~~~Lk~aG~~~~~~--~let~~~~~~~----------~~----~----~--~-~-  181 (328)
                      ...++.+++....  +|+.+...+..+.--++|++.+|-  .+. .|..+..          .|    +    .  + . 
T Consensus        66 ~pvi~~l~~~~~~--iSIDT~~~~Va~~Al~~Ga~iINDIsG~~-d~~m~~~va~~~~~~vlMH~~~~~~~~~~~~~~~~  142 (279)
T PRK13753         66 APLLDALSDQMHR--VSIDSFQPETQRYALKRGVGYLNDIQGFP-DPALYPDIAEADCRLVVMHSAQRDGIATRTGHLRP  142 (279)
T ss_pred             HHHHHHHHHHCCC--EEEECCCHHHHHHHHHCCCCEEECCCCCC-CHHHHHHHHHHCCCEEEEECCCCCCCCCCCCCCCC
T ss_conf             9999999860896--79978859999999983977884501033-83689999971998899826899988777778887


Q ss_pred             ------HHHHH-HHHHHHHHCCCCCC-----CEEEECCCCCHHHHHHHHHHHHHCC
Q ss_conf             ------89999-99999998798557-----7078668989999999999997408
Q gi|254780485|r  182 ------FEDRL-QTLENVRKSGIKVC-----CGGILGLGEMIDDRIDMLLTLANLS  225 (328)
Q Consensus       182 ------~~~~l-~~~~~a~~~G~~~~-----sg~l~G~gEt~eeri~~l~~lr~l~  225 (328)
                            ..+|+ +.++.+.+.|++..     .|+=||.|-+.++-++.+..|.++.
T Consensus       143 ~dvv~ev~~~~~~~i~~~~~~Gi~~~~IilDPGiGF~~gK~~~~nl~il~~l~~l~  198 (279)
T PRK13753        143 EDALDEIVRFFEARVSALRRSGVAADRLILDPGMGFFLSPAPETSLHVLSNLQKLK  198 (279)
T ss_pred             CCHHHHHHHHHHHHHHHHHHCCCCHHHEEECCCCCCCCCCCHHHHHHHHHHHHHHH
T ss_conf             55799999999999999998799867789837989499987788999998799997


No 242
>pfam04131 NanE Putative N-acetylmannosamine-6-phosphate epimerase. This family represents a putative ManNAc-6-P-to-GlcNAc-6P epimerase in the N-acetylmannosamine (ManNAc) utilisation pathway found mainly in pathogenic bacteria.
Probab=68.79  E-value=8.7  Score=18.25  Aligned_cols=163  Identities=18%  Similarity=0.224  Sum_probs=85.7

Q ss_pred             HHHHHHHHCCCEEEEEECCCCCCCCCCHHHHHHHHHHH---------CCC--CCCEEEECCCCCHHHHHHHHCCCCCEEE
Q ss_conf             99999996498389973036888744289999988762---------136--8832410256999999987415760697
Q gi|254780485|r   95 KEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGV---------KSL--GLETCMTLGMLSFEQAQILSKAGLDYYN  163 (328)
Q Consensus        95 ~~a~~~~~~G~~~~~l~~~~~~~~~~~~~~~~e~i~~i---------~~~--~~~i~~~~g~~~~~~~~~Lk~aG~~~~~  163 (328)
                      +.|+.+...|+.-+-..+         ++.+ ..+|..         |..  +-.+.+   ..+.++...|.++|+|.+-
T Consensus         3 ~MA~Aa~~gGA~giR~~~---------~~dI-~aik~~v~vPIIGi~K~~~~~~~VyI---TPt~~ev~~l~~aGadiIA   69 (192)
T pfam04131         3 AMALAAEQAGAVGIRIEG---------VNNI-KAIRAIVDLPIIGIVKRDLPDSPVRI---TPTMKDIDELANAGADIIA   69 (192)
T ss_pred             HHHHHHHHCCCEEEECCC---------HHHH-HHHHHHCCCCEEEEEECCCCCCCCEE---CCCHHHHHHHHHCCCCEEE
T ss_conf             899999978964997199---------9999-99998589987999856789998165---5889999999985999999


Q ss_pred             EECCCCHHHHHCCCCCCCHHHHHHHHHHHHHCCCCCCCEEEECCCCCHHHHHHHHHHHHHCCCCCCEEECCCEEECCCCC
Q ss_conf             51343777732058888989999999999987985577078668989999999999997408888602054112048741
Q gi|254780485|r  164 HNIDTSERFYPHVTTTHTFEDRLQTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSK  243 (328)
Q Consensus       164 ~~let~~~~~~~~~~~~~~~~~l~~~~~a~~~G~~~~sg~l~G~gEt~eeri~~l~~lr~l~~~~~~v~~~~~~p~~gt~  243 (328)
                        +|...+.    +| .+.+   +.++..|+.|.     .+.-=.-|.||-.    ...+++...-+-.+.-+++  .|+
T Consensus        70 --~DaT~R~----RP-~~~~---~lv~~i~~~~~-----l~MAD~st~eea~----~A~~~G~D~I~TTL~GYT~--~t~  128 (192)
T pfam04131        70 --LDGTDRP----RP-VDIE---SFIKRIKEKGQ-----LAMADCSTFEEGL----NAHKLGVDIVGTTLSGYTG--GSN  128 (192)
T ss_pred             --EECCCCC----CC-CCHH---HHHHHHHHHCC-----EEEEECCCHHHHH----HHHHCCCCEEECCCCCCCC--CCC
T ss_conf             --8467898----97-5899---99999998199-----8899749999999----9998599999823255789--999


Q ss_pred             CCCCCCCCHHHHHHHHHHHHHHCCCCCCEEEEHHHHHCHHHHHHHHHHCCCEEEECCEE
Q ss_conf             24456879899999999999968687214231156516568999998099889977866
Q gi|254780485|r  244 FEENKKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTL  302 (328)
Q Consensus       244 l~~~~~~~~~e~lr~iAi~RL~lP~~~i~i~~~~~~~~~~~~~~~L~~GaN~~~~g~~~  302 (328)
                      -    ..++.++++-++-    . + ..-|.=||.. .++....+|..||+++.+|.-+
T Consensus       129 ~----~~pD~~ll~~l~~----~-~-~pvIaEGri~-tPe~a~~a~~~GA~aVVVGsAI  176 (192)
T pfam04131       129 P----AEPDFQLVKTLSE----A-G-CFVIAEGRYN-TPELAKKAIEIGADAVTVGSAI  176 (192)
T ss_pred             C----CCCCHHHHHHHHH----C-C-CCEEEECCCC-CHHHHHHHHHCCCCEEEECCCC
T ss_conf             9----9997899999986----8-9-9399857989-9999999998399899989653


No 243
>PRK08318 dihydropyrimidine dehydrogenase; Validated
Probab=68.73  E-value=8.7  Score=18.24  Aligned_cols=193  Identities=16%  Similarity=0.090  Sum_probs=88.7

Q ss_pred             CCHHHHHHHHHHHCCC--CCCEEEEC-CCCCHHH----HHHHHCCCCCEEEEECCCCHHH----HHCCCCCCCHHHHHHH
Q ss_conf             4289999988762136--88324102-5699999----9987415760697513437777----3205888898999999
Q gi|254780485|r  120 RDLSIIVDMIKGVKSL--GLETCMTL-GMLSFEQ----AQILSKAGLDYYNHNIDTSERF----YPHVTTTHTFEDRLQT  188 (328)
Q Consensus       120 ~~~~~~~e~i~~i~~~--~~~i~~~~-g~~~~~~----~~~Lk~aG~~~~~~~let~~~~----~~~~~~~~~~~~~l~~  188 (328)
                      +.++++++.++.+|..  +..+.+|+ |..++++    .+.+.++|+|.+.+|+-. |..    .-..--..+.+---++
T Consensus        81 ~~le~~L~~i~~~k~~~P~~~vIaSI~g~~~~e~w~~la~~~e~~GaDalELNiSC-Pn~~~~~~~G~~~gq~pe~v~~i  159 (413)
T PRK08318         81 RPLEVNLREIRRVKRDYPDRALIASIMVECNEEEWKEIAPLVEETGADGIELNFGC-PHGMSERGMGSAVGQVPELVEMV  159 (413)
T ss_pred             CCHHHHHHHHHHHHHCCCCCEEEEEEECCCCHHHHHHHHHHHHHCCCCEEEEECCC-CCCCCCCCCCHHHCCCHHHHHHH
T ss_conf             58999999999988607897089999458788999999998665188779995556-77666665551105799999999


Q ss_pred             HHHHHH-CCCCCCCEEEECCCCCHHHHHHHHHHHHHCCCCCCEE-ECCCEEECCCCCCCC------------CCCCCH--
Q ss_conf             999998-7985577078668989999999999997408888602-054112048741244------------568798--
Q gi|254780485|r  189 LENVRK-SGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESI-PINLLIPIPGSKFEE------------NKKVDP--  252 (328)
Q Consensus       189 ~~~a~~-~G~~~~sg~l~G~gEt~eeri~~l~~lr~l~~~~~~v-~~~~~~p~~gt~l~~------------~~~~~~--  252 (328)
                      .++.++ ..+++    ++=+.-...+..+....+.+-+.  +++ .+|.+.+..+...+.            ....|.  
T Consensus       160 ~~~Vk~~~~iPV----~vKLsPnvtdi~~iA~aa~~aGA--Dgv~liNTi~~~~~iDid~~~~~p~i~~~~~~GGlSG~a  233 (413)
T PRK08318        160 TRWVKRGSRLPV----IAKLTPNITDIREPARAAKRGGA--DAVSLINTINSITGVDLDRMIPMPIVNGKSSHGGYCGPA  233 (413)
T ss_pred             HHHHHHHCCCCE----EEEECCCCCCHHHHHHHHHHCCC--CEEEEEECCCCCCCCCCCCCCCEEECCCCCCCCCCCCHH
T ss_conf             999885068856----99828997528999999997699--889998147865532022355302106777767666456


Q ss_pred             --HHHHHHHHH-HHH-HCCCCCCEEEE-HHHHHCHHHHHHHHHHCCCEEEECCEEECCCCCC-----HHHHHHHHHHCCC
Q ss_conf             --999999999-999-68687214231-1565165689999980998899778665158889-----8999999998298
Q gi|254780485|r  253 --IEHVRIISV-ARI-LMPKSRLRLAA-GRAMMSDELQALCFFSGANSIFVGDTLLTAKNPS-----YNKDTILFNRLGL  322 (328)
Q Consensus       253 --~e~lr~iAi-~RL-~lP~~~i~i~~-~~~~~~~~~~~~~L~~GaN~~~~g~~~~t~~g~~-----~~~~~~~i~~~G~  322 (328)
                        --.||+++. +|- -+|+  ++|.+ |=..-+.+. -.-|++||+.+.++--+ -..|..     .++..+.+.+-||
T Consensus       234 ikPiALr~V~~i~~~~~~~~--ipIiG~GGI~s~~Da-~e~ilaGAsaVQv~Ta~-~~~G~~ii~~i~~gL~~~m~~~G~  309 (413)
T PRK08318        234 VKPIALNMVAEIARDPETRG--LPISGIGGIETWRDA-AEFILLGAGTVQVCTAA-MQYGFRIVEDMISGLSHYMDEKGF  309 (413)
T ss_pred             HHHHHHHHHHHHHHHCCCCC--CCEEEECCCCCHHHH-HHHHHHCCCCEEEEEHH-HHCCCHHHHHHHHHHHHHHHHCCC
T ss_conf             76999999999986346788--377975685989999-99998278921675101-433844899999999999998099


Q ss_pred             C
Q ss_conf             5
Q gi|254780485|r  323 I  323 (328)
Q Consensus       323 ~  323 (328)
                      .
T Consensus       310 ~  310 (413)
T PRK08318        310 A  310 (413)
T ss_pred             C
T ss_conf             7


No 244
>PRK10060 RNase II stability modulator; Provisional
Probab=68.63  E-value=8.7  Score=18.23  Aligned_cols=10  Identities=10%  Similarity=0.328  Sum_probs=4.6

Q ss_pred             HHHHHHHCCC
Q ss_conf             9999998798
Q gi|254780485|r  188 TLENVRKSGI  197 (328)
Q Consensus       188 ~~~~a~~~G~  197 (328)
                      .|..||+.|-
T Consensus       380 Amy~AK~~Gr  389 (663)
T PRK10060        380 AMYTAKEGGR  389 (663)
T ss_pred             HHHHHHHCCC
T ss_conf             9999997089


No 245
>PRK03659 glutathione-regulated potassium-efflux system protein KefB; Provisional
Probab=67.77  E-value=9.1  Score=18.11  Aligned_cols=46  Identities=11%  Similarity=0.190  Sum_probs=28.9

Q ss_pred             CCHHHHHHHHHHHHHHCCCCCCEEEEHHHHHCHHHHHHHHHHCCCEEEEC
Q ss_conf             79899999999999968687214231156516568999998099889977
Q gi|254780485|r  250 VDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVG  299 (328)
Q Consensus       250 ~~~~e~lr~iAi~RL~lP~~~i~i~~~~~~~~~~~~~~~L~~GaN~~~~g  299 (328)
                      .+++...+++...|-..|+..|-.-+ |.  . .-......+|||.+.-+
T Consensus       473 ~d~~~~~~iv~~~r~~~P~l~I~aRa-r~--~-~~~~~L~~~Ga~~vv~E  518 (602)
T PRK03659        473 NEPEDTMKLVELCQQHFPHLHILARA-RG--R-VEAHELLQAGVTQFSRE  518 (602)
T ss_pred             CCHHHHHHHHHHHHHHCCCCEEEEEE-CC--H-HHHHHHHHCCCCEEECC
T ss_conf             98999999999999878699699986-97--8-99999997899978662


No 246
>pfam02662 FlpD Methyl-viologen-reducing hydrogenase, delta subunit. This family consist of methyl-viologen-reducing hydrogenase, delta subunit / heterodisulphide reductase. No specific functions have been assigned to this subunit. The aligned region corresponds to almost the entire delta chain sequence and contains 4 conserved cysteine residues. However, in two Archaeoglobus sequences this region corresponds to only the C-terminus of these proteins.
Probab=67.09  E-value=8.1  Score=18.43  Aligned_cols=18  Identities=22%  Similarity=0.335  Sum_probs=8.7

Q ss_pred             CHHHHHHHHHHCCCEEEE
Q ss_conf             656899999809988997
Q gi|254780485|r  281 SDELQALCFFSGANSIFV  298 (328)
Q Consensus       281 ~~~~~~~~L~~GaN~~~~  298 (328)
                      .+.+-..+|..|||++++
T Consensus        41 ~~~~il~A~~~GADGV~V   58 (124)
T pfam02662        41 NPSLILKALEKGADGVLV   58 (124)
T ss_pred             CHHHHHHHHHCCCCEEEE
T ss_conf             999999999869997999


No 247
>cd02810 DHOD_DHPD_FMN Dihydroorotate dehydrogenase (DHOD) and Dihydropyrimidine dehydrogenase (DHPD) FMN-binding domain.  DHOD catalyzes the oxidation of (S)-dihydroorotate to orotate. This is the fourth step and the only redox reaction in the de novo biosynthesis of UMP, the precursor of all pyrimidine nucleotides. DHOD requires FMN as co-factor. DHOD divides into class 1 and class 2 based on their amino acid sequences and cellular location. Members of class 1 are cytosolic enzymes and multimers while class 2 enzymes are membrane associated and monomeric. The class 1 enzymes can be further divided into subtypes 1A and 1B which are homodimers and heterotetrameric proteins, respectively. DHPD catalyzes the first step in pyrimidine degradation: the NADPH-dependent reduction of uracil and thymine to the corresponding 5,6-dihydropyrimidines. DHPD contains two FAD, two FMN and eight [4Fe-4S] clusters, arranged in two electron transfer chains that pass its homodimeric interface twice. Two of
Probab=66.81  E-value=9.5  Score=17.99  Aligned_cols=170  Identities=15%  Similarity=0.112  Sum_probs=87.2

Q ss_pred             CCHHHHHHHHHHHCCC--CCCEEEECCCCCHHH----HHHHHCCCCCEEEEECCCCHHHHHCCCCCCCHHHHHHHHHHHH
Q ss_conf             4289999988762136--883241025699999----9987415760697513437777320588889899999999999
Q gi|254780485|r  120 RDLSIIVDMIKGVKSL--GLETCMTLGMLSFEQ----AQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVR  193 (328)
Q Consensus       120 ~~~~~~~e~i~~i~~~--~~~i~~~~g~~~~~~----~~~Lk~aG~~~~~~~let~~~~~~~~~~~~~~~~~l~~~~~a~  193 (328)
                      ...+++.+.++..+..  +..+.+|++-.+.++    .+++.++|+|.+.+|+-+ |..-.......+.+...++++..+
T Consensus        80 ~g~~~~~~~l~~~~~~~~~~pli~Si~~~~~~~~~~~a~~~~~~gad~lElNiSc-Pn~~~~~~~~~~~~~~~~i~~~v~  158 (289)
T cd02810          80 LGLDVWLQDIAKAKKEFPGQPLIASVGGSSKEDYVELARKIERAGAKALELNLSC-PNVGGGRQLGQDPEAVANLLKAVK  158 (289)
T ss_pred             CCHHHHHHHHHHHHHCCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCEEEEEEEC-CCCCCCCCCCCCHHHHHHHHHHHH
T ss_conf             7889999999999861799539997888987899999999998479848998403-675655320149999999999998


Q ss_pred             HC-CCCCCCEEEECC--CCCHHHHHHHHHHHHHCCCCCCEEE-CCCEEECC---CC--C-CC-CCCCCCH----HHHHHH
Q ss_conf             87-985577078668--9899999999999974088886020-54112048---74--1-24-4568798----999999
Q gi|254780485|r  194 KS-GIKVCCGGILGL--GEMIDDRIDMLLTLANLSTPPESIP-INLLIPIP---GS--K-FE-ENKKVDP----IEHVRI  258 (328)
Q Consensus       194 ~~-G~~~~sg~l~G~--gEt~eeri~~l~~lr~l~~~~~~v~-~~~~~p~~---gt--~-l~-~~~~~~~----~e~lr~  258 (328)
                      +. .+++    ++=+  -.+.++..+.+..+.+.+.  +++. +|.+....   .+  + .. .....|.    .-.|++
T Consensus       159 ~~~~~Pv----~vKLsp~~~~~~~~~ia~~~~~~ga--~gv~~~Nt~~~~~~~~~~~~~~~~~~~gGlSG~~i~~~al~~  232 (289)
T cd02810         159 AAVDIPL----LVKLSPYFDLEDIVELAKAAERAGA--DGLTAINTISGRVVDLKTVGPGPKRGTGGLSGAPIRPLALRW  232 (289)
T ss_pred             HCCCCCE----EEECCCCCCHHHHHHHHHHHHHCCC--CEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHH
T ss_conf             6026874----8842788761689999999997599--689996787765554444554456776523662778899999


Q ss_pred             HHHHHHHCCCCCCEEEEHHHHHCHHHHHHHHHHCCCEEE
Q ss_conf             999999686872142311565165689999980998899
Q gi|254780485|r  259 ISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIF  297 (328)
Q Consensus       259 iAi~RL~lP~~~i~i~~~~~~~~~~~~~~~L~~GaN~~~  297 (328)
                      ++-.|=.++.....+..|=.. ..+-....|.+||+.+.
T Consensus       233 v~~~~~~~~~~i~Iig~GGI~-~~~da~e~i~aGA~~Vq  270 (289)
T cd02810         233 VARLAARLQLDIPIIGVGGID-SGEDVLEMLMAGASAVQ  270 (289)
T ss_pred             HHHHHHHCCCCCEEEEECCCC-CHHHHHHHHHCCCCHHH
T ss_conf             999999749996099989939-99999999984997999


No 248
>PRK02227 hypothetical protein; Provisional
Probab=66.12  E-value=9.8  Score=17.90  Aligned_cols=129  Identities=16%  Similarity=0.212  Sum_probs=70.9

Q ss_pred             CHHHHHHHHHHHHHCCCEEEEEECCCCCCCCCCHHHHHHHHHHHCCCCCC---EEEE------CC-CCCHHHHHHHHCCC
Q ss_conf             85799999999996498389973036888744289999988762136883---2410------25-69999999874157
Q gi|254780485|r   89 NVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLGLE---TCMT------LG-MLSFEQAQILSKAG  158 (328)
Q Consensus        89 ~~Eei~~~a~~~~~~G~~~~~l~~~~~~~~~~~~~~~~e~i~~i~~~~~~---i~~~------~g-~~~~~~~~~Lk~aG  158 (328)
                      ....+...+..+...|+.-+-++..+........+.+....+.++.....   |.+-      .+ +...+.....+++|
T Consensus        65 ~~~~i~~a~~~~a~~GvdyVKvGl~~~~~~~~~~~~l~~v~~a~k~~~~~~~~VaV~yAD~~~~~~~~p~~i~~~a~~~g  144 (239)
T PRK02227         65 KPGTAALAALGAAATGVDYVKVGLYGTKTAEEAVEVMAAVVRAVKDLDPNKRVVAVLYADAGRDGSISPLDLPAIAAEAG  144 (239)
T ss_pred             CCHHHHHHHHHHHHCCCCEEEEECCCCCCHHHHHHHHHHHHHHHHHCCCCCEEEEEEEECCCCCCCCCHHHHHHHHHHCC
T ss_conf             93799999987661399989994578886799999999999987511679739999983264224788677899999859


Q ss_pred             CCEEEEECCCCHHHHHCCCCCCCHHHHHHHHHHHHHCCCCCCCEEEECCCCCHHHHHHHHHHHHHCCCC
Q ss_conf             606975134377773205888898999999999998798557707866898999999999999740888
Q gi|254780485|r  159 LDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTP  227 (328)
Q Consensus       159 ~~~~~~~let~~~~~~~~~~~~~~~~~l~~~~~a~~~G~~~~sg~l~G~gEt~eeri~~l~~lr~l~~~  227 (328)
                      .+.+.  +||...-........+.++--+..+.+|+.|+.++   +-|..     +.+|+..|+.++..
T Consensus       145 ~~gvM--iDT~~Kdg~sL~d~~~~~~L~~fv~~a~~~gl~~g---LAGSL-----~~~di~~L~~l~Pd  203 (239)
T PRK02227        145 FDGAM--LDTAGKDGRSLFDHMDEEELAEFVAEARAHGLMTA---LAGSL-----KLEDIPALKRLGPD  203 (239)
T ss_pred             CCEEE--EECCCCCCCCHHHCCCHHHHHHHHHHHHHCCCEEE---EECCC-----CHHHHHHHHHCCCC
T ss_conf             98999--86367888753423899999999999997599399---84568-----87888999756999


No 249
>PRK09282 pyruvate carboxylase subunit B; Validated
Probab=65.78  E-value=9.9  Score=17.86  Aligned_cols=68  Identities=12%  Similarity=0.113  Sum_probs=34.1

Q ss_pred             CCHHHHHHHHHHHHHCCCCCCE----E-ECCCEEECCCCCCCCCC----CCC----HHHHHHHHHHHHHHCCCCCCEEEE
Q ss_conf             8999999999999740888860----2-05411204874124456----879----899999999999968687214231
Q gi|254780485|r  209 EMIDDRIDMLLTLANLSTPPES----I-PINLLIPIPGSKFEENK----KVD----PIEHVRIISVARILMPKSRLRLAA  275 (328)
Q Consensus       209 Et~eeri~~l~~lr~l~~~~~~----v-~~~~~~p~~gt~l~~~~----~~~----~~e~lr~iAi~RL~lP~~~i~i~~  275 (328)
                      +...+.-+++..+|......++    + +-....+.||.-+.+..    ...    -.|.++.++-.|-.|-+ .+.++-
T Consensus       262 ~~l~~~~~y~~~vr~~y~~~e~~~~~~d~~v~~hq~PGG~~snl~~Ql~~~g~~dr~~eV~~e~~~V~~~lG~-~~~VTP  340 (580)
T PRK09282        262 ELLEEIAAYFREVRKKYAKFEGELKGVDSRVLVAQVPGGMLSNLESQLKEQNALDKLDEVLEEIPRVREDLGY-PPLVTP  340 (580)
T ss_pred             HHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHEEECCCCCHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHCCC-CCEECC
T ss_conf             9999999999999998532786666689535651488206677999999768475699999999999997599-861284


Q ss_pred             HH
Q ss_conf             15
Q gi|254780485|r  276 GR  277 (328)
Q Consensus       276 ~~  277 (328)
                      +.
T Consensus       341 ~S  342 (580)
T PRK09282        341 TS  342 (580)
T ss_pred             HH
T ss_conf             99


No 250
>TIGR02491 NrdG anaerobic ribonucleoside-triphosphate reductase activating protein; InterPro: IPR012837    This enzyme  is a member of the radical-SAM protein and utilises S-adenosyl methionine, an iron-sulphur cluster and a reductant (dihydroflavodoxin ) to produce a glycine-centred radical in the class III (anaerobic) ribonucleotide triphosphate reductase (NrdD, IPR009161 from INTERPRO). The two components form an alpha-2/beta-2 heterodimer.; GO: 0043365 [formate-C-acetyltransferase]-activating enzyme activity, 0051539 4 iron 4 sulfur cluster binding, 0005737 cytoplasm.
Probab=65.55  E-value=10  Score=17.83  Aligned_cols=94  Identities=11%  Similarity=0.164  Sum_probs=52.8

Q ss_pred             EEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCE--EEEEECCCCCCCCCCHHHHHHHHHH
Q ss_conf             99864530786834232124335477756410006857999999999964983--8997303688874428999998876
Q gi|254780485|r   54 LSKLLNIKTGGCPENCGYCNQSVHNKSKLKASKLINVDQVLKEAKNAKENGAT--RYCMGAAWREPKERDLSIIVDMIKG  131 (328)
Q Consensus        54 ~~~~in~~TN~C~~~C~fCaf~~~~~~~~~~~~~~~~Eei~~~a~~~~~~G~~--~~~l~~~~~~~~~~~~~~~~e~i~~  131 (328)
                      ++.-+.+ + .|.-.|.=| |.+..-. ...-..++.+..-+.++.+.+.++.  -+.+ +||+|..+.-++.++++++.
T Consensus        16 ~R~slfv-a-GC~H~C~GC-~N~~TW~-~~~G~~~t~~~~~~i~~~l~~~~~~~~G~tl-sGGDPL~~~N~~~~~~l~k~   90 (158)
T TIGR02491        16 IRVSLFV-A-GCKHHCEGC-FNKETWN-FNGGEEFTEELEKEIIRDLNDNPILIDGLTL-SGGDPLYPANVEELIELVKK   90 (158)
T ss_pred             EEEEEEE-C-CCCCCCCCC-CCCCCCC-CCCCCCCCHHHHHHHHHHHCCCCCEEEEEEE-CCCCCCCCCCHHHHHHHHHH
T ss_conf             4899860-4-760388888-7835557-6789420368899999985128816630143-18888872443689999999


Q ss_pred             HCCCCC-C-EEEECCCCCHHHHH
Q ss_conf             213688-3-24102569999999
Q gi|254780485|r  132 VKSLGL-E-TCMTLGMLSFEQAQ  152 (328)
Q Consensus       132 i~~~~~-~-i~~~~g~~~~~~~~  152 (328)
                      +|...+ . |.+=.|..=+|-+.
T Consensus        91 ~k~~~P~kdIW~wTGY~~Eei~~  113 (158)
T TIGR02491        91 IKAELPEKDIWLWTGYTWEEILE  113 (158)
T ss_pred             HHHHCCCCCEEEECCCCHHHHHC
T ss_conf             99857899689830766888750


No 251
>PRK13113 consensus
Probab=65.46  E-value=10  Score=17.82  Aligned_cols=202  Identities=13%  Similarity=0.128  Sum_probs=113.4

Q ss_pred             CHHHHHHHHHHHHHCCCEEEEEECCCCCCC-CC---------------CHHHHHHHHHHHCCCCC---CEEEE---C-CC
Q ss_conf             857999999999964983899730368887-44---------------28999998876213688---32410---2-56
Q gi|254780485|r   89 NVDQVLKEAKNAKENGATRYCMGAAWREPK-ER---------------DLSIIVDMIKGVKSLGL---ETCMT---L-GM  145 (328)
Q Consensus        89 ~~Eei~~~a~~~~~~G~~~~~l~~~~~~~~-~~---------------~~~~~~e~i~~i~~~~~---~i~~~---~-g~  145 (328)
                      +.|.-++.++...+.|+.-+-++-=.-+|. +.               .++.++++++.++....   .+.++   + ..
T Consensus        29 ~~e~s~~~~~~l~~~GaDiiElGiPFSDP~ADGPvIq~A~~rAL~~G~~~~~~~~~v~~~r~~~~~~PivlM~Y~N~i~~  108 (263)
T PRK13113         29 DYDTSLEVMRGLPAAGVDIIELGMPFTDPMADGPTIQLAGQRALEGGMTLDRTLDMVRAFRKEDDTTPIVMMGYYNPIYS  108 (263)
T ss_pred             CHHHHHHHHHHHHHCCCCEEEECCCCCCCCCCCHHHHHHHHHHHHCCCCHHHHHHHHHHHHCCCCCCCEEEEECHHHHHH
T ss_conf             97999999999997699999978988887765899999999999779838899999997512389988899831368988


Q ss_pred             CC-HHHHHHHHCCCCCEEEEECCCCHHHHHCCCCCCCHHHHHHHHHHHHHCCCCCCCEEEECCCCCHHHHHHHHHHHHHC
Q ss_conf             99-99999874157606975134377773205888898999999999998798557707866898999999999999740
Q gi|254780485|r  146 LS-FEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANL  224 (328)
Q Consensus       146 ~~-~~~~~~Lk~aG~~~~~~~let~~~~~~~~~~~~~~~~~l~~~~~a~~~G~~~~sg~l~G~gEt~eeri~~l~~lr~l  224 (328)
                      .. +.-+++.+++|++.+++             |.-.+++--+..+.+++.|+..-  .++.. -|.++|+..+....  
T Consensus       109 ~G~e~F~~~~~~~GvdGvIi-------------pDLP~eE~~~~~~~~~~~~l~~I--~lvaP-tt~~~Ri~~i~~~a--  170 (263)
T PRK13113        109 RGVDRFLAEAKEAGIDGLIV-------------VDLPPEEDSELCLPAQAAGLNFI--RLATP-TTDDRRLPKVLQNT--  170 (263)
T ss_pred             HHHHHHHHHHHHCCCCEEEE-------------CCCCHHHHHHHHHHHHHCCCCEE--EEECC-CCCHHHHHHHHHCC--
T ss_conf             56999999987779436971-------------79997888999999997798679--99479-99999999998338--


Q ss_pred             CCCCCEEECCCEEECCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCEEEEHHHHHCHHHHHHHHHHCCCEEEECCEEEC
Q ss_conf             88886020541120487412445687989999999999996868721423115651656899999809988997786651
Q gi|254780485|r  225 STPPESIPINLLIPIPGSKFEENKKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLT  304 (328)
Q Consensus       225 ~~~~~~v~~~~~~p~~gt~l~~~~~~~~~e~lr~iAi~RL~lP~~~i~i~~~~~~~~~~~~~~~L~~GaN~~~~g~~~~t  304 (328)
                         ..++-   .+...|+.-  .......+....++-.|-..   .+++..|-.--.++.. ..+..+||++++|..++.
T Consensus       171 ---~gFiY---~Vs~~GvTG--~~~~~~~~~~~~i~~ik~~t---~~Pv~vGFGI~~~e~~-~~~~~~ADGvIVGSa~v~  238 (263)
T PRK13113        171 ---SGFVY---YVSITGITG--AAAAQAADVAPEVARIKAAT---DLPVIVGFGITTPEAA-QAIAGVADGCVVGSAIVK  238 (263)
T ss_pred             ---CCCEE---EEECCCCCC--CCCCCHHHHHHHHHHHHHCC---CCCEEEECCCCCHHHH-HHHHCCCCEEEECHHHHH
T ss_conf             ---98489---983455668--77554377999999998547---9988998378998999-999733999998689999


Q ss_pred             --CCCCCHHHHHHHHHHC
Q ss_conf             --5888989999999982
Q gi|254780485|r  305 --AKNPSYNKDTILFNRL  320 (328)
Q Consensus       305 --~~g~~~~~~~~~i~~~  320 (328)
                        ..|.+.++..++++++
T Consensus       239 ~i~e~~~~~~~~~~v~~l  256 (263)
T PRK13113        239 LIGEGRPVAEVLAFVATL  256 (263)
T ss_pred             HHHHCCCHHHHHHHHHHH
T ss_conf             998289989999999999


No 252
>PRK13587 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional
Probab=65.35  E-value=10  Score=17.81  Aligned_cols=178  Identities=12%  Similarity=0.137  Sum_probs=86.1

Q ss_pred             HHHHHHH-CCCEEEEEECC--CCCCCCCCHHHHHHHHHHH-CCCCCCEEEECCCCCHHHHHHHHCCCCCEEEEECCC--C
Q ss_conf             9999996-49838997303--6888744289999988762-136883241025699999998741576069751343--7
Q gi|254780485|r   96 EAKNAKE-NGATRYCMGAA--WREPKERDLSIIVDMIKGV-KSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDT--S  169 (328)
Q Consensus        96 ~a~~~~~-~G~~~~~l~~~--~~~~~~~~~~~~~e~i~~i-~~~~~~i~~~~g~~~~~~~~~Lk~aG~~~~~~~let--~  169 (328)
                      .++...+ .|++++|++--  -........+    +++.+ +...+.+.+.-|..+.+..+++.++|++++.++-..  .
T Consensus        36 ~~~~~~~~~Ga~~lHvVDLdgA~~g~~~n~~----~I~~i~~~~~~~iqvGGGIRs~e~i~~~l~~G~~rViigT~a~~~  111 (234)
T PRK13587         36 SIAYYSQFECVNRIHIVDLIGAKAQHAREFD----YIKSLRRLTTKDIEVGGGIRTKSQIMDYFAAGINYCIVGTKGIQD  111 (234)
T ss_pred             HHHHHHHHCCCCEEEEEECCCCCCCCCCHHH----HHHHHHHHCCCCEEEECCCCCHHHHHHHHHCCCCEEEECCCCCCC
T ss_conf             9999998389988999978764689743799----999998437986798465475999999997689999988813028


Q ss_pred             HHHHHCCCCCCCHHHHHHHHHHHHHCCCCCCCEEEE--CC-CCCHHHHHHHHHHHHHCCCCCCEEECCCEEECCCCCCCC
Q ss_conf             777320588889899999999999879855770786--68-989999999999997408888602054112048741244
Q gi|254780485|r  170 ERFYPHVTTTHTFEDRLQTLENVRKSGIKVCCGGIL--GL-GEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEE  246 (328)
Q Consensus       170 ~~~~~~~~~~~~~~~~l~~~~~a~~~G~~~~sg~l~--G~-gEt~eeri~~l~~lr~l~~~~~~v~~~~~~p~~gt~l~~  246 (328)
                      |++..++.....  .++       -+++..--+-+.  |- -.+.-+..+++..+.+++..  .+- ..-+-..|| |. 
T Consensus       112 ~~~l~~~~~~f~--~~I-------vv~iD~~~~~v~~~GW~~~s~~~~~d~~~~~~~~g~~--~il-~TdI~rDGt-l~-  177 (234)
T PRK13587        112 TDWLKEMAHTFP--GRI-------YLSVDAYGEDIKVNGWEEDTELNLFSFVRQLSDIPLG--GII-YTDIAKDGK-MS-  177 (234)
T ss_pred             HHHHHHHHHHCC--CCE-------EEEEECCCCEEEECCCCEECCCCHHHHHHHHHHCCCC--EEE-EECCCCCCC-CC-
T ss_conf             699999998666--776-------8712023854544575142586799999999743987--899-840266574-55-


Q ss_pred             CCCCCHHHHHHHHHHHHHHCCCCCCEEEEHHHHHCHHHHHHHHHHCCCEEEECC
Q ss_conf             568798999999999999686872142311565165689999980998899778
Q gi|254780485|r  247 NKKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGD  300 (328)
Q Consensus       247 ~~~~~~~e~lr~iAi~RL~lP~~~i~i~~~~~~~~~~~~~~~L~~GaN~~~~g~  300 (328)
                        .++ .+.++-++  +  .++..+.+++|- +-..+..++ -..|+++.++|-
T Consensus       178 --G~n-~el~~~i~--~--~~~~pvIaSGGv-~sl~Di~~L-~~~gv~GvIvGk  222 (234)
T PRK13587        178 --GPN-FELTGQLV--K--ATTIPVIASGGI-RHQQDIQRL-ASLNVHAAIIGK  222 (234)
T ss_pred             --CCC-HHHHHHHH--H--HCCCCEEEECCC-CCHHHHHHH-HHCCCCEEEEEE
T ss_conf             --799-99999999--7--679999998998-999999999-988998999997


No 253
>PRK13127 consensus
Probab=65.01  E-value=10  Score=17.76  Aligned_cols=187  Identities=14%  Similarity=0.174  Sum_probs=104.2

Q ss_pred             CCHHHHHHHHHHHHHCCCEEEEEECCCCCCC-CC---------------CHHHHHHHHHHHCCC-CC-CEEE---EC--C
Q ss_conf             6857999999999964983899730368887-44---------------289999988762136-88-3241---02--5
Q gi|254780485|r   88 INVDQVLKEAKNAKENGATRYCMGAAWREPK-ER---------------DLSIIVDMIKGVKSL-GL-ETCM---TL--G  144 (328)
Q Consensus        88 ~~~Eei~~~a~~~~~~G~~~~~l~~~~~~~~-~~---------------~~~~~~e~i~~i~~~-~~-~i~~---~~--g  144 (328)
                      -+.|.-++.++.+.+.|+.-+-++-=.-+|. +.               .++.+.++++.++.. .. .+.+   |.  .
T Consensus        22 P~~e~t~~~l~~l~~~GaDiiElGiPfSDP~ADGPvIq~a~~rAL~~G~~~~~~~~~~~~~r~~~~~pivlM~Y~N~i~~  101 (262)
T PRK13127         22 PDPEATLEFVKALVKGGADVIELGIPFSDPVADGPTIQAADVRALSAGMKIDKYFELVKELRVDSSVPLVLMTYYNPVYR  101 (262)
T ss_pred             CCHHHHHHHHHHHHHCCCCEEEECCCCCCCCCCCHHHHHHHHHHHHCCCCHHHHHHHHHHHHCCCCCCEEEEECCHHHHH
T ss_conf             99899999999999769999997898888776579999999999976997999999999974569988799966138876


Q ss_pred             CCCHHHHHHHHCCCCCEEEEECCCCHHHHHCCCCCCCHHHHHHHHHHHHHCCCCCCCEEEECCCCCHHHHHHHHHHHHHC
Q ss_conf             69999999874157606975134377773205888898999999999998798557707866898999999999999740
Q gi|254780485|r  145 MLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANL  224 (328)
Q Consensus       145 ~~~~~~~~~Lk~aG~~~~~~~let~~~~~~~~~~~~~~~~~l~~~~~a~~~G~~~~sg~l~G~gEt~eeri~~l~~lr~l  224 (328)
                      .-.+.-+++.+++|++.+++             |.-.+++.-+..+.+++.|+..-  .++- .-|.++|+..+....  
T Consensus       102 ~G~e~F~~~~~~~GvdGlIi-------------pDLP~eE~~~~~~~~~~~gi~~I--~lva-Ptt~~~Ri~~i~~~a--  163 (262)
T PRK13127        102 YGVEKFVKKAAEAGVSGLII-------------PDLPVEEATDLREACKKHGLDLV--FLVA-PTTPEERLKRIDEAS--  163 (262)
T ss_pred             CCHHHHHHHHHHCCCCEEEE-------------CCCCHHHHHHHHHHHHHCCCEEE--EEEC-CCCCHHHHHHHHHCC--
T ss_conf             08999999998759976996-------------69997899999999985583279--9858-999899999998438--


Q ss_pred             CCCCCEEECCCEEECCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCEEEEHHHHHCHHHHHHHHHHCCCEEEECCEEE
Q ss_conf             8888602054112048741244568798999999999999686872142311565165689999980998899778665
Q gi|254780485|r  225 STPPESIPINLLIPIPGSKFEENKKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLL  303 (328)
Q Consensus       225 ~~~~~~v~~~~~~p~~gt~l~~~~~~~~~e~lr~iAi~RL~lP~~~i~i~~~~~~~~~~~~~~~L~~GaN~~~~g~~~~  303 (328)
                         ..++-   ++...|+.-...  .-+.+....+.-.|=..+   +++..|-.--.++........|||++++|..++
T Consensus       164 ---~gFiY---~vs~~GvTG~~~--~~~~~~~~~i~~ik~~t~---~Pv~vGFGI~~~e~v~~~~~~~aDGvIVGSaiv  231 (262)
T PRK13127        164 ---SGFVY---LVSRLGVTGARE--DVEEATFDLLKRARTTCK---NKIAVGFGISKGEHAEELLDAGADGVIVGSALV  231 (262)
T ss_pred             ---CCEEE---EEECCCCCCCCC--CCHHHHHHHHHHHHHCCC---CCEEEEEEECCHHHHHHHHHCCCCEEEECHHHH
T ss_conf             ---98189---984355568765--552889999999996179---984899334889999999864999999878999


No 254
>COG4739 Uncharacterized protein containing a ferredoxin domain [Function unknown]
Probab=64.46  E-value=4.3  Score=20.27  Aligned_cols=21  Identities=33%  Similarity=0.677  Sum_probs=16.2

Q ss_pred             EEEEEC-CCCCCCCCCCCCCCC
Q ss_conf             864530-786834232124335
Q gi|254780485|r   56 KLLNIK-TGGCPENCGYCNQSV   76 (328)
Q Consensus        56 ~~in~~-TN~C~~~C~fCaf~~   76 (328)
                      ..|.++ |+.|..||.-|+|..
T Consensus        76 vLIG~Kasg~~glnCgaCGfes   97 (182)
T COG4739          76 VLIGVKASGTVGLNCGACGFES   97 (182)
T ss_pred             EEEEECCCCCCCCCCCCCCCHH
T ss_conf             9997535776544655455156


No 255
>TIGR01522 ATPase-IIA2_Ca calcium-transporting P-type ATPase, PMR1-type; InterPro: IPR006413   This family describes the P-type ATPase responsible for translocating calcium ions across the golgi membrane of fungi and animals , , and is of particular importance in the sarcoplasmic reticulum of skeletal and cardiac muscle in vertebrates . The calcium P-type ATPases have been characterised as Type IIA based on a phylogenetic analysis which distinguishes this group from the Type IIB PMCA calcium pump  represented by IPR006408 from INTERPRO. ; GO: 0005388 calcium-transporting ATPase activity, 0006816 calcium ion transport, 0016021 integral to membrane.
Probab=63.91  E-value=11  Score=17.63  Aligned_cols=148  Identities=17%  Similarity=0.290  Sum_probs=82.7

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCHHH---HHHHHHHHHHCCCEEEEEEC------------CCCCCCCCCHHHHHHHHH
Q ss_conf             342321243354777564100068579---99999999964983899730------------368887442899999887
Q gi|254780485|r   66 PENCGYCNQSVHNKSKLKASKLINVDQ---VLKEAKNAKENGATRYCMGA------------AWREPKERDLSIIVDMIK  130 (328)
Q Consensus        66 ~~~C~fCaf~~~~~~~~~~~~~~~~Ee---i~~~a~~~~~~G~~~~~l~~------------~~~~~~~~~~~~~~e~i~  130 (328)
                      ..=-+||++|...++  .+...++.+.   +-+.+-+....|.+-+.+-.            |-++||.-.   .-++|+
T Consensus       437 E~v~~yc~~Y~~~dG--~kt~~Lt~~~k~~~~~~~~~Ma~~GLRv~A~A~~~~~~L~F~GL~G~~DPPRp~---V~~Av~  511 (856)
T TIGR01522       437 EQVLKYCTYYLKKDG--KKTEELTEEQKEKIQEEAAEMASEGLRVIAFASGTEKDLVFLGLVGINDPPRPD---VKEAVE  511 (856)
T ss_pred             HHHHHHHHHHHCCCC--CCHHHHHHHHHHHHHHHHHHHHCCCCEEEEEEECCCCCCEEEEEECCCCCCCCC---CHHHHH
T ss_conf             012334545440578--411577899999998987632006664665652256871576100265922486---268999


Q ss_pred             HHCCCCCCEEEECCCCCHHHHHHHHCCCCCEE----EEECCC-CHHHHHCCCC------CCCHHHHHHHHHHHHHCCCCC
Q ss_conf             62136883241025699999998741576069----751343-7777320588------889899999999999879855
Q gi|254780485|r  131 GVKSLGLETCMTLGMLSFEQAQILSKAGLDYY----NHNIDT-SERFYPHVTT------THTFEDRLQTLENVRKSGIKV  199 (328)
Q Consensus       131 ~i~~~~~~i~~~~g~~~~~~~~~Lk~aG~~~~----~~~let-~~~~~~~~~~------~~~~~~~l~~~~~a~~~G~~~  199 (328)
                      .+-.-+++|.+=.|....-.+.--+..|+...    .-.+++ +..-..++.+      .-|+++.+++++..++.|= +
T Consensus       512 ~L~~gGV~v~MITGDS~~TAv~IA~~lG~~~~~~~~G~~Ld~md~~~L~~~v~~v~vFaRasP~hKmkIv~aLq~~Gd-V  590 (856)
T TIGR01522       512 RLLTGGVRVIMITGDSEETAVSIARRLGMPVKSSKEGEKLDEMDDQQLSEVVDKVAVFARASPEHKMKIVKALQKRGD-V  590 (856)
T ss_pred             HHHHCCCEEEEECCCCHHHHHHHHHHCCCCCCCCCCHHHHHHCCHHHHHHHHCCCEEEEECCCHHHHHHHHHHHHCCC-E
T ss_conf             984289189998187289999998772865799854147763168889865230357630780678999999720898-8


Q ss_pred             CCEEEECCCCCHHHHHHHHHHHHHCC
Q ss_conf             77078668989999999999997408
Q gi|254780485|r  200 CCGGILGLGEMIDDRIDMLLTLANLS  225 (328)
Q Consensus       200 ~sg~l~G~gEt~eeri~~l~~lr~l~  225 (328)
                      -|  |=|=|=...    -.+.|.|++
T Consensus       591 VA--MTGDGVNDA----pALKlADIG  610 (856)
T TIGR01522       591 VA--MTGDGVNDA----PALKLADIG  610 (856)
T ss_pred             EE--ECCCCCCHH----HHHHHHHCC
T ss_conf             98--868795517----774053122


No 256
>pfam00977 His_biosynth Histidine biosynthesis protein. Proteins involved in steps 4 and 6 of the histidine biosynthesis pathway are contained in this family. Histidine is formed by several complex and distinct biochemical reactions catalysed by eight enzymes. The enzymes in this Pfam entry are called His6 and His7 in eukaryotes and HisA and HisF in prokaryotes. The structure of HisA is known to be a TIM barrel fold. In some archaeal HisA proteins the TIM barrel is composed of two tandem repeats of a half barrel. This family belong to the common phosphate binding site TIM barrel family.
Probab=63.56  E-value=11  Score=17.59  Aligned_cols=178  Identities=19%  Similarity=0.196  Sum_probs=91.5

Q ss_pred             HHHHHHHHHHHHCCCEEEEEECCCCC--CCCCCHHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHCCCCCEEEEECCC
Q ss_conf             79999999999649838997303688--8744289999988762136883241025699999998741576069751343
Q gi|254780485|r   91 DQVLKEAKNAKENGATRYCMGAAWRE--PKERDLSIIVDMIKGVKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDT  168 (328)
Q Consensus        91 Eei~~~a~~~~~~G~~~~~l~~~~~~--~~~~~~~~~~e~i~~i~~~~~~i~~~~g~~~~~~~~~Lk~aG~~~~~~~let  168 (328)
                      ...++.|+...+.|+.+++++--..-  ......+.+.++.   ++.++.+.+.-|..+.++.+++-++|++.+.++-++
T Consensus        29 gdP~~~a~~~~~~g~d~i~ivDLda~~~~~~~n~~~i~~i~---~~~~~pi~vgGGIrs~e~~~~~l~~Ga~kvvigs~~  105 (229)
T pfam00977        29 GDPVELAKRYEEEGADELHFVDLDAAKEGRPVNLDLIEEIA---EEVFIPVQVGGGIRSLEDAERLLSAGADKVIIGTAA  105 (229)
T ss_pred             CCHHHHHHHHHHCCCCEEEEEECCCCCCCCHHHHHHHHHHH---HHCCCCEEEECCEEEHHHHHHHHHCCCCEEEECCCH
T ss_conf             99999999999879998999968663026810699999999---866987899645611899999997699899958604


Q ss_pred             --CHHHHHCCCCCCCHHHHHHHHHHHHHCCC-------CC-CCEEEECCC---CCHHHHHHHHHHHHHCCCCCCEEECCC
Q ss_conf             --77773205888898999999999998798-------55-770786689---899999999999974088886020541
Q gi|254780485|r  169 --SERFYPHVTTTHTFEDRLQTLENVRKSGI-------KV-CCGGILGLG---EMIDDRIDMLLTLANLSTPPESIPINL  235 (328)
Q Consensus       169 --~~~~~~~~~~~~~~~~~l~~~~~a~~~G~-------~~-~sg~l~G~g---Et~eeri~~l~~lr~l~~~~~~v~~~~  235 (328)
                        .|++..++               +...|-       .+ .-+.++-++   .+..+..+.+..+.+++.  ..+-+ -
T Consensus       106 ~~~~~~~~~~---------------~~~~g~q~iv~siD~k~~~~v~~~~~~~~~~~~~~~~i~~~~~~g~--~eii~-t  167 (229)
T pfam00977       106 VKNPELIKEA---------------AEKFGSQCIVVAIDAKRDGKVAINGWREETGIDAVEWAKKLEELGA--GEILL-T  167 (229)
T ss_pred             HHCHHHHHHH---------------HHHCCCCCEEEEEEECCCCEEEEECCCCCCCCCHHHHHHHHHHCCC--CEEEE-E
T ss_conf             3093789999---------------9980986479999871451799806433567443344567765167--50688-7


Q ss_pred             EEECCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCEEEEHHHHHCHHHHHHHHHHCCCEEEECC
Q ss_conf             12048741244568798999999999999686872142311565165689999980998899778
Q gi|254780485|r  236 LIPIPGSKFEENKKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGD  300 (328)
Q Consensus       236 ~~p~~gt~l~~~~~~~~~e~lr~iAi~RL~lP~~~i~i~~~~~~~~~~~~~~~L~~GaN~~~~g~  300 (328)
                      -+-..|| +.   .+ ..+.++-++  +.  .+..+.+++|- +-..+..+ ....|++++++|.
T Consensus       168 di~~dGt-~~---G~-d~~l~~~i~--~~--~~~pii~~GGv-~~~~di~~-l~~~g~~gvivg~  221 (229)
T pfam00977       168 DIDRDGT-LS---GP-DLELTRELA--EA--VNIPVIASGGV-GSLEDLKE-LFSEGVDGVIAGS  221 (229)
T ss_pred             EECCCCC-CC---CC-CHHHHHHHH--HH--CCCCEEEECCC-CCHHHHHH-HHHCCCCEEEEHH
T ss_conf             7504275-66---68-999999999--76--89989998589-99999999-9987998999857


No 257
>COG0036 Rpe Pentose-5-phosphate-3-epimerase [Carbohydrate transport and metabolism]
Probab=63.47  E-value=11  Score=17.58  Aligned_cols=194  Identities=16%  Similarity=0.218  Sum_probs=111.4

Q ss_pred             HHHHHHHHHHHHCCCEEEEE-ECCCCCCCCCCH-HHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHCCCCCEEEEECCC
Q ss_conf             79999999999649838997-303688874428-9999988762136883241025699999998741576069751343
Q gi|254780485|r   91 DQVLKEAKNAKENGATRYCM-GAAWREPKERDL-SIIVDMIKGVKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDT  168 (328)
Q Consensus        91 Eei~~~a~~~~~~G~~~~~l-~~~~~~~~~~~~-~~~~e~i~~i~~~~~~i~~~~g~~~~~~~~~Lk~aG~~~~~~~let  168 (328)
                      -..-++++...+.|+.-+++ +..++--+.-.+ -.+++.++...+....+|.-+-. .+..+..+.++|++.+..-.|.
T Consensus        16 ~~l~~el~~~~~agad~iH~DVMDghFVPNiTfGp~~v~~l~~~t~~p~DvHLMV~~-p~~~i~~fa~agad~It~H~E~   94 (220)
T COG0036          16 ARLGEELKALEAAGADLIHIDVMDGHFVPNITFGPPVVKALRKITDLPLDVHLMVEN-PDRYIEAFAKAGADIITFHAEA   94 (220)
T ss_pred             HHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCHHHHHHHHHCCCCCEEEEEECCC-HHHHHHHHHHHCCCEEEEEECC
T ss_conf             679999999997699879996457876787334899999886368973589973289-8999999998199989997127


Q ss_pred             CHHHHHCCCCCCCHHHHHHHHHHHHHCCCCCCCEEEECCCCCHHHHHHHHHHHHHCCCCCCEEECCCEEECCCCCCCCCC
Q ss_conf             77773205888898999999999998798557707866898999999999999740888860205411204874124456
Q gi|254780485|r  169 SERFYPHVTTTHTFEDRLQTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENK  248 (328)
Q Consensus       169 ~~~~~~~~~~~~~~~~~l~~~~~a~~~G~~~~sg~l~G~gEt~eeri~~l~~lr~l~~~~~~v~~~~~~p~~gt~l~~~~  248 (328)
                      .+-             -.+++...++.|.+.+  +.+- -+|+.+-++.++.  +++    .|-++-..  ||  +.+..
T Consensus        95 ~~~-------------~~r~i~~Ik~~G~kaG--v~ln-P~Tp~~~i~~~l~--~vD----~VllMsVn--PG--fgGQ~  148 (220)
T COG0036          95 TEH-------------IHRTIQLIKELGVKAG--LVLN-PATPLEALEPVLD--DVD----LVLLMSVN--PG--FGGQK  148 (220)
T ss_pred             CCC-------------HHHHHHHHHHCCCEEE--EEEC-CCCCHHHHHHHHH--HCC----EEEEEEEC--CC--CCCCC
T ss_conf             768-------------9999999997598577--9978-9997789998986--578----99998577--99--86631


Q ss_pred             CCCHHHHHHHHHHHHHHCCC---CCCEEEEHHHHHCHHHHHHHHHHCCCEEEECCEEECCCCCCHHHHHHHHH
Q ss_conf             87989999999999996868---72142311565165689999980998899778665158889899999999
Q gi|254780485|r  249 KVDPIEHVRIISVARILMPK---SRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTILFN  318 (328)
Q Consensus       249 ~~~~~e~lr~iAi~RL~lP~---~~i~i~~~~~~~~~~~~~~~L~~GaN~~~~g~~~~t~~g~~~~~~~~~i~  318 (328)
                      -  -.+.+.-+.-.|=+.+.   ..|-+-+|   +..+....+..+|||-+.+|.++-..+.  ..+-++-++
T Consensus       149 F--i~~~l~Ki~~lr~~~~~~~~~~IeVDGG---I~~~t~~~~~~AGad~~VaGSalF~~~d--~~~~i~~~~  214 (220)
T COG0036         149 F--IPEVLEKIRELRAMIDERLDILIEVDGG---INLETIKQLAAAGADVFVAGSALFGADD--YKATIRELR  214 (220)
T ss_pred             C--CHHHHHHHHHHHHHHCCCCCEEEEEECC---CCHHHHHHHHHCCCCEEEEEEEEECCCC--HHHHHHHHH
T ss_conf             4--7999999999999740247759999689---6988899999739999999777867811--999999999


No 258
>TIGR01678 FAD_lactone_ox sugar 1,4-lactone oxidases; InterPro: IPR010031   This entry identifies a family of at least two different sugar 1,4 lactone oxidases, both involved in synthesising ascorbic acid or a derivative. These include L-gulonolactone oxidase (1.1.3.8 from EC) from rat and D-arabinono-1,4-lactone oxidase (1.1.3.37 from EC) from Saccharomyces cerevisiae. Members are proposed to have the cofactor FAD covalently bound at a site specified by IPR006093 from INTERPRO.; GO: 0016899 oxidoreductase activity acting on the CH-OH group of donors oxygen as acceptor, 0009058 biosynthetic process.
Probab=61.85  E-value=12  Score=17.39  Aligned_cols=135  Identities=17%  Similarity=0.156  Sum_probs=76.6

Q ss_pred             CCCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCCC--CHHHHHHHHHHHC------C---CCCCEEEECCCCCHHHHHH
Q ss_conf             000685799999999996498389973036888744--2899999887621------3---6883241025699999998
Q gi|254780485|r   85 SKLINVDQVLKEAKNAKENGATRYCMGAAWREPKER--DLSIIVDMIKGVK------S---LGLETCMTLGMLSFEQAQI  153 (328)
Q Consensus        85 ~~~~~~Eei~~~a~~~~~~G~~~~~l~~~~~~~~~~--~~~~~~e~i~~i~------~---~~~~i~~~~g~~~~~~~~~  153 (328)
                      |--.|.||++|....|..++ +.+..|++||.|.+-  .-+|++.+=|.-|      +   ....|.+.+|.+-.+.-..
T Consensus        19 ~qP~s~eevrE~l~~Ar~~~-Kk~~vVG~GHSPSdi~cTdg~l~~ldkmnkV~~fd~~Pelh~~~iTV~AGirlyql~e~   97 (505)
T TIGR01678        19 YQPKSVEEVREVLADAREAE-KKVKVVGAGHSPSDIVCTDGFLVSLDKMNKVLKFDKEPELHKKDITVEAGIRLYQLQEI   97 (505)
T ss_pred             CCCCCHHHHHHHHHHHHHCC-CEEEEECCCCCCCCCEECCCHHEECCCCCCEEEECCCCCCCCCCEEHHHHHHHHHHHHH
T ss_conf             48972999999999987469-83899757778232154260210012245101552786632201116552568664589


Q ss_pred             HHCCCCCEEEEEC--C----------CC-HHHHHCCCC----------------CCCHHHHHHHHHHHH----HCCCCCC
Q ss_conf             7415760697513--4----------37-777320588----------------889899999999999----8798557
Q gi|254780485|r  154 LSKAGLDYYNHNI--D----------TS-ERFYPHVTT----------------THTFEDRLQTLENVR----KSGIKVC  200 (328)
Q Consensus       154 Lk~aG~~~~~~~l--e----------t~-~~~~~~~~~----------------~~~~~~~l~~~~~a~----~~G~~~~  200 (328)
                      |.+.|...-+++-  |          |+ -.+++.+.+                ..+-+.--++.++|+    .+|+=++
T Consensus        98 L~~~Gys~~~lGsiSe~sVaGiistgtHgss~~Hg~l~~q~v~lti~~adGe~~~cs~e~~~dvF~AA~vslG~lGiIv~  177 (505)
T TIGR01678        98 LDEKGYSLSNLGSISEVSVAGIISTGTHGSSLKHGVLASQVVALTIMLADGEVLECSEERDKDVFKAARVSLGALGIIVD  177 (505)
T ss_pred             HHHCCCCEECCCCCCCCEECCEEECCCCCCCCCCCHHHHEEEEEEEEECCCCEEEECCCCCHHHHHHHHHCCCCEEEEEE
T ss_conf             75248710002210043121155037468765333244033334567047757860220485688898641562478999


Q ss_pred             CEEEE----CCCC-----CHHHHHHHHHH
Q ss_conf             70786----6898-----99999999999
Q gi|254780485|r  201 CGGIL----GLGE-----MIDDRIDMLLT  220 (328)
Q Consensus       201 sg~l~----G~gE-----t~eeri~~l~~  220 (328)
                      .|+=+    -+.+     |.+|.++.+..
T Consensus       178 ~Ti~vVP~F~l~~T~~v~T~~~ll~~wd~  206 (505)
T TIGR01678       178 VTIRVVPAFDLKETEEVSTLKELLKDWDS  206 (505)
T ss_pred             EEEEEECCCCCCCCCCCCCHHHHHHHHCC
T ss_conf             98887336555257764108999876200


No 259
>pfam04481 DUF561 Protein of unknown function (DUF561). Protein of unknown function found in a cyanobacterium, and the chloroplasts of algae.
Probab=61.21  E-value=12  Score=17.31  Aligned_cols=205  Identities=19%  Similarity=0.168  Sum_probs=119.3

Q ss_pred             CCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCCCCHHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHCCCCCEEEEEC
Q ss_conf             06857999999999964983899730368887442899999887621368832410256999999987415760697513
Q gi|254780485|r   87 LINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNI  166 (328)
Q Consensus        87 ~~~~Eei~~~a~~~~~~G~~~~~l~~~~~~~~~~~~~~~~e~i~~i~~~~~~i~~~~g~~~~~~~~~Lk~aG~~~~~~~l  166 (328)
                      -++.+.+...++.+...|++.+-+-.   ++      .+.+.++.  ...+.+|+|.  .+.+.+-.--+||++.+.++ 
T Consensus        23 NFd~~~V~~i~~AA~~ggAt~vDIA~---dp------~LV~~v~~--~~~lPiCVSa--Vep~~f~~aV~AGA~lvEIG-   88 (243)
T pfam04481        23 NFNYEQVLKIARASQIAKATYVDIAA---DP------QLVKVVKS--VSNIPICVSA--VEPELLYEAVLAGADLVEIG-   88 (243)
T ss_pred             CCCHHHHHHHHHHHHCCCCCEEEECC---CH------HHHHHHHH--HCCCCEEEEC--CCHHHHHHHHHHCCCEEEEC-
T ss_conf             26989999999998715997687417---99------99999997--2899858604--79788899998278789864-


Q ss_pred             CCCHHHHHCCCCCCCHHHHHHHHHHHHHCCCCCCCEEEECCCCCHHHHHHHHHHHHHCCC---CCCE-EECCCEEECCCC
Q ss_conf             437777320588889899999999999879855770786689899999999999974088---8860-205411204874
Q gi|254780485|r  167 DTSERFYPHVTTTHTFEDRLQTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLST---PPES-IPINLLIPIPGS  242 (328)
Q Consensus       167 et~~~~~~~~~~~~~~~~~l~~~~~a~~~G~~~~sg~l~G~gEt~eeri~~l~~lr~l~~---~~~~-v~~~~~~p~~gt  242 (328)
                       -...+|++.+ .-+.++-|+.-+..+++=-.+.-..-+=|.=..++-++....|.+++.   +|++ ..-.++  .+|+
T Consensus        89 -NfDsFY~qGr-~f~a~eVL~Lt~~Tr~LLP~~~LsVTVPHiL~ld~Qv~LA~~L~~~GaDiIQTEGgtss~p~--~~g~  164 (243)
T pfam04481        89 -NFDSFYKQGR-VLSVCEIIALVKETRKLLPHTPLCVTIPHILKLKEQINLAKQLESLGIDLIQTEGKITSISK--NHCV  164 (243)
T ss_pred             -CHHHHHHCCC-EECHHHHHHHHHHHHHHCCCCCEEEECCCCCCHHHHHHHHHHHHHHCCCEEECCCCCCCCCC--CCCH
T ss_conf             -5364765476-64499999999999976899844774576356789999999999818877872898777888--8425


Q ss_pred             CCCCCCCCCHHHHHHHHHHHHHHCCCCCCE-EEEHHHHHCHHHHHHHHHHCCCEEEECCEEECCCCCCHHHHHHHHHH
Q ss_conf             124456879899999999999968687214-23115651656899999809988997786651588898999999998
Q gi|254780485|r  243 KFEENKKVDPIEHVRIISVARILMPKSRLR-LAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTILFNR  319 (328)
Q Consensus       243 ~l~~~~~~~~~e~lr~iAi~RL~lP~~~i~-i~~~~~~~~~~~~~~~L~~GaN~~~~g~~~~t~~g~~~~~~~~~i~~  319 (328)
                       +.......+ ...-+.+++|-.    .++ +.+|  .+..-...+++.+||.++-+|..+-.  =.+...|+..+++
T Consensus       165 -~glIekaap-TLAaay~IS~~v----~vPVlcAS--GlS~vT~PmAiaaGAsGVGVGSavn~--Lnd~~aMva~vr~  232 (243)
T pfam04481       165 -NDLIEKSAS-TLASTYEISKHV----QLPVICAS--GLSDVTVPLAFSYGASGIGIGSAVSK--LNDIEKMVNYISE  232 (243)
T ss_pred             -HHHHHHHHH-HHHHHHHHHHCC----CCCEEECC--CCCHHHHHHHHHCCCCCCCHHHHHHH--CCCHHHHHHHHHH
T ss_conf             -777988758-899999998617----87667546--76421478899748771006577650--0249999999999


No 260
>TIGR01367 pyrE_Therm orotate phosphoribosyltransferase; InterPro: IPR006273   This group of sequences are a distinct clade of orotate phosphoribosyltransferases. Members include the experimentally determined example from Thermus aquaticus and additional examples from Caulobacter crescentus, Helicobacter pylori (Campylobacter pylori), Mesorhizobium loti, and related species. ; GO: 0004588 orotate phosphoribosyltransferase activity, 0019856 pyrimidine base biosynthetic process.
Probab=60.97  E-value=8.8  Score=18.19  Aligned_cols=96  Identities=17%  Similarity=0.206  Sum_probs=46.2

Q ss_pred             EEEEEECCCCCCCC----------CCHHHHHHHHH-HHCCC--CCCEEEEC---C-CCCHHHHHHHHCCCCCEEEEECCC
Q ss_conf             38997303688874----------42899999887-62136--88324102---5-699999998741576069751343
Q gi|254780485|r  106 TRYCMGAAWREPKE----------RDLSIIVDMIK-GVKSL--GLETCMTL---G-MLSFEQAQILSKAGLDYYNHNIDT  168 (328)
Q Consensus       106 ~~~~l~~~~~~~~~----------~~~~~~~e~i~-~i~~~--~~~i~~~~---g-~~~~~~~~~Lk~aG~~~~~~~let  168 (328)
                      -||.|.+|-+.+..          +..+.+++.+. .|.+.  .+...+++   | .+..+.++.|++.-.|.=.++.|-
T Consensus        15 GhFlLsSG~hS~~flQ~~~ll~~P~~~~~lg~~LA~~i~~~~~~~d~ivsPA~GGv~~~Ye~AR~L~etlPd~R~iF~Er   94 (205)
T TIGR01367        15 GHFLLSSGKHSPYFLQSAKLLEDPELAEKLGEELAKKILKYKLEVDVIVSPAMGGVILGYEVARALSETLPDVRSIFAER   94 (205)
T ss_pred             CCEEEECCCCCCHHHHHHHHHHCHHHHHHHHHHHHHHHHHHCCCCCEEECCCCCHHHHHHHHHHHHHHCCCCCCEEEEEE
T ss_conf             71224057614236656567616368999999999999982787015864730004688899987410068885267776


Q ss_pred             -------CHHHHHC------------CCCCCCHHHHHHHHHHHHHCCCCC-CCEEE
Q ss_conf             -------7777320------------588889899999999999879855-77078
Q gi|254780485|r  169 -------SERFYPH------------VTTTHTFEDRLQTLENVRKSGIKV-CCGGI  204 (328)
Q Consensus       169 -------~~~~~~~------------~~~~~~~~~~l~~~~~a~~~G~~~-~sg~l  204 (328)
                             -++-|.-            +-|+.|.   +++++..++.|-.+ +.+-|
T Consensus        95 ~gsg~mkLRrgF~v~pGek~v~vEDvvTTGGS~---~e~~~~i~~~GG~vvg~a~i  147 (205)
T TIGR01367        95 EGSGGMKLRRGFEVKPGEKVVVVEDVVTTGGSL---LEAIKAIEELGGQVVGLACI  147 (205)
T ss_pred             ECCCCCEECCCEEECCCCEEEEEEEEECCCHHH---HHHHHHHHHCCCCEEEEEEH
T ss_conf             078752011120336997799996211047448---99999998579827984211


No 261
>PRK07535 methyltetrahydrofolate:corrinoid/iron-sulfur protein methyltransferase; Validated
Probab=60.66  E-value=12  Score=17.25  Aligned_cols=188  Identities=19%  Similarity=0.232  Sum_probs=103.5

Q ss_pred             CCCHHHHHHHHHHHHHCCCEEEEEECCCCC-CCCCCHHHHHHHHHHHCCCCCCEEEECCCCCHHHHH-HHHCCCC-CEEE
Q ss_conf             068579999999999649838997303688-874428999998876213688324102569999999-8741576-0697
Q gi|254780485|r   87 LINVDQVLKEAKNAKENGATRYCMGAAWRE-PKERDLSIIVDMIKGVKSLGLETCMTLGMLSFEQAQ-ILSKAGL-DYYN  163 (328)
Q Consensus        87 ~~~~Eei~~~a~~~~~~G~~~~~l~~~~~~-~~~~~~~~~~e~i~~i~~~~~~i~~~~g~~~~~~~~-~Lk~aG~-~~~~  163 (328)
                      --+.+.+.+.|+.-.+.|+.-+-+-.|... +....+.++++.+...-  ...+++  ...+.+.++ .|+...- ..++
T Consensus        21 ~~d~~~i~~~A~~Q~eaGA~~LDVN~g~~~~de~~~m~~~v~~iq~~~--~~Pl~i--DS~~~~aiEaaLk~~~Gr~iIN   96 (268)
T PRK07535         21 EKDAAFIQKLALRQVEAGANYLDVNAGTAVEEEPETMEWLVETVQEVV--DVPLCI--DSPNPEAIEAGLKVAKGRPLIN   96 (268)
T ss_pred             CCCHHHHHHHHHHHHHCCCCEEEEECCCCCCCHHHHHHHHHHHHHHCC--CCCEEE--CCCCHHHHHHHHHHCCCCCEEE
T ss_conf             679899999999999849998996089877468999999999997338--999676--1898999999999779997266


Q ss_pred             -EECCCCHHHHHCCCCCCCHHHHHH-HHHHHHHCCCCCCCEEE--ECCCCCHHHHHHHHHHHHHC----CCCCCEEECCC
Q ss_conf             -513437777320588889899999-99999987985577078--66898999999999999740----88886020541
Q gi|254780485|r  164 -HNIDTSERFYPHVTTTHTFEDRLQ-TLENVRKSGIKVCCGGI--LGLGEMIDDRIDMLLTLANL----STPPESIPINL  235 (328)
Q Consensus       164 -~~let~~~~~~~~~~~~~~~~~l~-~~~~a~~~G~~~~sg~l--~G~gEt~eeri~~l~~lr~l----~~~~~~v~~~~  235 (328)
                       +++|               +++++ ++..|++.|-.+-+-.+  =|+-+|.++|++...++-+.    +..++-+.+=+
T Consensus        97 Sis~e---------------~er~~~i~pLakkyga~vI~L~~de~Gip~tae~R~~ia~~i~~~a~~~Gi~~edi~~Dp  161 (268)
T PRK07535         97 SVSAE---------------EERLEAVLPLVKKYNAPVVALTMDDTGIPKDAEVRLAVAKKLVEKAADFGIPPDDIYIDP  161 (268)
T ss_pred             EECCC---------------HHHHHHHHHHHHHHCCEEEEEECCCCCCCCCHHHHHHHHHHHHHHHHHCCCCHHHEEEEC
T ss_conf             00388---------------056999999999849979999428999999999999999999999998599889988845


Q ss_pred             EEECCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCEEEEH--------HHHHCHHHHHHHHHHCCCEEEE
Q ss_conf             12048741244568798999999999999686872142311--------5651656899999809988997
Q gi|254780485|r  236 LIPIPGSKFEENKKVDPIEHVRIISVARILMPKSRLRLAAG--------RAMMSDELQALCFFSGANSIFV  298 (328)
Q Consensus       236 ~~p~~gt~l~~~~~~~~~e~lr~iAi~RL~lP~~~i~i~~~--------~~~~~~~~~~~~L~~GaN~~~~  298 (328)
                      ++..-+|     .+-...+.|.++...|-.+|.+.+...-|        |..+..-+-.+++.+|-|+-++
T Consensus       162 Lv~~i~t-----~~~~~~~~leair~ik~~~P~v~t~~GlSNiSFGlP~R~~lNs~FL~~a~~~GLd~aI~  227 (268)
T PRK07535        162 LVLPLSA-----AQTAGVEVLETIRRIKELYPKVHTTCGLSNISFGLPNRKLINRAFLVMAMGAGMDSAIL  227 (268)
T ss_pred             CCCEEEC-----CCHHHHHHHHHHHHHHHHCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHHHCCCCEEEC
T ss_conf             5121006-----80789999999999998787777524540011475338999999999999869984645


No 262
>PRK07328 histidinol-phosphatase; Provisional
Probab=60.00  E-value=13  Score=17.17  Aligned_cols=198  Identities=12%  Similarity=0.082  Sum_probs=87.8

Q ss_pred             HHHHHHHHHCCCEEEEEECCCCCC---C----------CCCHHHHHHHHHHHCCCC--CCE--EEECCCC--CHHHHHH-
Q ss_conf             999999996498389973036888---7----------442899999887621368--832--4102569--9999998-
Q gi|254780485|r   94 LKEAKNAKENGATRYCMGAAWREP---K----------ERDLSIIVDMIKGVKSLG--LET--CMTLGML--SFEQAQI-  153 (328)
Q Consensus        94 ~~~a~~~~~~G~~~~~l~~~~~~~---~----------~~~~~~~~e~i~~i~~~~--~~i--~~~~g~~--~~~~~~~-  153 (328)
                      .+.++.+.++|+..+++.-...-.   +          ..+++.|.+.++.+++..  +.|  .+.++..  .++.+.. 
T Consensus        20 ee~v~~Ai~~Gl~~i~~TdH~p~~~~~~~~~~~~~~~~~~~~~~Y~~~i~~l~~~y~~i~I~~GiE~d~~~~~~~~~~~~   99 (268)
T PRK07328         20 EEYVEEARAKGLAEIGFTDHLPMYWLPPEWYDPPWAMRLEELPAYVSEVLRVRERFPDLPVRLGLEADFHPGTEEFLARL   99 (268)
T ss_pred             HHHHHHHHHCCCCEEEECCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCEEECCCCCCCCCHHHHHHHH
T ss_conf             99999999879998997279997778744458543456888999999999999872599367555346675539999999


Q ss_pred             HHCCCCCEEEEE---CCC----CHHHHHCCC---CCCCHHHHHHHHHHHHHCCCCCCCEEEECCCCCHHHHHHHHHHHHH
Q ss_conf             741576069751---343----777732058---8889899999999999879855770786689899999999999974
Q gi|254780485|r  154 LSKAGLDYYNHN---IDT----SERFYPHVT---TTHTFEDRLQTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLAN  223 (328)
Q Consensus       154 Lk~aG~~~~~~~---let----~~~~~~~~~---~~~~~~~~l~~~~~a~~~G~~~~sg~l~G~gEt~eeri~~l~~lr~  223 (328)
                      +++.+.|.+...   ++.    .+.......   ...-+++.++.+..+.+.|..-    ++||-          ..++.
T Consensus       100 l~~~~~D~vigSvH~i~~~~~~~~~~~~~~~~~~~~~~~~~Y~~~~~~~~~~~~fd----vlgH~----------Dli~~  165 (268)
T PRK07328        100 LRRYPFDYVIGSVHYLGAWGFDNPDLVAEYARRDLDELYRRYFALVEQAARSGLFD----AIGHL----------DLPKK  165 (268)
T ss_pred             HHHCCCCEEEEEEEECCCCCCCCHHHHHHHHCCCHHHHHHHHHHHHHHHHHCCCCC----EECCC----------CHHHH
T ss_conf             97489974888775148877778778888730589999999999999998658988----82553----------47866


Q ss_pred             CCCCCCEEECCCEEECCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCEEEEHHHH-----HCHHHHHHHHHHCCCEEEE
Q ss_conf             08888602054112048741244568798999999999999686872142311565-----1656899999809988997
Q gi|254780485|r  224 LSTPPESIPINLLIPIPGSKFEENKKVDPIEHVRIISVARILMPKSRLRLAAGRAM-----MSDELQALCFFSGANSIFV  298 (328)
Q Consensus       224 l~~~~~~v~~~~~~p~~gt~l~~~~~~~~~e~lr~iAi~RL~lP~~~i~i~~~~~~-----~~~~~~~~~L~~GaN~~~~  298 (328)
                      .+.            .+....   . .-.++.++.++-....+   .||-++.|-.     -.+++-+++...|+-- .+
T Consensus       166 ~~~------------~~~~~~---~-~~~~~il~~~~~~g~~l---EiNt~glr~~~~e~yP~~~il~~~~~~G~~i-t~  225 (268)
T PRK07328        166 FGH------------RPTGDL---T-ELYEPALDVIARAGLCL---DVNTAGLRKPAAEVYPAPALLRAARERGIPV-VL  225 (268)
T ss_pred             CCC------------CCCHHH---H-HHHHHHHHHHHHCCCEE---EEECCCCCCCCCCCCCHHHHHHHHHHCCCEE-EE
T ss_conf             489------------985246---6-99999999999729779---9877867788888886299999999879979-99


Q ss_pred             CC-EE-ECCCCCCHHHHHHHHHHCCCCCC
Q ss_conf             78-66-51588898999999998298532
Q gi|254780485|r  299 GD-TL-LTAKNPSYNKDTILFNRLGLIPD  325 (328)
Q Consensus       299 g~-~~-~t~~g~~~~~~~~~i~~~G~~P~  325 (328)
                      |. -- ...=|...++..++++++||+..
T Consensus       226 gSDAH~~~~vg~~f~~a~~~lk~~Gf~~~  254 (268)
T PRK07328        226 GSDAHRPEEVGFGFAEAVALLKEAGYREV  254 (268)
T ss_pred             ECCCCCHHHHHHHHHHHHHHHHHCCCCEE
T ss_conf             05989888988689999999998699889


No 263
>PTZ00124 adenosine deaminase; Provisional
Probab=59.76  E-value=13  Score=17.15  Aligned_cols=95  Identities=14%  Similarity=0.155  Sum_probs=46.8

Q ss_pred             HHHHHHHHHHCCCCCCCEE-EECCCCCHHHHHHHHHHHHHCCCCCCEEECCCEEECCCCCCCCCCCCCHHHHHHHHHHHH
Q ss_conf             9999999998798557707-866898999999999999740888860205411204874124456879899999999999
Q gi|254780485|r  185 RLQTLENVRKSGIKVCCGG-ILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEHVRIISVAR  263 (328)
Q Consensus       185 ~l~~~~~a~~~G~~~~sg~-l~G~gEt~eeri~~l~~lr~l~~~~~~v~~~~~~p~~gt~l~~~~~~~~~e~lr~iAi~R  263 (328)
                      -.++.+.|++.|+++|.+. =.|-.+..+++.+.+..+.- +...|++.+                ....+.++.++--+
T Consensus       208 f~~af~~Ar~~Gl~~T~HAGE~~~p~~i~~v~~ai~~l~a-~RIGHGv~~----------------~~Dp~L~~~l~e~~  270 (362)
T PTZ00124        208 FKDIFDRLREAGVNLSVHAGEDVTPPNLNELYAAILDLGV-KRIGHGIRV----------------AESQELIDRVKEKD  270 (362)
T ss_pred             HHHHHHHHHHCCCCEEEECCCCCCCCCHHHHHHHHHHHCC-CCCCCCEEC----------------CCCHHHHHHHHHCC
T ss_conf             8999999998699543556755785459999999998097-043575340----------------77989999998659


Q ss_pred             HH---CCCCCCEEEEHHHHHCHHHHHHHHHHCCCEEE
Q ss_conf             96---86872142311565165689999980998899
Q gi|254780485|r  264 IL---MPKSRLRLAAGRAMMSDELQALCFFSGANSIF  297 (328)
Q Consensus       264 L~---lP~~~i~i~~~~~~~~~~~~~~~L~~GaN~~~  297 (328)
                      |.   +|..++...+ ..++...=-...+.+|++.++
T Consensus       271 I~LEvCPtSNv~t~~-v~~~~~HPi~~l~~~G~~vti  306 (362)
T PTZ00124        271 ILLEVCPISNVLLNN-SKSMDTHPIRKLYDAGVKVSV  306 (362)
T ss_pred             CEEEECCCCCCCCCC-CCCCCCCHHHHHHHCCCEEEE
T ss_conf             548986765533456-698321719999978996999


No 264
>cd02071 MM_CoA_mut_B12_BD methylmalonyl CoA mutase B12 binding domain. This domain binds to B12 (adenosylcobamide), which initiates the conversion of succinyl CoA and methylmalonyl CoA by forming an adenosyl radical, which then undergoes a rearrangement exchanging a hydrogen atom with a group attached to a neighboring carbon atom. This family is present in both mammals and bacteria. Bacterial members are heterodimers and involved in the fermentation of pyruvate to propionate. Mammalian members are homodimers and responsible for the conversion of odd-chain fatty acids and branched-chain amino acids via propionyl CoA to succinyl CoA for further degradation.
Probab=59.71  E-value=13  Score=17.14  Aligned_cols=67  Identities=12%  Similarity=0.240  Sum_probs=30.3

Q ss_pred             CCHHHHHHHHHHHHHCCCEEEEEECCCCCCCCCCHHHHHHHHHHHCCCCC---CEEEECCCCCHHHHHHHHCCCCCEE
Q ss_conf             68579999999999649838997303688874428999998876213688---3241025699999998741576069
Q gi|254780485|r   88 INVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLGL---ETCMTLGMLSFEQAQILSKAGLDYY  162 (328)
Q Consensus        88 ~~~Eei~~~a~~~~~~G~~~~~l~~~~~~~~~~~~~~~~e~i~~i~~~~~---~i~~~~g~~~~~~~~~Lk~aG~~~~  162 (328)
                      .++|++.+.|.+   .+..-+.+. +....   ..+.+-+++..+++.+.   .+. --|....+.+..|+++|++.+
T Consensus        37 ~s~eeiv~~A~~---e~ad~IglS-sL~g~---h~~~~~~l~~~L~e~G~~di~v~-vGG~Ip~~d~~~l~~~Gv~~v  106 (122)
T cd02071          37 QTPEEIVEAAIQ---EDVDVIGLS-SLSGG---HMTLFPEVIELLRELGAGDILVV-GGGIIPPEDYELLKEMGVAEI  106 (122)
T ss_pred             CCHHHHHHHHHH---CCCCEEEEE-CCCCC---HHHHHHHHHHHHHHCCCCCCEEE-EECCCCHHHHHHHHHCCCCEE
T ss_conf             899999999997---399899996-46554---47899999999997699984699-945649899999997799889


No 265
>PRK11059 regulatory protein CsrD; Provisional
Probab=59.43  E-value=13  Score=17.11  Aligned_cols=12  Identities=25%  Similarity=0.160  Sum_probs=5.2

Q ss_pred             HHHHHHHHHHCC
Q ss_conf             999999997408
Q gi|254780485|r  214 RIDMLLTLANLS  225 (328)
Q Consensus       214 ri~~l~~lr~l~  225 (328)
                      ....+..|++++
T Consensus       537 ~~~~l~~L~~lG  548 (642)
T PRK11059        537 LRPVLRMLRGLG  548 (642)
T ss_pred             HHHHHHHHHHCC
T ss_conf             999999999769


No 266
>cd01311 PDC_hydrolase 2-pyrone-4,6-dicarboxylic acid (PDC) hydrolase hydrolyzes PDC to yield 4-oxalomesaconic acid (OMA) or its tautomer, 4-carboxy-2-hydroxymuconic acid (CHM). This reaction is part of the protocatechuate (PCA) 4,5-cleavage pathway. PCA is one of the most important intermediate metabolites in the bacterial pathways for various phenolic compounds, including lignin, which is the most abundant aromatic material in nature.
Probab=59.38  E-value=13  Score=17.11  Aligned_cols=185  Identities=11%  Similarity=0.021  Sum_probs=100.7

Q ss_pred             CHHHHHHHHHHHHHCCCEEEEEECCCCCCCCCCHHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHCCCCCEEEEECCC
Q ss_conf             85799999999996498389973036888744289999988762136883241025699999998741576069751343
Q gi|254780485|r   89 NVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDT  168 (328)
Q Consensus        89 ~~Eei~~~a~~~~~~G~~~~~l~~~~~~~~~~~~~~~~e~i~~i~~~~~~i~~~~g~~~~~~~~~Lk~aG~~~~~~~let  168 (328)
                      +.++.   .......|+.+.++|..-  ....+-.++++.++......--+.+-....+.++++.|..+|+..+-+++-.
T Consensus        29 ~~~dl---~~~~~~~Gi~r~VlVQ~s--~~g~Dn~~ll~al~~~~~~~~~v~v~~~~~~d~~l~~l~~~GvrGvR~n~~~  103 (263)
T cd01311          29 GIDDL---RALRSTLGIDRVVIVQAS--IYGADNSNLLDALASNGKARGGATVDPRTTTDAELKEMHDAGVRGVRFNFLF  103 (263)
T ss_pred             CHHHH---HHHHHHHCCCEEEEECCC--CCCCCHHHHHHHHHHCCCCEEEEEEECCCCCHHHHHHHHHCCCCCEEEECCC
T ss_conf             99999---999998099659997888--7745389999999856994799998079899799999876589713772567


Q ss_pred             CHHHHHCCCCCCCHHHHHHHHHHHHHCCCCCCCEEEECCCCCHHHHHHHHHHHHHCCCCCCEEECCCEEECCCCCCCCCC
Q ss_conf             77773205888898999999999998798557707866898999999999999740888860205411204874124456
Q gi|254780485|r  169 SERFYPHVTTTHTFEDRLQTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENK  248 (328)
Q Consensus       169 ~~~~~~~~~~~~~~~~~l~~~~~a~~~G~~~~sg~l~G~gEt~eeri~~l~~lr~l~~~~~~v~~~~~~p~~gt~l~~~~  248 (328)
                              ....+.++-....++++++|+.+...+      ...+..+++..++.+..       ...+-+-|-|-....
T Consensus       104 --------~~~~~~~~~~~~~~ri~~~gw~~~l~~------~~~~l~~~~~~l~~~p~-------~vViDH~g~p~~~~g  162 (263)
T cd01311         104 --------GGVDNKDELDEIAKRAAELGWHVQVYF------DAVDLPALLPFLQKLPV-------AVVIDHFGRPDVTKG  162 (263)
T ss_pred             --------CCCCCHHHHHHHHHHHHHCCCCEEEEC------CCCCHHHHHHHHHHCCC-------CEEEECCCCCCCCCC
T ss_conf             --------777898999999999987498645203------71106999999997899-------899856778898878


Q ss_pred             CCCHHHHHHHHHHHHHHCCCCCCEEEEHHHHHC---------HHHHHHHHHHCCCEEEECCEEE
Q ss_conf             879899999999999968687214231156516---------5689999980998899778665
Q gi|254780485|r  249 KVDPIEHVRIISVARILMPKSRLRLAAGRAMMS---------DELQALCFFSGANSIFVGDTLL  303 (328)
Q Consensus       249 ~~~~~e~lr~iAi~RL~lP~~~i~i~~~~~~~~---------~~~~~~~L~~GaN~~~~g~~~~  303 (328)
                      ..+ ..+-.+++++|  .|++.+++|+ ..+..         ....+..+.+|.+-+|-|.-.-
T Consensus       163 ~~~-~~~~~l~~L~~--~~~v~vKlSg-~~r~s~~~~~~~d~~p~~~~l~~~gp~RlmWGSDWP  222 (263)
T cd01311         163 VDG-AEFAALLKLIE--EGNVWVKVSG-PYRLSVKQEAYADVIAFARQIVAAAPDRLVWGTDWP  222 (263)
T ss_pred             CCC-HHHHHHHHHHH--CCCEEEEECC-CEEECCCCCCHHHHHHHHHHHHHHCCCCEEEECCCC
T ss_conf             779-88999999996--6986999645-455158898866899999999986999489979999


No 267
>pfam00113 Enolase_C Enolase, C-terminal TIM barrel domain.
Probab=59.24  E-value=13  Score=17.09  Aligned_cols=34  Identities=24%  Similarity=0.360  Sum_probs=18.5

Q ss_pred             CHHHHHHHHHHHHHCCCCCCCEEEECC--CCCHHHHHHHH
Q ss_conf             989999999999987985577078668--98999999999
Q gi|254780485|r  181 TFEDRLQTLENVRKSGIKVCCGGILGL--GEMIDDRIDML  218 (328)
Q Consensus       181 ~~~~~l~~~~~a~~~G~~~~sg~l~G~--gEt~eeri~~l  218 (328)
                      +..+-+++++.|++.|+.+    +++|  |||....+.||
T Consensus       213 Tlset~e~~~~ak~~g~~~----ivShRSGETeD~~iaDL  248 (296)
T pfam00113       213 SVTESLAAVKMAKDAGWGV----MVSHRSGETEDTFIADL  248 (296)
T ss_pred             HHHHHHHHHHHHHHCCCEE----EEECCCCCCCCCHHHHH
T ss_conf             1999999999999869649----98669887765229998


No 268
>PRK11359 cAMP phosphodiesterase; Provisional
Probab=58.74  E-value=13  Score=17.03  Aligned_cols=13  Identities=15%  Similarity=0.227  Sum_probs=6.5

Q ss_pred             HHHHHHHHHCCCC
Q ss_conf             9999999982985
Q gi|254780485|r  311 NKDTILFNRLGLI  323 (328)
Q Consensus       311 ~~~~~~i~~~G~~  323 (328)
                      .+.++-++++|+.
T Consensus       681 ~~~l~~lr~~G~~  693 (799)
T PRK11359        681 FKRIQILRDMGVG  693 (799)
T ss_pred             HHHHHHHHHCCCE
T ss_conf             9999999978998


No 269
>cd00945 Aldolase_Class_I Class I aldolases. The class I aldolases use an active-site lysine which stablilzes a reaction intermediates via Schiff base formation, and have TIM beta/alpha barrel fold. The members of this family include 2-keto-3-deoxy-6-phosphogluconate (KDPG) and 2-keto-4-hydroxyglutarate (KHG) aldolases, transaldolase, dihydrodipicolinate synthase sub-family, Type I 3-dehydroquinate dehydratase, DeoC and DhnA proteins, and metal-independent fructose-1,6-bisphosphate aldolase. Although structurally similar, the class II aldolases use a different mechanism and are believed to have an independent evolutionary origin.
Probab=58.30  E-value=13  Score=16.99  Aligned_cols=179  Identities=13%  Similarity=0.124  Sum_probs=92.9

Q ss_pred             CCHHHHHHHHHHHHHCCCEEEEEECCCCCCCCCCHHHHHHHHHHHCCCCCCEEEECCCCC--------HHHHHHHHCCCC
Q ss_conf             685799999999996498389973036888744289999988762136883241025699--------999998741576
Q gi|254780485|r   88 INVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLGLETCMTLGMLS--------FEQAQILSKAGL  159 (328)
Q Consensus        88 ~~~Eei~~~a~~~~~~G~~~~~l~~~~~~~~~~~~~~~~e~i~~i~~~~~~i~~~~g~~~--------~~~~~~Lk~aG~  159 (328)
                      .+.+++.+.++++.+.|+.-+|+..       ..+....+.   ++...+.+++.++...        ..+.+...+.|+
T Consensus        10 ~t~~~i~~~~~~a~~~~~~av~v~p-------~~v~~~~~~---l~~~~~~v~~vv~fp~g~~~~~~k~~e~~~ai~~GA   79 (201)
T cd00945          10 ATLEDIAKLCDEAIEYGFAAVCVNP-------GYVRLAADA---LAGSDVPVIVVVGFPTGLTTTEVKVAEVEEAIDLGA   79 (201)
T ss_pred             CCHHHHHHHHHHHHHHCCCEEEECH-------HHHHHHHHH---CCCCCCCEEEEECCCCCCCCHHHHHHHHHHHHHHCC
T ss_conf             9999999999999862982999889-------999999998---089998389995889999977799999999999099


Q ss_pred             CEEEEECCCCHHHHHCCCCCCCHHHHHH----HHHHHHHCCCCCCCEEEECCCCCHHHHHHHHHHHHHCCCCCCEEECCC
Q ss_conf             0697513437777320588889899999----999999879855770786689899999999999974088886020541
Q gi|254780485|r  160 DYYNHNIDTSERFYPHVTTTHTFEDRLQ----TLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINL  235 (328)
Q Consensus       160 ~~~~~~let~~~~~~~~~~~~~~~~~l~----~~~~a~~~G~~~~sg~l~G~gEt~eeri~~l~~lr~l~~~~~~v~~~~  235 (328)
                      +.+-+.+...  ...    ...|+.-++    +.+.+ +.|+++-.-+-.+.-.+.++.........+.+.  ++|-   
T Consensus        80 deid~v~~~~--~~~----~~~~~~~~~ei~~v~~~~-~~g~~~kvi~e~~~l~~~~~i~~a~~~~~~~Ga--dfvK---  147 (201)
T cd00945          80 DEIDVVINIG--SLK----EGDWEEVLEEIAAVVEAA-DGGLPLKVILETRGLKTADEIAKAARIAAEAGA--DFIK---  147 (201)
T ss_pred             CEEEEECCHH--HHH----CCCHHHHHHHHHHHHHHH-CCCCCEEEEECCCCCCCHHHHHHHHHHHHHHCC--CEEE---
T ss_conf             9899740567--775----668899999999999973-579837999616778999999999999998099--8798---


Q ss_pred             EEECCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCEEEEHHHHHCHHHHHHHHHHCCCEEEE
Q ss_conf             120487412445687989999999999996868721423115651656899999809988997
Q gi|254780485|r  236 LIPIPGSKFEENKKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFV  298 (328)
Q Consensus       236 ~~p~~gt~l~~~~~~~~~e~lr~iAi~RL~lP~~~i~i~~~~~~~~~~~~~~~L~~GaN~~~~  298 (328)
                          ..|.+.. ...+.+....+....+   ++..|..++|--  ..+.....+.+||+.+-+
T Consensus       148 ----tstG~~~-~~at~~~v~~m~~~~~---~~~~vk~sGGi~--~~~~a~~~l~aGa~~igt  200 (201)
T cd00945         148 ----TSTGFGG-GGATVEDVKLMKEAVG---GRVGVKAAGGIK--TLEDALAAIEAGADGIGT  200 (201)
T ss_pred             ----ECCCCCC-CCCCHHHHHHHHHHHC---CCCEEECCCCCC--CHHHHHHHHHHCCCEEEC
T ss_conf             ----5588788-9899999999999828---786386358979--999999999828653537


No 270
>COG1908 FrhD Coenzyme F420-reducing hydrogenase, delta subunit [Energy production and conversion]
Probab=57.39  E-value=14  Score=16.89  Aligned_cols=17  Identities=24%  Similarity=0.452  Sum_probs=6.8

Q ss_pred             CHHHHHHHHH-HHHHCCC
Q ss_conf             9899999999-9998798
Q gi|254780485|r  181 TFEDRLQTLE-NVRKSGI  197 (328)
Q Consensus       181 ~~~~~l~~~~-~a~~~G~  197 (328)
                      .+++|.+.++ .+.++|+
T Consensus        75 ka~rR~~~lke~l~elgi   92 (132)
T COG1908          75 KAKRRMELLKELLKELGI   92 (132)
T ss_pred             HHHHHHHHHHHHHHHHCC
T ss_conf             799999999999999488


No 271
>TIGR02291 rimK_rel_E_lig alpha-L-glutamate ligase homolog; InterPro: IPR011758   Members of this protein family contain a region of homology to the RimK family of alpha-L-glutamate ligases (IPR004666 from INTERPRO), various members of which modify the Glu-Glu C-terminus of ribosomal protein S6, or tetrahydromethanopterin, or a form of coenzyme F420 derivative. Members of this family are found so far in various Vibrio and Pseudomonas species and some other gamma and beta Proteobacteria. The function is unknown..
Probab=57.14  E-value=12  Score=17.21  Aligned_cols=47  Identities=13%  Similarity=0.137  Sum_probs=23.6

Q ss_pred             CCCCCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCCCCHHHHHHHHHHHC
Q ss_conf             410006857999999999964983899730368887442899999887621
Q gi|254780485|r   83 KASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVK  133 (328)
Q Consensus        83 ~~~~~~~~Eei~~~a~~~~~~G~~~~~l~~~~~~~~~~~~~~~~e~i~~i~  133 (328)
                      ..|.+. +|.+.-+.. +...|++=.-+.+.-+  ...+++.+-++++...
T Consensus        30 SlYPlV-DDKl~TK~~-A~AaGi~VPelyGVI~--~q~ev~~~~~ivkdh~   76 (320)
T TIGR02291        30 SLYPLV-DDKLKTKIL-AIAAGIAVPELYGVIE--IQKEVKSLDDIVKDHE   76 (320)
T ss_pred             CCCCCC-CCHHHHHHH-HHHCCCCCCHHCCCCC--CHHHHHHHHHHHCCCC
T ss_conf             478720-313678899-8733671101301002--3466543466627889


No 272
>PRK08104 consensus
Probab=56.99  E-value=14  Score=16.84  Aligned_cols=182  Identities=14%  Similarity=0.138  Sum_probs=105.3

Q ss_pred             CCCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCCCCHHHHHHHHHHHCCCCCCEEEECCC-CCHHHHHHHHCCCCCEEE
Q ss_conf             0006857999999999964983899730368887442899999887621368832410256-999999987415760697
Q gi|254780485|r   85 SKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLGLETCMTLGM-LSFEQAQILSKAGLDYYN  163 (328)
Q Consensus        85 ~~~~~~Eei~~~a~~~~~~G~~~~~l~~~~~~~~~~~~~~~~e~i~~i~~~~~~i~~~~g~-~~~~~~~~Lk~aG~~~~~  163 (328)
                      -+..+.|+....++.+.+.|++-+-+..  +.+.      -.+.|+.+++..+.+.+-+|. ++.++++...++|++.+.
T Consensus        21 ir~~~~~~a~~la~al~~gGi~~iEiTl--rt~~------a~~~I~~l~~~~p~~~vGaGTV~~~e~~~~ai~aGA~FiV   92 (212)
T PRK08104         21 IVINKLEHAVPLAKALVAGGVRVLEVTL--RTPC------ALEAIRAIAKEVPEAIVGAGTVLNPQQLAEVTEAGAQFAI   92 (212)
T ss_pred             EECCCHHHHHHHHHHHHHCCCCEEEEEC--CCCH------HHHHHHHHHHHCCCCEEEEEECCCHHHHHHHHHCCCCEEE
T ss_conf             9779999999999999987998899968--8814------9999999998689856854202679999999985999998


Q ss_pred             EECCCCHHHHHCCCCCCCHHHHHHHHHHHHHCCCCCCCEEEECCCCCHHHHHHHHHHHHHCCCCCCEEECCCEEECCCCC
Q ss_conf             51343777732058888989999999999987985577078668989999999999997408888602054112048741
Q gi|254780485|r  164 HNIDTSERFYPHVTTTHTFEDRLQTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSK  243 (328)
Q Consensus       164 ~~let~~~~~~~~~~~~~~~~~l~~~~~a~~~G~~~~sg~l~G~gEt~eeri~~l~~lr~l~~~~~~v~~~~~~p~~gt~  243 (328)
                           +|        ..+    -++++.+++.+++.-.|.+     |+-|...-+    +.+.  ..+-   |+|..   
T Consensus        93 -----SP--------~~~----~~v~~~a~~~~i~~iPGv~-----TpsEi~~A~----~~G~--~~vK---lFPA~---  138 (212)
T PRK08104         93 -----SP--------GLT----EELLKAATEGTIPLIPGIS-----TVSELMLGM----DYGL--TEFK---FFPAE---  138 (212)
T ss_pred             -----CC--------CCC----HHHHHHHHHCCCCEECCCC-----CHHHHHHHH----HCCC--CEEE---ECCCC---
T ss_conf             -----48--------999----9999999982997656769-----999999999----8799--9799---78762---


Q ss_pred             CCCCCCCCHHHHHHHHHHHHHHCCCCCCEEEEHHHHHCHHHHHHHHHHCCCEEEECCEEECC---CCCCHHHHHHHHHH
Q ss_conf             24456879899999999999968687214231156516568999998099889977866515---88898999999998
Q gi|254780485|r  244 FEENKKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTA---KNPSYNKDTILFNR  319 (328)
Q Consensus       244 l~~~~~~~~~e~lr~iAi~RL~lP~~~i~i~~~~~~~~~~~~~~~L~~GaN~~~~g~~~~t~---~g~~~~~~~~~i~~  319 (328)
                           ...+..++|-+   +=-+|+..+.-++|   +..+...--|.+|+-....|..+...   .....+++.+..++
T Consensus       139 -----~~gG~~~lkal---~~p~p~~~f~ptGG---V~~~N~~~yl~~~~v~~vgGS~l~~~~~i~~~d~~~I~~~a~~  206 (212)
T PRK08104        139 -----ANGGVKALQAI---SGPFSQIRFCPTGG---ITPANYRDYLALKSVLCIGGSWLVPADALEAGDWDRITKLAKE  206 (212)
T ss_pred             -----CCCCHHHHHHH---HCCCCCCEEEECCC---CCHHHHHHHHHCCCEEEEECHHHCCHHHHHCCCHHHHHHHHHH
T ss_conf             -----13749999998---55589981896489---8988999998079879998835389999874899999999999


No 273
>PTZ00081 enolase (2-phospho-D-glycerate hydrolase); Provisional
Probab=56.38  E-value=14  Score=16.78  Aligned_cols=74  Identities=14%  Similarity=0.047  Sum_probs=42.3

Q ss_pred             CCCCCCCHHHHHHHHHHHHHHCCCCCCEEEE-HHHHHCHHHHHHHHHHCCCEEEECCEEECCCC---CCHHHHHHHHHHC
Q ss_conf             4456879899999999999968687214231-15651656899999809988997786651588---8989999999982
Q gi|254780485|r  245 EENKKVDPIEHVRIISVARILMPKSRLRLAA-GRAMMSDELQALCFFSGANSIFVGDTLLTAKN---PSYNKDTILFNRL  320 (328)
Q Consensus       245 ~~~~~~~~~e~lr~iAi~RL~lP~~~i~i~~-~~~~~~~~~~~~~L~~GaN~~~~g~~~~t~~g---~~~~~~~~~i~~~  320 (328)
                      +.....|..|.+..+..+|=.-=.+  .+|. +-||...-...+|.-.||.-+-+|.-   .+|   ...++.++.=+++
T Consensus       352 K~NQiGTlset~eai~~A~~~g~~~--ivShRSGETeD~~iaDLAVg~ga~~iK~G~~---~r~ER~aKyNrLLrIeeeL  426 (442)
T PTZ00081        352 KVNQIGSITEAIEACKLCMKNGWGV--MVSHRSGETEDTFIADLVVGLGTGQIKTGAP---CRSERNAKYNQLLRIEEEL  426 (442)
T ss_pred             ECCCCCHHHHHHHHHHHHHHCCCEE--EEECCCCCCCCCHHHHHHHHCCCCCEECCCC---CCHHHHHHHHHHHHHHHHH
T ss_conf             3323220999999999999879879--9957988766300888777448982033898---4178899999999999986


Q ss_pred             CCC
Q ss_conf             985
Q gi|254780485|r  321 GLI  323 (328)
Q Consensus       321 G~~  323 (328)
                      |-.
T Consensus       427 g~~  429 (442)
T PTZ00081        427 GSR  429 (442)
T ss_pred             CCC
T ss_conf             545


No 274
>pfam07085 DRTGG DRTGG domain. This presumed domain is about 120 amino acids in length. It is found associated with CBS domains pfam00571, as well as the CbiA domain pfam01656. The function of this domain is unknown. It is named the DRTGG domain after some of the most conserved residues. This domain may be very distantly related to a pair of CBS domains. There are no significant sequence similarities, but its length and association with CBS domains supports this idea (Bateman A, pers. obs.).
Probab=55.41  E-value=15  Score=16.67  Aligned_cols=51  Identities=20%  Similarity=0.303  Sum_probs=26.3

Q ss_pred             CCCCCEEEEHHHHHCHHHHHHHHHHCCCEEEECCEEECCCCCCHHHHHHHHHHCCCCCCCC
Q ss_conf             6872142311565165689999980998899778665158889899999999829853247
Q gi|254780485|r  267 PKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTILFNRLGLIPDLS  327 (328)
Q Consensus       267 P~~~i~i~~~~~~~~~~~~~~~L~~GaN~~~~g~~~~t~~g~~~~~~~~~i~~~G~~P~~~  327 (328)
                      |+..+-+.+-|+    +.+..++.+|+.+++.     |.+....++..+++++.| .|.++
T Consensus        40 ~g~lvI~~gdR~----di~~~a~~~~~~~iIl-----Tgg~~p~~~v~~la~~~~-ipii~   90 (105)
T pfam07085        40 PGDLVITPGDRE----DIQLAALLAGIAGLIL-----TGGFEPSEEVLKLAEEAG-LPVLS   90 (105)
T ss_pred             CCCEEEEECCCH----HHHHHHHHHCCCEEEE-----ECCCCCCHHHHHHHHHCC-CEEEE
T ss_conf             897999927968----9999999824878999-----489898999999998779-83999


No 275
>pfam00490 ALAD Delta-aminolevulinic acid dehydratase.
Probab=54.90  E-value=15  Score=16.62  Aligned_cols=56  Identities=18%  Similarity=0.203  Sum_probs=38.7

Q ss_pred             CCCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCCC---------CHHHHHHHHHHHCCCCCCEEE
Q ss_conf             000685799999999996498389973036888744---------289999988762136883241
Q gi|254780485|r   85 SKLINVDQVLKEAKNAKENGATRYCMGAAWREPKER---------DLSIIVDMIKGVKSLGLETCM  141 (328)
Q Consensus        85 ~~~~~~Eei~~~a~~~~~~G~~~~~l~~~~~~~~~~---------~~~~~~e~i~~i~~~~~~i~~  141 (328)
                      -+..+.+.++++++.+.+.|++-+.+-.... +..+         +-..+..+++.+|+.++.+.+
T Consensus        51 i~R~sid~l~~~v~~~~~lGI~av~LFpvi~-~~~Kd~~gseA~n~~~lv~raIr~iK~~fpdl~v  115 (322)
T pfam00490        51 VYRLSVDLLVKEVEEAVELGIPAVILFGVID-PELKDEDGSEAYNPDGLVQRAIRAIKEAFPDLVV  115 (322)
T ss_pred             CEEECHHHHHHHHHHHHHCCCCEEEEECCCC-CCCCCCCCCCCCCCCCHHHHHHHHHHHHCCCEEE
T ss_conf             5144899999999999977998799844586-0238955361248742899999999986897067


No 276
>PRK03562 glutathione-regulated potassium-efflux system protein KefC; Provisional
Probab=54.34  E-value=15  Score=16.56  Aligned_cols=40  Identities=13%  Similarity=0.011  Sum_probs=17.7

Q ss_pred             HHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHCCCCCEE
Q ss_conf             9999988762136883241025699999998741576069
Q gi|254780485|r  123 SIIVDMIKGVKSLGLETCMTLGMLSFEQAQILSKAGLDYY  162 (328)
Q Consensus       123 ~~~~e~i~~i~~~~~~i~~~~g~~~~~~~~~Lk~aG~~~~  162 (328)
                      +.-.++++.+++.+|++.+-+-..+..+..+|+++|++.+
T Consensus       475 ~~~~~iv~~~r~~~P~l~IiaRard~~~~~~L~~~Ga~~v  514 (615)
T PRK03562        475 QTNLQLTELVKEHFPHLQIIARARDVDHYIRLRQAGVEKP  514 (615)
T ss_pred             HHHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHCCCCEE
T ss_conf             9999999999975899869998397788999997899989


No 277
>PRK04302 triosephosphate isomerase; Provisional
Probab=54.19  E-value=16  Score=16.55  Aligned_cols=147  Identities=14%  Similarity=0.115  Sum_probs=80.0

Q ss_pred             HHHHHHHHCCCCCEEEEECCCCHHHHHCCCCCCCHHHHHHHHHHHHHCCCCCCCEEEECCCCCHHHHHHHHHHHHHCCCC
Q ss_conf             99999874157606975134377773205888898999999999998798557707866898999999999999740888
Q gi|254780485|r  148 FEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTP  227 (328)
Q Consensus       148 ~~~~~~Lk~aG~~~~~~~let~~~~~~~~~~~~~~~~~l~~~~~a~~~G~~~~sg~l~G~gEt~eeri~~l~~lr~l~~~  227 (328)
                      +-....|+++|+..+.++.--.|..|.+         --+.++.+.+.|+.+    ++=.++..+.+.     +..+.  
T Consensus        75 evS~~mL~d~G~~~vIlGHSERR~~~~E---------~~~~v~~a~~~gl~~----I~Cv~~~~~~~~-----~~~l~--  134 (223)
T PRK04302         75 HILPEAVKDAGAVGTLLNHSERRLRLAD---------IEAAVERAKELGLES----VVCTNNPETSAA-----AAALG--  134 (223)
T ss_pred             CCCHHHHHHCCCCEEEECCCHHHHHCCC---------HHHHHHHHHHCCCEE----EEECCCHHHHHH-----HHHCC--
T ss_conf             3309999985999999565331000322---------799999999869948----997273998889-----98658--


Q ss_pred             CCEEECCCEEECCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCEEEEHHHHHCHHHHHHHHHHCCCEEEECCEEECCCC
Q ss_conf             86020541120487412445687989999999999996868721423115651656899999809988997786651588
Q gi|254780485|r  228 PESIPINLLIPIPGSKFEENKKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKN  307 (328)
Q Consensus       228 ~~~v~~~~~~p~~gt~l~~~~~~~~~e~lr~iAi~RL~lP~~~i~i~~~~~~~~~~~~~~~L~~GaN~~~~g~~~~t~~g  307 (328)
                      +..+..=|..- =||-.. .....+++.-+++...|=.-|++.|-..+ =++-+ +.....+.-|+||.++|+-.+.+..
T Consensus       135 ~~~IAYEPvWA-IGTG~~-as~~~~e~i~~~~~~~~~~~~~i~ILYGG-sV~~~-n~~~~~~~~~vDG~LVGgAsLkA~D  210 (223)
T PRK04302        135 PDAVAVEPPEL-IGTGIP-VSKAKPEVVTGTVEAVRKVNPDVKVLCGA-GISTG-EDVKAALELGADGVLLASGVVKAKD  210 (223)
T ss_pred             CCEEEECCHHH-HCCCCC-CCCCCHHHHHHHHHHHHHHCCCCCEEEEC-CCCHH-HHHHHHHCCCCCEEEEEEEEEECCC
T ss_conf             99899888898-448987-66258999999999999647997589978-46878-8999974689985897625666879


Q ss_pred             CCHHHHHHHHHH
Q ss_conf             898999999998
Q gi|254780485|r  308 PSYNKDTILFNR  319 (328)
Q Consensus       308 ~~~~~~~~~i~~  319 (328)
                       ....+.+|++.
T Consensus       211 -p~~~l~~l~~~  221 (223)
T PRK04302        211 -PEAALRDLVSP  221 (223)
T ss_pred             -HHHHHHHHHHH
T ss_conf             -99999999975


No 278
>COG4822 CbiK Cobalamin biosynthesis protein CbiK, Co2+ chelatase [Coenzyme metabolism]
Probab=54.14  E-value=16  Score=16.54  Aligned_cols=84  Identities=15%  Similarity=0.050  Sum_probs=48.2

Q ss_pred             CCCEEE-ECCCCCHHHHHHHHCCCCCEEEEE--CCCCHHHHHCCCCCCCHHHHHHHHHHHHHCCCCCCCEEEECCCCCHH
Q ss_conf             883241-025699999998741576069751--34377773205888898999999999998798557707866898999
Q gi|254780485|r  136 GLETCM-TLGMLSFEQAQILSKAGLDYYNHN--IDTSERFYPHVTTTHTFEDRLQTLENVRKSGIKVCCGGILGLGEMID  212 (328)
Q Consensus       136 ~~~i~~-~~g~~~~~~~~~Lk~aG~~~~~~~--let~~~~~~~~~~~~~~~~~l~~~~~a~~~G~~~~sg~l~G~gEt~e  212 (328)
                      +..++. ...+.-+..++.|++.|+..+.+-  +-++-.....-....+-+.|.+.+   .+.|+++ ...+-|+||.++
T Consensus       169 ~v~v~~ve~yP~~d~vi~~l~~~~~~~v~L~PlMlvAG~Ha~nDMasddedswk~il---~~~G~~v-~~~l~GLGE~~~  244 (265)
T COG4822         169 NVFVAAVEGYPLVDTVIEYLRKNGIKEVHLIPLMLVAGDHAKNDMASDDEDSWKNIL---EKNGFKV-EVYLHGLGENPA  244 (265)
T ss_pred             CEEEEEECCCCCHHHHHHHHHHCCCCEEEEEEEEEEECHHHHHHHCCCCHHHHHHHH---HHCCCEE-EEEEECCCCCHH
T ss_conf             569998247875899999999768764888656886040223211126347899999---8679546-887605777678


Q ss_pred             HHHHHHHHHHH
Q ss_conf             99999999974
Q gi|254780485|r  213 DRIDMLLTLAN  223 (328)
Q Consensus       213 eri~~l~~lr~  223 (328)
                      =+.-.+.+|++
T Consensus       245 iq~ifi~Hik~  255 (265)
T COG4822         245 IQAIFIDHIKD  255 (265)
T ss_pred             HHHHHHHHHHH
T ss_conf             99999999999


No 279
>TIGR01163 rpe ribulose-phosphate 3-epimerase; InterPro: IPR000056 Ribulose-phosphate 3-epimerase (5.1.3.1 from EC) (also known as pentose-5-phosphate 3-epimerase or PPE) is the enzyme that converts D-ribulose 5-phosphate into D-xylulose 5-phosphate in Calvin's reductive pentose phosphate cycle. In Alcaligenes eutrophus two copies of the gene coding for PPE are known , one is chromosomally encoded P40117 from SWISSPROT, the other one is on a plasmid Q04539 from SWISSPROT. PPE has been found in a wide range of bacteria, archaebacteria, fungi and plants. All the proteins have from 209 to 241 amino acid residues. The enzyme has a TIM barrel structure.; GO: 0004750 ribulose-phosphate 3-epimerase activity, 0005975 carbohydrate metabolic process.
Probab=53.79  E-value=16  Score=16.50  Aligned_cols=183  Identities=15%  Similarity=0.203  Sum_probs=112.2

Q ss_pred             HHHHHHHHHHHCCCEEEEE-ECCCCCCCCCCH-HHHHHHHHHH-CCCCCCEEEECCCCCHHHHHHHHCCCCCEEEEECCC
Q ss_conf             9999999999649838997-303688874428-9999988762-136883241025699999998741576069751343
Q gi|254780485|r   92 QVLKEAKNAKENGATRYCM-GAAWREPKERDL-SIIVDMIKGV-KSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDT  168 (328)
Q Consensus        92 ei~~~a~~~~~~G~~~~~l-~~~~~~~~~~~~-~~~~e~i~~i-~~~~~~i~~~~g~~~~~~~~~Lk~aG~~~~~~~let  168 (328)
                      .+-++++...+.|+--+|+ ++-|+.-|.-++ --+++.+|.. -+.++.+|+=+-. .+..+..+.++|++.+..-.|.
T Consensus        13 rLgee~~~v~~AGaD~iH~DVMDGHFVPNlT~Gp~v~~~~r~~g~~~P~DVHLMv~~-pd~~~~~Fa~aGA~~I~vH~Ea   91 (216)
T TIGR01163        13 RLGEEVKAVEEAGADLIHVDVMDGHFVPNLTFGPPVLEALRKYGTKLPIDVHLMVEN-PDRYIEDFAEAGADIITVHAEA   91 (216)
T ss_pred             HHHHHHHHHHHCCCCEEEEEECCCCCCCCCCCCHHHHHHHHHHCCCCCEEEEECCCC-HHHHHHHHHHHCCCEEEEECCC
T ss_conf             799999999966997899862479717710027789998874079521266303578-5777889997089989984377


Q ss_pred             CHHHHHCCCCCCCHHHHHHHHHHHHHCCCCCCCEEEECCCCCHHHHHHHHHHHHHCCCCCCEEECCCEEECCCCCCCCCC
Q ss_conf             77773205888898999999999998798557707866898999999999999740888860205411204874124456
Q gi|254780485|r  169 SERFYPHVTTTHTFEDRLQTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENK  248 (328)
Q Consensus       169 ~~~~~~~~~~~~~~~~~l~~~~~a~~~G~~~~sg~l~G~gEt~eeri~~l~~lr~l~~~~~~v~~~~~~p~~gt~l~~~~  248 (328)
                      +.-             -.++++..|+.|.+-  |+-+=. .|+-|-++.++.--+      .|-++=-.  ||  |-+++
T Consensus        92 ~~h-------------~~R~l~~Ik~~G~~A--G~v~NP-~TPl~~~~~~L~~~D------~VLlMSVn--PG--FgGQk  145 (216)
T TIGR01163        92 TEH-------------IHRLLQLIKELGAKA--GIVLNP-ATPLEALEYVLEDVD------LVLLMSVN--PG--FGGQK  145 (216)
T ss_pred             CCC-------------HHHHHHHHHHCCCCE--EEEECC-CCCHHHHHHHHHHCC------EEEEEEEE--CC--CCCCC
T ss_conf             626-------------799999999718970--688679-999878998987629------89988760--79--98841


Q ss_pred             CCCHHHHHHHHHHHHHHCC--C----CCCEEEEHHHHHCHHHHHHHHHHCCCEEEECCEEECCC
Q ss_conf             8798999999999999686--8----72142311565165689999980998899778665158
Q gi|254780485|r  249 KVDPIEHVRIISVARILMP--K----SRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAK  306 (328)
Q Consensus       249 ~~~~~e~lr~iAi~RL~lP--~----~~i~i~~~~~~~~~~~~~~~L~~GaN~~~~g~~~~t~~  306 (328)
                      =.  .+.+.=|--.|=|.+  .    ..|-+=+   .+..+.....-.||||...+|.++=.++
T Consensus       146 FI--P~~~~Kir~~R~~id~~~~~~~~~ieVDG---Gv~~~ni~~~~~AGAD~~VaGSaiF~~~  204 (216)
T TIGR01163       146 FI--PETLEKIRELRKMIDKLELGLSILIEVDG---GVNEDNIAEVAEAGADILVAGSAIFGAD  204 (216)
T ss_pred             CH--HHHHHHHHHHHHHHHHHCCCCCEEEEECC---CCCHHHHHHHHHCCCCEEEEEEEEECCC
T ss_conf             10--57899999999999860279955899717---9897679999975898999831020888


No 280
>PRK13131 consensus
Probab=53.29  E-value=16  Score=16.45  Aligned_cols=186  Identities=13%  Similarity=0.125  Sum_probs=100.7

Q ss_pred             CHHHHHHHHHHHHHCCCEEEEEECCCCCCC-CC--------------CHHHHHHHHHHHCCCCCCEEE-ECCCC------
Q ss_conf             857999999999964983899730368887-44--------------289999988762136883241-02569------
Q gi|254780485|r   89 NVDQVLKEAKNAKENGATRYCMGAAWREPK-ER--------------DLSIIVDMIKGVKSLGLETCM-TLGML------  146 (328)
Q Consensus        89 ~~Eei~~~a~~~~~~G~~~~~l~~~~~~~~-~~--------------~~~~~~e~i~~i~~~~~~i~~-~~g~~------  146 (328)
                      +.|.-++.++...+.|+.-+-++--.-+|. +.              ......++++.+++....+-+ -.+..      
T Consensus        23 ~~e~s~~~~~~l~~~GadiiEiGiPFSDP~ADGpvIQ~a~~rAL~~g~~~~~~~~~~~~r~~~~~~pivlM~Y~N~i~~y  102 (257)
T PRK13131         23 NYELSFEIIKTLIISGVSALELGFAFSDPVADGITIQASHLRALKHASMAKNFQLLKKIRDYNHHIPIGLLAYANLIFSY  102 (257)
T ss_pred             CHHHHHHHHHHHHHCCCCEEEECCCCCCCCCCCHHHHHHHHHHHHCCCHHHHHHHHHHHHHCCCCCCEEEECCHHHHHHH
T ss_conf             98899999999997799999978998885545599999999999789889999999998704999888999276899985


Q ss_pred             -CHHHHHHHHCCCCCEEEEECCCCHHHHHCCCCCCCHHHHHHHHHHHHHCCCCCCCEEEECCCCCHHHHHHHHHHHHHCC
Q ss_conf             -9999998741576069751343777732058888989999999999987985577078668989999999999997408
Q gi|254780485|r  147 -SFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLS  225 (328)
Q Consensus       147 -~~~~~~~Lk~aG~~~~~~~let~~~~~~~~~~~~~~~~~l~~~~~a~~~G~~~~sg~l~G~gEt~eeri~~l~~lr~l~  225 (328)
                       .+.-+++.+++|++.+.+             |.-.+++.-+..+.+++.|+..-  .++-. -|.++|++.+....+  
T Consensus       103 G~e~F~~~~~~~GvdGvIi-------------pDLP~eE~~~~~~~~~~~~l~~I--~lvaP-tt~~~Ri~~i~~~s~--  164 (257)
T PRK13131        103 GVDGFYAQAKECGVDSVLI-------------ADMPLIEKELVIKSAQKHQIKQI--FIASP-NASVKDLEQVATHSQ--  164 (257)
T ss_pred             CHHHHHHHHHHCCCCCEEC-------------CCCCHHHHHHHHHHHHHCCCCEE--EEECC-CCCHHHHHHHHHCCC--
T ss_conf             7999999998659985655-------------89996788999999997798479--97289-998899999983589--


Q ss_pred             CCCCEEECCCEEECCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCEEEEHHHHHCHHHHHHHHHHCCCEEEECCEEE
Q ss_conf             888602054112048741244568798999999999999686872142311565165689999980998899778665
Q gi|254780485|r  226 TPPESIPINLLIPIPGSKFEENKKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLL  303 (328)
Q Consensus       226 ~~~~~v~~~~~~p~~gt~l~~~~~~~~~e~lr~iAi~RL~lP~~~i~i~~~~~~~~~~~~~~~L~~GaN~~~~g~~~~  303 (328)
                         .++   ..+...|+.-....  -+.+....+.-.|-.-   .+++..|-.--.++........|||++++|..++
T Consensus       165 ---GFi---Y~vs~~GvTG~~~~--~~~~~~~~i~~ik~~t---~~Pv~vGFGIs~~e~v~~~~~~gaDGvIVGSaiV  231 (257)
T PRK13131        165 ---GYI---YTLARSGVTGASHT--LENDASAIIKTLKTFS---PTPALLGFGISKKEHITNAKGMGADGVICGSALV  231 (257)
T ss_pred             ---CEE---EEEECCCCCCCCCC--CCHHHHHHHHHHHHCC---CCCEEEECCCCCHHHHHHHHHCCCCEEEECHHHH
T ss_conf             ---749---99845767798643--4076999999999668---9987998057988999999855999999878999


No 281
>TIGR01090 apt adenine phosphoribosyltransferase; InterPro: IPR005764    Adenine phosphoribosyltransferase (APRTase, 2.4.2.7 from EC) is a widely distributed enzyme, and its deficiency in humans causes the accumulation of 2,8-dihydroxyadenine. It is the sole catalyst for adenine recycling in most eukaryotes.  AMP + diphosphate = adenine + 5-phospho-alpha-D-ribose 1-diphosphate  ; GO: 0003999 adenine phosphoribosyltransferase activity, 0006168 adenine salvage.
Probab=53.09  E-value=10  Score=17.84  Aligned_cols=39  Identities=23%  Similarity=0.307  Sum_probs=26.7

Q ss_pred             HHHHHHHH-HCCCEEEECCEEECCCCCCHHHHHHHHHHCCCC
Q ss_conf             68999998-099889977866515888989999999982985
Q gi|254780485|r  283 ELQALCFF-SGANSIFVGDTLLTAKNPSYNKDTILFNRLGLI  323 (328)
Q Consensus       283 ~~~~~~L~-~GaN~~~~g~~~~t~~g~~~~~~~~~i~~~G~~  323 (328)
                      ++++=|+. -|.+.+++-| ++.|+| +.+...++|+++|=+
T Consensus       104 EIh~DA~~~~g~RVliVDD-LlATGG-T~~A~~eLi~~Lgge  143 (175)
T TIGR01090       104 EIHKDAIKIPGQRVLIVDD-LLATGG-TAEATLELIKKLGGE  143 (175)
T ss_pred             EEEHHHHHCCCCEEEEEEC-CCCCHH-HHHHHHHHHHHHCCE
T ss_conf             3411136407890899832-201267-899999999985961


No 282
>cd04732 HisA HisA.  Phosphoribosylformimino-5-aminoimidazole carboxamide ribonucleotide (ProFAR) isomerase catalyzes the fourth step in histidine biosynthesis, an isomerisation of the aminoaldose moiety of ProFAR to the aminoketose of PRFAR (N-(5'-phospho-D-1'-ribulosylformimino)-5-amino-1-(5''-phospho-ribosyl)-4-imidazolecarboxamide). In bacteria and archaea, ProFAR isomerase is encoded by the HisA gene.
Probab=53.09  E-value=16  Score=16.43  Aligned_cols=185  Identities=17%  Similarity=0.169  Sum_probs=94.1

Q ss_pred             HHHHHHHHHHHCCCEEEEEECCC--CCCCCCCHHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHCCCCCEEEEECCC-
Q ss_conf             99999999996498389973036--888744289999988762136883241025699999998741576069751343-
Q gi|254780485|r   92 QVLKEAKNAKENGATRYCMGAAW--REPKERDLSIIVDMIKGVKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDT-  168 (328)
Q Consensus        92 ei~~~a~~~~~~G~~~~~l~~~~--~~~~~~~~~~~~e~i~~i~~~~~~i~~~~g~~~~~~~~~Lk~aG~~~~~~~let-  168 (328)
                      ..++.|+...+.|+.++++.--.  ........+.+.++.   ++.++.+.+.-|..+.++.+++.++|++.+.++-++ 
T Consensus        30 dP~~~a~~~~~~g~d~l~i~DLdaa~~~~~~n~~~I~~I~---~~~~~pi~vGGGIrs~~~~~~l~~~Ga~kvvi~s~~~  106 (234)
T cd04732          30 DPVEVAKKWEEAGAKWLHVVDLDGAKGGEPVNLELIEEIV---KAVGIPVQVGGGIRSLEDIERLLDLGVSRVIIGTAAV  106 (234)
T ss_pred             CHHHHHHHHHHCCCCEEEEEECCCHHHCCCCHHHHHHHHH---HHCCCCEEECCCCCCHHHHHHHHHCCCCEEEECCCHH
T ss_conf             9999999999869998999967530308911599999999---7679568973771759999999864887189714011


Q ss_pred             -CHHHHHCCCCCCCHHHHHHHHHHHHHCCCCCCCEE--EEC-CCCCHHHHHHHHHHHHHCCCCCCEEECCCEEECCCCCC
Q ss_conf             -77773205888898999999999998798557707--866-89899999999999974088886020541120487412
Q gi|254780485|r  169 -SERFYPHVTTTHTFEDRLQTLENVRKSGIKVCCGG--ILG-LGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKF  244 (328)
Q Consensus       169 -~~~~~~~~~~~~~~~~~l~~~~~a~~~G~~~~sg~--l~G-~gEt~eeri~~l~~lr~l~~~~~~v~~~~~~p~~gt~l  244 (328)
                       .|++..++......+ ++       -+.+...-+-  .-| --.+..+..+++..+.+++.  ..+-++ -+...||. 
T Consensus       107 ~~~~~~~~~~~~~G~q-~i-------v~slD~k~~~~~~~~~~~~~~~~~~~~i~~~~~~g~--geiilt-~i~~dGt~-  174 (234)
T cd04732         107 KNPELVKELLKEYGGE-RI-------VVGLDAKDGKVATKGWLETSEVSLEELAKRFEELGV--KAIIYT-DISRDGTL-  174 (234)
T ss_pred             HCHHHHHHHHHHCCCC-CE-------EEEEEEECCCHHCCCCCEEECCCHHHHHHHHHHCCC--CEEEEE-EECCCCCC-
T ss_conf             0827899999982976-46-------999997512000168640013516999999974586--469987-64256653-


Q ss_pred             CCCCCCCHHHHHHHHHHHHHHCCCCCCEEEEHHHHHCHHHHHHHHHHCCCEEEECCE
Q ss_conf             445687989999999999996868721423115651656899999809988997786
Q gi|254780485|r  245 EENKKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDT  301 (328)
Q Consensus       245 ~~~~~~~~~e~lr~iAi~RL~lP~~~i~i~~~~~~~~~~~~~~~L~~GaN~~~~g~~  301 (328)
                          .....+.++-+  .+..  +..+-+++|- +-..+..+ ....|+++.++|--
T Consensus       175 ----~G~d~~ll~~i--~~~~--~~p~i~~GGv-~s~~di~~-l~~~g~~gvivgsA  221 (234)
T cd04732         175 ----SGPNFELYKEL--AAAT--GIPVIASGGV-SSLDDIKA-LKELGVAGVIVGKA  221 (234)
T ss_pred             ----CCCCHHHHHHH--HHHC--CCCEEEEECC-CCHHHHHH-HHHCCCCEEEEEHH
T ss_conf             ----56899999999--8657--9989998189-99999999-99779989999889


No 283
>TIGR01501 MthylAspMutase methylaspartate mutase, S subunit; InterPro: IPR006394   These sequences represent the S (sigma) subunit of methylaspartate mutase (glutamate mutase), a cobalamin-dependent enzyme that catalyzes the first step in a pathway of glutamate fermentation. ; GO: 0016866 intramolecular transferase activity, 0019670 anaerobic glutamate catabolic process.
Probab=51.61  E-value=17  Score=16.28  Aligned_cols=45  Identities=20%  Similarity=0.394  Sum_probs=24.5

Q ss_pred             HHHHHHHHHCCCEEE--ECCEEECCCCCCHHHHHHHHHHCCCCCCCCC
Q ss_conf             689999980998899--7786651588898999999998298532479
Q gi|254780485|r  283 ELQALCFFSGANSIF--VGDTLLTAKNPSYNKDTILFNRLGLIPDLSA  328 (328)
Q Consensus       283 ~~~~~~L~~GaN~~~--~g~~~~t~~g~~~~~~~~~i~~~G~~P~~~~  328 (328)
                      .+++.+-.+|.+.|+  +|+|+ ..+-...++..+..+++||-=+|++
T Consensus        71 Glr~~c~eaGl~~illYVGGNl-vVGk~df~dV~~rFkeMGfDRVfap  117 (134)
T TIGR01501        71 GLRDKCAEAGLDAILLYVGGNL-VVGKTDFEDVEKRFKEMGFDRVFAP  117 (134)
T ss_pred             HHHHHHHHCCCCCEEEEECCEE-EECCCCHHHHHHHHHHCCCCEEECC
T ss_conf             5789998658882799876766-5577673678888764587332369


No 284
>pfam04476 DUF556 Protein of unknown function (DUF556). Family of uncharacterized, hypothetical prokaryotic proteins.
Probab=51.46  E-value=17  Score=16.26  Aligned_cols=127  Identities=20%  Similarity=0.261  Sum_probs=61.0

Q ss_pred             HHHHHHHHHHHHCCCEEEEEECCCCCCCCCCHHHHHHHHHHHCCCCCCE-EEECCC--------CC-HHHHHHHHCCCCC
Q ss_conf             7999999999964983899730368887442899999887621368832-410256--------99-9999987415760
Q gi|254780485|r   91 DQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLGLET-CMTLGM--------LS-FEQAQILSKAGLD  160 (328)
Q Consensus        91 Eei~~~a~~~~~~G~~~~~l~~~~~~~~~~~~~~~~e~i~~i~~~~~~i-~~~~g~--------~~-~~~~~~Lk~aG~~  160 (328)
                      ..+...+......|..-+-++..+......-.+.+....+.++...... .+..+.        .+ .+.....+++|.+
T Consensus        67 ~~is~aa~~~a~~GvDyVKVGl~~~~~~~~~~e~~~~~~~av~~~~~~~~vVav~~AD~~~~~~~~p~~i~~~a~~~G~~  146 (235)
T pfam04476        67 GTVSLAALGAAVSGADYIKVGLYGVKNYDEAVEVMKNVVRAVKDFDSSKIVVAAGYADAYRIGAVEPLDVPEIAADAGAD  146 (235)
T ss_pred             CHHHHHHHHHHCCCCCEEEEECCCCCCHHHHHHHHHHHHHHHHHCCCCCEEEEEEECHHHHHCCCCHHHHHHHHHHCCCC
T ss_conf             16789998755038998999437888679999999999999872278866999960103331388835679999975997


Q ss_pred             EEEEECCCCHHHHHCCCCCCCHHHHHHHHHHHHHCCCCCCCEEEECCCCCHHHHHHHHHHHHHCCCC
Q ss_conf             6975134377773205888898999999999998798557707866898999999999999740888
Q gi|254780485|r  161 YYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTP  227 (328)
Q Consensus       161 ~~~~~let~~~~~~~~~~~~~~~~~l~~~~~a~~~G~~~~sg~l~G~gEt~eeri~~l~~lr~l~~~  227 (328)
                      .+.  +||...-........+.++--...+.+|+.|+.++   |-|.   .  +.+|+..|+.++..
T Consensus       147 gvM--iDT~~K~g~sl~d~~~~~~L~~fv~~a~~~gl~~g---LAGS---L--~~~di~~l~~l~pd  203 (235)
T pfam04476       147 IAM--LDTAIKDGTTLFDHMKIEDLESFVKLARDNGLKVA---LAGS---I--SWEHIEPLKEIGTD  203 (235)
T ss_pred             EEE--EECCCCCCCCHHHHCCHHHHHHHHHHHHHCCCEEE---EECC---C--CHHHHHHHHHCCCC
T ss_conf             899--87466789766664999999999999997598399---8457---8--88888999864999


No 285
>cd00954 NAL N-Acetylneuraminic acid aldolase, also called N-acetylneuraminate lyase (NAL), which catalyses the reversible aldol reaction of N-acetyl-D-mannosamine and pyruvate to give N-acetyl-D-neuraminic acid (D-sialic acid). It has a widespread application as biocatalyst for the synthesis of sialic acid and its derivatives. This enzyme has been shown to be quite specific for pyruvate as the donor, but flexible to a variety of D- and, to some extent, L-hexoses and pentoses as acceptor substrates. NAL is member of dihydrodipicolinate synthase family that comprises several pyruvate-dependent class I aldolases.
Probab=51.03  E-value=17  Score=16.22  Aligned_cols=78  Identities=14%  Similarity=0.055  Sum_probs=46.5

Q ss_pred             CCCHHHHHHHHHHHH-HCCCEEEEEECCCCCCCCCCHHHHHHHHHHHCC---CCCCEEEECCCCCHH----HHHHHHCCC
Q ss_conf             068579999999999-649838997303688874428999998876213---688324102569999----999874157
Q gi|254780485|r   87 LINVDQVLKEAKNAK-ENGATRYCMGAAWREPKERDLSIIVDMIKGVKS---LGLETCMTLGMLSFE----QAQILSKAG  158 (328)
Q Consensus        87 ~~~~Eei~~~a~~~~-~~G~~~~~l~~~~~~~~~~~~~~~~e~i~~i~~---~~~~i~~~~g~~~~~----~~~~Lk~aG  158 (328)
                      ..+.+.+.+.++... ..|+.-+++.++..+-.....+...++++...+   ....+.+.+|..+-.    ..+...++|
T Consensus        17 ~iD~~~~~~~i~~li~~~Gv~gi~v~GstGE~~~Ls~~Er~~l~~~~~~~~~~r~pvi~gv~~~s~~~ai~~a~~a~~~G   96 (288)
T cd00954          17 EINEDVLRAIVDYLIEKQGVDGLYVNGSTGEGFLLSVEERKQIAEIVAEAAKGKVTLIAHVGSLNLKESQELAKHAEELG   96 (288)
T ss_pred             CCCHHHHHHHHHHHHHHCCCCEEEECCCCCCCCCCCHHHHHHHHHHHHHHCCCCCEEEECCCCCCHHHHHHHHHHHHHCC
T ss_conf             97999999999999987799899979354252138999999999999997289860873588645999999999998649


Q ss_pred             CCEEEE
Q ss_conf             606975
Q gi|254780485|r  159 LDYYNH  164 (328)
Q Consensus       159 ~~~~~~  164 (328)
                      +|.+.+
T Consensus        97 ad~v~v  102 (288)
T cd00954          97 YDAISA  102 (288)
T ss_pred             CCEEEE
T ss_conf             786773


No 286
>PRK08392 hypothetical protein; Provisional
Probab=50.41  E-value=18  Score=16.16  Aligned_cols=57  Identities=12%  Similarity=0.160  Sum_probs=31.3

Q ss_pred             CCCEEEEHHHHHCHHHHHHHHHHCCCEEEECCEEECCCCCCHHHHHHHHHHCCCCCC
Q ss_conf             721423115651656899999809988997786651588898999999998298532
Q gi|254780485|r  269 SRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTILFNRLGLIPD  325 (328)
Q Consensus       269 ~~i~i~~~~~~~~~~~~~~~L~~GaN~~~~g~~~~t~~g~~~~~~~~~i~~~G~~P~  325 (328)
                      +.+-|.+.......++..++...|+.-++--+--....=...+.-.++++++|+.+.
T Consensus       151 ~~lEIns~~~~~~~~~~~~a~~~Gv~i~i~SDAH~~~~vg~~~~~~~~~~~~~~~~e  207 (215)
T PRK08392        151 KAFEISSRYKVPDLEFIRECIKRGIKLTFASDAHRPEDVGNVSWSEKVFEKAGGKKE  207 (215)
T ss_pred             CEEECCCCCCCCCHHHHHHHHHCCCEEEEECCCCCCCCCCCHHHHHHHHHHCCCCHH
T ss_conf             877415988899899999999849969997899984545779999999998599899


No 287
>TIGR01369 CPSaseII_lrg carbamoyl-phosphate synthase, large subunit; InterPro: IPR006275   Carbamoyl phosphate synthase (CPSase) is a heterodimeric enzyme composed of a small and a large subunit (with the exception of CPSase III, see below). CPSase catalyses the synthesis of carbamoyl phosphate from biocarbonate, ATP and glutamine (6.3.5.5 from EC) or ammonia (6.3.4.16 from EC), and represents the first committed step in pyrimidine and arginine biosynthesis in prokaryotes and eukaryotes, and in the urea cycle in most terrestrial vertebrates , . CPSase has three active sites, one in the small subunit and two in the large subunit. The small subunit contains the glutamine binding site and catalyses the hydrolysis of glutamine to glutamate and ammonia. The large subunit has two homologous carboxy phosphate domains, both of which have ATP-binding sites; however, the N-terminal carboxy phosphate domain catalyses the phosphorylation of biocarbonate, while the C-terminal domain catalyses the phosphorylation of the carbamate intermediate . The carboxy phosphate domain found duplicated in the large subunit of CPSase is also present as a single copy in the biotin-dependent enzymes acetyl-CoA carboxylase (6.4.1.2 from EC) (ACC), propionyl-CoA carboxylase (6.4.1.3 from EC) (PCCase), pyruvate carboxylase (6.4.1.1 from EC) (PC) and urea carboxylase (6.3.4.6 from EC).   Most prokaryotes carry one form of CPSase that participates in both arginine and pyrimidine biosynthesis, however certain bacteria can have separate forms. The large subunit in bacterial CPSase has four structural domains: the carboxy phosphate domain 1, the oligomerisation domain, the carbamoyl phosphate domain 2 and the allosteric domain . CPSase heterodimers from Escherichia coli contain two molecular tunnels: an ammonia tunnel and a carbamate tunnel. These inter-domain tunnels connect the three distinct active sites, and function as conduits for the transport of unstable reaction intermediates (ammonia and carbamate) between successive active sites . The catalytic mechanism of CPSase involves the diffusion of carbamate through the interior of the enzyme from the site of synthesis within the N-terminal domain of the large subunit to the site of phosphorylation within the C-terminal domain.   Eukaryotes have two distinct forms of CPSase: a mitochondrial enzyme (CPSase I) that participates in both arginine biosynthesis and the urea cycle; and a cytosolic enzyme (CPSase II) involved in pyrimidine biosynthesis. CPSase II occurs as part of a multi-enzyme complex along with aspartate transcarbamoylase and dihydroorotase; this complex is referred to as the CAD protein . The hepatic expression of CPSase is transcriptionally regulated by glucocorticoids and/or cAMP . There is a third form of the enzyme, CPSase III, found in fish, which uses glutamine as a nitrogen source instead of ammonia . CPSase III is closely related to CPSase I, and is composed of a single polypeptide that may have arisen from gene fusion of the glutaminase and synthetase domains .    This entry represents glutamine-dependent CPSase (6.3.5.5 from EC) from prokaryotes and eukaryotes (CPSase II). ; GO: 0004086 carbamoyl-phosphate synthase activity, 0006807 nitrogen compound metabolic process.
Probab=50.38  E-value=18  Score=16.15  Aligned_cols=88  Identities=11%  Similarity=0.031  Sum_probs=44.8

Q ss_pred             CCCEEEECCCCC-HHHHHHHHCCC-CCEEEEECCC-----CHHHHHCCC--------CCCCHHHHHHHHHHHHHCCCCC-
Q ss_conf             883241025699-99999874157-6069751343-----777732058--------8889899999999999879855-
Q gi|254780485|r  136 GLETCMTLGMLS-FEQAQILSKAG-LDYYNHNIDT-----SERFYPHVT--------TTHTFEDRLQTLENVRKSGIKV-  199 (328)
Q Consensus       136 ~~~i~~~~g~~~-~~~~~~Lk~aG-~~~~~~~let-----~~~~~~~~~--------~~~~~~~~l~~~~~a~~~G~~~-  199 (328)
                      ...+.++.|=-+ -.-.++|.++| +.-+.-..++     .|+.|.+.+        ++....--=++.+-|.+.|+|+ 
T Consensus       649 ~~GVIVq~GGQtp~nlA~~L~~~GG~~iLGTS~~~ID~AEDR~kFs~~l~~Lgi~QP~~~~a~s~eea~~~A~~iGYPvl  728 (1089)
T TIGR01369       649 PEGVIVQFGGQTPLNLAKELEEAGGVPILGTSPESIDRAEDREKFSELLDELGIPQPEWKIATSVEEAKEFASEIGYPVL  728 (1089)
T ss_pred             CCEEEEECCCHHHHHHHHHHHHCCCCEEECCCHHHHHHHCCHHHHHHHHHHCCCCCCCCCEECCHHHHHHHHHHCCCCEE
T ss_conf             66799974873267899999970893173688578751318679999997158798988527287999999854699289


Q ss_pred             --CCEEEECC----CCCHHHHHHHHHHHHH
Q ss_conf             --77078668----9899999999999974
Q gi|254780485|r  200 --CCGGILGL----GEMIDDRIDMLLTLAN  223 (328)
Q Consensus       200 --~sg~l~G~----gEt~eeri~~l~~lr~  223 (328)
                        =|-.|=|-    ....||.-.-|...-+
T Consensus       729 vRPSYVLgG~aM~iv~~~eeL~~yl~~a~~  758 (1089)
T TIGR01369       729 VRPSYVLGGRAMEIVYNEEELARYLEEAVE  758 (1089)
T ss_pred             ECCCCCCCCCCHHEECCHHHHHHHHHHHHH
T ss_conf             816830033621002678899999999997


No 288
>pfam02449 Glyco_hydro_42 Beta-galactosidase. This group of beta-galactosidase enzymes belong to the glycosyl hydrolase 42 family. The enzyme catalyses the hydrolysis of terminal, non-reducing terminal beta-D-galactosidase residues.
Probab=50.18  E-value=18  Score=16.13  Aligned_cols=70  Identities=13%  Similarity=0.077  Sum_probs=30.2

Q ss_pred             CHHHHHHHHHHHHHHC---CCCCCEEEEH---HHHHC-----HHHHH---HHHHHCCCEEEE-------------CCEEE
Q ss_conf             9899999999999968---6872142311---56516-----56899---999809988997-------------78665
Q gi|254780485|r  251 DPIEHVRIISVARILM---PKSRLRLAAG---RAMMS-----DELQA---LCFFSGANSIFV-------------GDTLL  303 (328)
Q Consensus       251 ~~~e~lr~iAi~RL~l---P~~~i~i~~~---~~~~~-----~~~~~---~~L~~GaN~~~~-------------g~~~~  303 (328)
                      ++....-...+.|=+-   |-..+=.|+|   |-..+     ..++.   .++-.|||+++.             ..-++
T Consensus       273 ~~~~~a~~~dl~R~~~~g~pf~vmE~q~g~vnw~~~n~~~~pG~~~l~s~~~vA~GAd~v~yf~Wr~~~~G~E~~h~gll  352 (376)
T pfam02449       273 LPDALAFAHDLYRSLKKGKPFWVMEQSPSPVNWAPYNPAKRPGMMRLWSLQAVAHGADAVCYFQWRQSRGGSEKFHSGVL  352 (376)
T ss_pred             CHHHHHHHHHHHHHCCCCCCEEEEECCCCCCCCCCCCCCCCCCHHHHHHHHHHHCCCCEEEEECCCCCCCCHHHHCEEEC
T ss_conf             88789988999874248997799747898888877889999779999999999663665764206787873031151204


Q ss_pred             CCCC----CCHHHHHHHHHHC
Q ss_conf             1588----8989999999982
Q gi|254780485|r  304 TAKN----PSYNKDTILFNRL  320 (328)
Q Consensus       304 t~~g----~~~~~~~~~i~~~  320 (328)
                      .-+|    +...|..++.+++
T Consensus       353 ~hdg~~~~r~~~Ev~~~g~el  373 (376)
T pfam02449       353 DHDGREDTRVFREVAEVGEEL  373 (376)
T ss_pred             CCCCCCCCCHHHHHHHHHHHH
T ss_conf             879999862599999999999


No 289
>TIGR02153 gatD_arch glutamyl-tRNA(Gln) amidotransferase, subunit D; InterPro: IPR011878    This peptide is found only in the Archaea. It is part of a heterodimer, with GatD (IPR004414 from INTERPRO), that acts as an amidotransferase on misacylated Glu-tRNA(Gln) to produce Gln-tRNA(Gln). The analogous amidotransferase found in bacteria is the GatABC system, although GatABC homologs in the Archaea appear to act instead on Asp-tRNA(Asn) .; GO: 0006450 regulation of translational fidelity.
Probab=50.17  E-value=14  Score=16.76  Aligned_cols=42  Identities=21%  Similarity=0.226  Sum_probs=25.4

Q ss_pred             CCCCCHHHHHHHHHHHHHCCCCCCCEEEE---CCCCCHHHHHHHHHHHHHCC
Q ss_conf             88889899999999999879855770786---68989999999999997408
Q gi|254780485|r  177 TTTHTFEDRLQTLENVRKSGIKVCCGGIL---GLGEMIDDRIDMLLTLANLS  225 (328)
Q Consensus       177 ~~~~~~~~~l~~~~~a~~~G~~~~sg~l~---G~gEt~eeri~~l~~lr~l~  225 (328)
                      .|+.+.    ++++...+-|++-   +++   |+|...++.++++.+..+-+
T Consensus       293 yPG~~p----~il~~~~d~GykG---iViEGTGLGHvs~~~ip~i~ra~d~G  337 (413)
T TIGR02153       293 YPGLDP----EILEFLVDKGYKG---IVIEGTGLGHVSEDWIPSIKRATDDG  337 (413)
T ss_pred             CCCCCH----HHHHHHHCCCCEE---EEEECCCCCCCHHHHHHHHHHHHHCC
T ss_conf             389888----8999985187159---99833787555235899999987589


No 290
>COG0034 PurF Glutamine phosphoribosylpyrophosphate amidotransferase [Nucleotide transport and metabolism]
Probab=49.16  E-value=19  Score=16.03  Aligned_cols=31  Identities=13%  Similarity=0.358  Sum_probs=16.1

Q ss_pred             HHCCCEEEECCEEECCCCCCHHHHHHHHHHCCC
Q ss_conf             809988997786651588898999999998298
Q gi|254780485|r  290 FSGANSIFVGDTLLTAKNPSYNKDTILFNRLGL  322 (328)
Q Consensus       290 ~~GaN~~~~g~~~~t~~g~~~~~~~~~i~~~G~  322 (328)
                      -.|-+.+++.|.+  .+|.+-.++++|+|++|=
T Consensus       346 v~GKrVvlVDDSI--VRGTTsr~IV~mlReAGA  376 (470)
T COG0034         346 VKGKRVVLVDDSI--VRGTTSRRIVQMLREAGA  376 (470)
T ss_pred             HCCCEEEEECCCC--CCCCCHHHHHHHHHHHCC
T ss_conf             5897699972651--457669999999997188


No 291
>COG0422 ThiC Thiamine biosynthesis protein ThiC [Coenzyme metabolism]
Probab=49.15  E-value=19  Score=16.03  Aligned_cols=74  Identities=16%  Similarity=0.204  Sum_probs=42.4

Q ss_pred             HHHHHHHHCCCCCCCEEEECCCCCHHHHHH-HHHHHHHCCCCCCEEECCCEEECC----------------------C--
Q ss_conf             999999987985577078668989999999-999997408888602054112048----------------------7--
Q gi|254780485|r  187 QTLENVRKSGIKVCCGGILGLGEMIDDRID-MLLTLANLSTPPESIPINLLIPIP----------------------G--  241 (328)
Q Consensus       187 ~~~~~a~~~G~~~~sg~l~G~gEt~eeri~-~l~~lr~l~~~~~~v~~~~~~p~~----------------------g--  241 (328)
                      +..+.|.+.|.++   |+=|.|.-+-+-++ ++..-+++-   ++.|+..+-|.+                      |  
T Consensus       248 eL~krA~~~gVQv---mVEGPGHvpl~~I~~nv~l~k~~c---~~aPfYvLGPLvTDIApGYDHItsAIGaA~aa~~Gad  321 (432)
T COG0422         248 ELTKRAWEAGVQV---MVEGPGHVPLNEIEANVKLQKELC---DGAPFYVLGPLVTDIAPGYDHITSAIGAAMAAWAGAD  321 (432)
T ss_pred             HHHHHHHHCCCEE---EEECCCCCCHHHHHHHHHHHHHHC---CCCCEEEECCCCCCCCCCCHHHHHHHHHHHHHHCCCC
T ss_conf             9999999859879---997898673999999899999851---7997155577433557770378888889998764786


Q ss_pred             -----CCCCCCCCCCHHHHHHHHHHHHHHC
Q ss_conf             -----4124456879899999999999968
Q gi|254780485|r  242 -----SKFEENKKVDPIEHVRIISVARILM  266 (328)
Q Consensus       242 -----t~l~~~~~~~~~e~lr~iAi~RL~l  266 (328)
                           ||-++..-|+.++.-.=+-.+||.-
T Consensus       322 ~LCYVTPaEHL~LP~~eDV~eGvIa~kIAA  351 (432)
T COG0422         322 MLCYVTPAEHLGLPNVEDVKEGVIAYKIAA  351 (432)
T ss_pred             EEEECCCHHHCCCCCHHHHHHHHHHHHHHH
T ss_conf             588438389739998899988899999999


No 292
>pfam01207 Dus Dihydrouridine synthase (Dus). Members of this family catalyse the reduction of the 5,6-double bond of a uridine residue on tRNA. Dihydrouridine modification of tRNA is widely observed in prokaryotes and eukaryotes, and also in some archae. Most dihydrouridines are found in the D loop of t-RNAs. The role of dihydrouridine in tRNA is currently unknown, but may increase conformational flexibility of the tRNA. It is likely that different family members have different substrate specificities, which may overlap. Dus 1 from Saccharomyces cerevisiae acts on pre-tRNA-Phe, while Dus 2 acts on pre-tRNA-Tyr and pre-tRNA-Leu. Dus 1 is active as a single subunit, requiring NADPH or NADH, and is stimulated by the presence of FAD. Some family members may be targeted to the mitochondria and even have a role in mitochondria.
Probab=48.90  E-value=19  Score=16.00  Aligned_cols=166  Identities=13%  Similarity=0.095  Sum_probs=82.6

Q ss_pred             HHCCCCEEEEEEEEEECCCCCCCC---CCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCEEEEEECCC-------
Q ss_conf             862898569998645307868342---3212433547775641000685799999999996498389973036-------
Q gi|254780485|r   45 KNFEPNHIQLSKLLNIKTGGCPEN---CGYCNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAW-------  114 (328)
Q Consensus        45 ~~~~g~~V~~~~~in~~TN~C~~~---C~fCaf~~~~~~~~~~~~~~~~Eei~~~a~~~~~~G~~~~~l~~~~-------  114 (328)
                      +++.+..+++.--++. ..++..+   -.++.+....+-...--.-.++|.+.+.|+.+.+.|+..+-|-.|=       
T Consensus        18 ~~~g~~~l~~TEmv~a-~~l~~~~~~~~~~~~~~~~e~P~~~Ql~G~dp~~~~~aa~~~~~~g~d~IDlN~GCP~~~v~~   96 (309)
T pfam01207        18 REYGAGDLVVTEMVTA-KAQLRPEKQRELMLPELEEPTPLAVQLGGSDPALLAEAAKLVADLGADIIDINMGCPAKKVTR   96 (309)
T ss_pred             HHHCCCCEEEECCEEE-HHHHCCCHHHHHHCCCCCCCCCEEEEEECCCHHHHHHHHHHHHHCCCCEEEEECCCCHHHHCC
T ss_conf             9979592999798997-135438875887420076789728999369999999999998863999896518999999878


Q ss_pred             ---CCCCCCCHHHHHHHHHHHCC-CCCCEEE--ECCCC-C----HHHHHHHHCCCCCEEEEECCCCHHHHHCCCCCCCHH
Q ss_conf             ---88874428999998876213-6883241--02569-9----999998741576069751343777732058888989
Q gi|254780485|r  115 ---REPKERDLSIIVDMIKGVKS-LGLETCM--TLGML-S----FEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFE  183 (328)
Q Consensus       115 ---~~~~~~~~~~~~e~i~~i~~-~~~~i~~--~~g~~-~----~~~~~~Lk~aG~~~~~~~let~~~~~~~~~~~~~~~  183 (328)
                         +.-...+.+.+.++++.+++ .+..+.+  -+|.- +    .+-.+.+.++|++.+.+---|..+.|.   +..+|+
T Consensus        97 ~g~GsaLl~~p~~~~~iv~a~~~~~~~PVtvK~RlG~d~~~~~~~~~~~~l~~~G~~~itvH~Rt~~q~~~---g~a~w~  173 (309)
T pfam01207        97 GGAGAALLRDPDLVAQIVKAVVKAVDIPVTVKIRIGWDESHENAVEIARRVEDAGAQALTVHGRTRAQNYE---GPADWD  173 (309)
T ss_pred             CCCCEEHHHCHHHHHHHHHHHHHHCCCCEEEEEECCCCCCHHHHHHHHHHHHHCCCCEEEEECCCHHHCCC---CCCCHH
T ss_conf             99776254177899999999997558854675433788763889999999984688879996763240267---865418


Q ss_pred             HHHHHHHHHHHCCCCCCCEEEECCCCCHHHHHHHHHH
Q ss_conf             9999999999879855770786689899999999999
Q gi|254780485|r  184 DRLQTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLT  220 (328)
Q Consensus       184 ~~l~~~~~a~~~G~~~~sg~l~G~gEt~eeri~~l~~  220 (328)
                      .--+ +  .....+++.   .=|=.-+.+|..+++..
T Consensus       174 ~i~~-~--k~~~~ipvi---~NGdi~~~~d~~~~l~~  204 (309)
T pfam01207       174 AIKQ-V--KQAVSIPVI---ANGDITDAEDAQRCLSY  204 (309)
T ss_pred             HHHH-H--HHHCCCCEE---EECCCCCHHHHHHHHHH
T ss_conf             9999-9--985898289---80894889999999861


No 293
>pfam10758 DUF2586 Protein of unknown function (DUF2586). This bacterial family of proteins has no known function.
Probab=48.86  E-value=12  Score=17.29  Aligned_cols=99  Identities=29%  Similarity=0.424  Sum_probs=53.3

Q ss_pred             CCCCCCCEEEECCCCCHHHHHH---HHHHHHHCCCCCCEEECCCEEE-CCCCCCCCCCCCC-----------------HH
Q ss_conf             7985577078668989999999---9999974088886020541120-4874124456879-----------------89
Q gi|254780485|r  195 SGIKVCCGGILGLGEMIDDRID---MLLTLANLSTPPESIPINLLIP-IPGSKFEENKKVD-----------------PI  253 (328)
Q Consensus       195 ~G~~~~sg~l~G~gEt~eeri~---~l~~lr~l~~~~~~v~~~~~~p-~~gt~l~~~~~~~-----------------~~  253 (328)
                      .-+++-+|-++|+|+.+.|-..   .+.+|+.|+....+||  -|.| .+|..-.+-..+.                 ..
T Consensus       194 SPmRV~TGal~glg~~P~D~~g~~l~lAtl~aL~~~R~SVP--~wYpDYdG~YW~DG~tLDv~GGDyQ~IEnlRvvdKaa  271 (363)
T pfam10758       194 SPMRVATGALLGLGELPVDKDGKPLTLATLAALDAARYSVP--QWYPDYDGVYWGDGNTLDAEGGDYQVIENLRVVDKAA  271 (363)
T ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCC--CCCCCCCCCEECCCCEEECCCCCHHEEEHHHHHHHHH
T ss_conf             85310135530377788488988753899999986374665--2348999755047816505887502011227788898


Q ss_pred             HHHHHHHHHHHHCCCC---CCEEEEHHHHHCHHHHHHHHHHCCCE
Q ss_conf             9999999999968687---21423115651656899999809988
Q gi|254780485|r  254 EHVRIISVARILMPKS---RLRLAAGRAMMSDELQALCFFSGANS  295 (328)
Q Consensus       254 e~lr~iAi~RL~lP~~---~i~i~~~~~~~~~~~~~~~L~~GaN~  295 (328)
                      ...|++||.||.--..   .-.|.+..--.++.++.++-..-.|+
T Consensus       272 RrVRi~AI~rIadR~lNSTP~Siaa~~~yF~rpLReMskS~~i~G  316 (363)
T pfam10758       272 RRVRILAIARIADRSLNSTPSSIAAHKTYFMRPLREMSKSTTING  316 (363)
T ss_pred             HHHHHHHHHHHHCCCCCCCHHHHHHHHHHHCCHHHHHHHHEEECC
T ss_conf             899999999874165678858899999885526887653304777


No 294
>COG2200 Rtn c-di-GMP phosphodiesterase class I (EAL domain) [Signal    transduction mechanisms]
Probab=48.72  E-value=19  Score=15.98  Aligned_cols=175  Identities=14%  Similarity=0.116  Sum_probs=98.6

Q ss_pred             CCCCHHHHHHHHCCC-H-HH----HHHHHHHHHHHHCCCCEEEEEEEEEEC-CCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             478999999997399-1-89----999999998886289856999864530-7868342321243354777564100068
Q gi|254780485|r   17 KVWTSKEVFQIYNMP-F-ND----LLFWSHTVHRKNFEPNHIQLSKLLNIK-TGGCPENCGYCNQSVHNKSKLKASKLIN   89 (328)
Q Consensus        17 e~ls~eea~~L~~~~-~-~e----l~~~Aa~~~r~~~~g~~V~~~~~in~~-TN~C~~~C~fCaf~~~~~~~~~~~~~~~   89 (328)
                      ..+|..+.+.+.+.. + .+    .+..|.+..+ .+..+. .+..-+|+. +...  ++.|.                 
T Consensus        47 g~i~p~~Fi~~ae~~gli~~l~~~v~~~a~~~~~-~~~~~~-~~~l~iNis~~~l~--~~~~~-----------------  105 (256)
T COG2200          47 GLISPGEFIPLAEETGLIVELGRWVLEEACRQLR-TWPRAG-PLRLAVNLSPVQLR--SPGLV-----------------  105 (256)
T ss_pred             CCCCHHHHHHHHHHCCCHHHHHHHHHHHHHHHHH-HCCCCC-CEEEEEECCHHHHC--CCHHH-----------------
T ss_conf             8679899999998849899999999999999998-532138-80799984888828--65699-----------------


Q ss_pred             HHHHHHHHHHHHHCCCEEEEEECCCCCCCCCCHHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHCCCCCEEEEECCCC
Q ss_conf             57999999999964983899730368887442899999887621368832410256999999987415760697513437
Q gi|254780485|r   90 VDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTS  169 (328)
Q Consensus        90 ~Eei~~~a~~~~~~G~~~~~l~~~~~~~~~~~~~~~~e~i~~i~~~~~~i~~~~g~~~~~~~~~Lk~aG~~~~~~~let~  169 (328)
                       +.+.+..+. ...-..++.+-..... .....+.....++.+++.+..+.+.-+=.....+..|++..+|.+.+    .
T Consensus       106 -~~l~~~l~~-~~~~~~~l~~EitE~~-~~~~~~~~~~~l~~Lr~~G~~ialDDFGtG~ssl~~L~~l~~d~iKI----D  178 (256)
T COG2200         106 -DLLLRLLAR-LGLPPHRLVLEITESA-LIDDLDTALALLRQLRELGVRIALDDFGTGYSSLSYLKRLPPDILKI----D  178 (256)
T ss_pred             -HHHHHHHHH-CCCCCCEEEEEECCCH-HHCCHHHHHHHHHHHHHCCCCEEEECCCCCHHHHHHHHHCCCCEEEE----C
T ss_conf             -999999997-3999120799974871-22498999999999997799899978999716599998579974999----6


Q ss_pred             HHHHHCCCCCCCHHHHHH-HHHHHHHCCCCCCCEEEECCCCCHHHHHHHHHHHHHCCCC
Q ss_conf             777320588889899999-9999998798557707866898999999999999740888
Q gi|254780485|r  170 ERFYPHVTTTHTFEDRLQ-TLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTP  227 (328)
Q Consensus       170 ~~~~~~~~~~~~~~~~l~-~~~~a~~~G~~~~sg~l~G~gEt~eeri~~l~~lr~l~~~  227 (328)
                      +.+...+........-++ .+..||++|+.+.+    --+||.+    .+..|++++..
T Consensus       179 ~~fv~~i~~~~~~~~iv~~iv~la~~l~~~vva----EGVEt~~----ql~~L~~~G~~  229 (256)
T COG2200         179 RSFVRDLETDARDQAIVRAIVALAHKLGLTVVA----EGVETEE----QLDLLRELGCD  229 (256)
T ss_pred             HHHHHHHCCCCHHHHHHHHHHHHHHHCCCEEEE----EECCCHH----HHHHHHHCCCC
T ss_conf             999986303831179999999999974998999----7069699----99999977999


No 295
>cd03313 enolase Enolase: Enolases are homodimeric enzymes that catalyse the reversible dehydration of 2-phospho-D-glycerate to phosphoenolpyruvate as part of the glycolytic and gluconeogenesis pathways. The reaction is facilitated by the presence of metal ions.
Probab=48.37  E-value=19  Score=15.95  Aligned_cols=53  Identities=17%  Similarity=0.089  Sum_probs=32.1

Q ss_pred             CCCCCCHHHHHHHHHHHHHHCCCCCCEEEE-HHHHHCHHHHHHHHHHCCCEEEECC
Q ss_conf             456879899999999999968687214231-1565165689999980998899778
Q gi|254780485|r  246 ENKKVDPIEHVRIISVARILMPKSRLRLAA-GRAMMSDELQALCFFSGANSIFVGD  300 (328)
Q Consensus       246 ~~~~~~~~e~lr~iAi~RL~lP~~~i~i~~-~~~~~~~~~~~~~L~~GaN~~~~g~  300 (328)
                      .....|..|.+..+.+++=.-=  ...+|. +=||...-...++.-.||--|-+|.
T Consensus       336 ~NQiGTvset~ea~~la~~~g~--~~ivShRSGETeD~~IaDLAVg~ga~~iK~G~  389 (408)
T cd03313         336 VNQIGTLTETIEAIKLAKKNGY--GVVVSHRSGETEDTFIADLAVALGAGQIKTGA  389 (408)
T ss_pred             CCCCCCHHHHHHHHHHHHHCCC--EEEEECCCCCCCCCHHHHHHHHCCCCCEECCC
T ss_conf             5457729999999999998698--79997899886501799989870898002589


No 296
>COG0159 TrpA Tryptophan synthase alpha chain [Amino acid transport and metabolism]
Probab=48.15  E-value=19  Score=15.93  Aligned_cols=201  Identities=17%  Similarity=0.161  Sum_probs=111.3

Q ss_pred             CCHHHHHHHHHHHHHCCCEEEEEECCCCCCCC-----------------CCHHHHHHHHHHHCCCCCC---EEEE---C-
Q ss_conf             68579999999999649838997303688874-----------------4289999988762136883---2410---2-
Q gi|254780485|r   88 INVDQVLKEAKNAKENGATRYCMGAAWREPKE-----------------RDLSIIVDMIKGVKSLGLE---TCMT---L-  143 (328)
Q Consensus        88 ~~~Eei~~~a~~~~~~G~~~~~l~~~~~~~~~-----------------~~~~~~~e~i~~i~~~~~~---i~~~---~-  143 (328)
                      -+.|..++.++.+.+.|+.-+-++ -...++.                 ...+..+++++.+++.+..   +.+.   + 
T Consensus        28 P~~e~s~e~i~~L~~~GaD~iELG-vPfSDPvADGP~Iq~A~~rAL~~g~t~~~~lel~~~~r~~~~~~Pivlm~Y~Npi  106 (265)
T COG0159          28 PDLETSLEIIKTLVEAGADILELG-VPFSDPVADGPTIQAAHLRALAAGVTLEDTLELVEEIRAKGVKVPIVLMTYYNPI  106 (265)
T ss_pred             CCHHHHHHHHHHHHHCCCCEEEEC-CCCCCCCCCCHHHHHHHHHHHHCCCCHHHHHHHHHHHHHCCCCCCEEEEEECCHH
T ss_conf             998999999999986798889966-8888867668899998999997799889999999999861899988998701188


Q ss_pred             CCCC-HHHHHHHHCCCCCEEEEECCCCHHHHHCCCCCCCHHHHHHHHHHHHHCCCCCCCEEEECCCCCHHHHHHHHHHHH
Q ss_conf             5699-999998741576069751343777732058888989999999999987985577078668989999999999997
Q gi|254780485|r  144 GMLS-FEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLA  222 (328)
Q Consensus       144 g~~~-~~~~~~Lk~aG~~~~~~~let~~~~~~~~~~~~~~~~~l~~~~~a~~~G~~~~sg~l~G~gEt~eeri~~l~~lr  222 (328)
                      .-.. +.-+++.+++|++.+.+             +.-..++.-+..+.+.+.|+..   +.+--.-|..+|++-+....
T Consensus       107 ~~~Gie~F~~~~~~~GvdGliv-------------pDLP~ee~~~~~~~~~~~gi~~---I~lvaPtt~~~rl~~i~~~a  170 (265)
T COG0159         107 FNYGIEKFLRRAKEAGVDGLLV-------------PDLPPEESDELLKAAEKHGIDP---IFLVAPTTPDERLKKIAEAA  170 (265)
T ss_pred             HHHHHHHHHHHHHHCCCCEEEE-------------CCCCHHHHHHHHHHHHHCCCCE---EEEECCCCCHHHHHHHHHHC
T ss_conf             7735999999999759987985-------------7898667778999999769867---98869999989999999747


Q ss_pred             HCCCCCCEEECCCEEECCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCEEEEHHHHHCHHHHHHHHHHCCCEEEECCEE
Q ss_conf             40888860205411204874124456879899999999999968687214231156516568999998099889977866
Q gi|254780485|r  223 NLSTPPESIPINLLIPIPGSKFEENKKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTL  302 (328)
Q Consensus       223 ~l~~~~~~v~~~~~~p~~gt~l~~~~~~~~~e~lr~iAi~RL~lP~~~i~i~~~~~~~~~~~~~~~L~~GaN~~~~g~~~  302 (328)
                      +     .++-   +....|+.-...+ .+ ...-+.+.-.|=+-   .+++..|..--.++.......+ ||++++|.-+
T Consensus       171 ~-----GFiY---~vs~~GvTG~~~~-~~-~~~~~~v~~vr~~~---~~Pv~vGFGIs~~e~~~~v~~~-ADGVIVGSAi  236 (265)
T COG0159         171 S-----GFIY---YVSRMGVTGARNP-VS-ADVKELVKRVRKYT---DVPVLVGFGISSPEQAAQVAEA-ADGVIVGSAI  236 (265)
T ss_pred             C-----CCEE---EEECCCCCCCCCC-CC-HHHHHHHHHHHHHC---CCCEEEECCCCCHHHHHHHHHH-CCEEEECHHH
T ss_conf             9-----8589---9966666677765-30-46999999999744---8973874486999999999976-8857973999


Q ss_pred             EC--CCC---CCHHHHHHHHHH
Q ss_conf             51--588---898999999998
Q gi|254780485|r  303 LT--AKN---PSYNKDTILFNR  319 (328)
Q Consensus       303 ~t--~~g---~~~~~~~~~i~~  319 (328)
                      +.  ..+   ...++..+++++
T Consensus       237 V~~i~~~~~~~~~~~~~~l~~~  258 (265)
T COG0159         237 VKIIEEGLDEEALEELRALVKE  258 (265)
T ss_pred             HHHHHHCCCHHHHHHHHHHHHH
T ss_conf             9999955514469999999999


No 297
>PRK05096 guanosine 5'-monophosphate oxidoreductase; Provisional
Probab=47.81  E-value=19  Score=15.89  Aligned_cols=45  Identities=16%  Similarity=0.194  Sum_probs=22.9

Q ss_pred             HHHHHHHHHHCCCCCCEEEECC-CCCHHHHHHHHCCCCCEEEEECC
Q ss_conf             9999988762136883241025-69999999874157606975134
Q gi|254780485|r  123 SIIVDMIKGVKSLGLETCMTLG-MLSFEQAQILSKAGLDYYNHNID  167 (328)
Q Consensus       123 ~~~~e~i~~i~~~~~~i~~~~g-~~~~~~~~~Lk~aG~~~~~~~le  167 (328)
                      +.+.+.++.+|+..+...+-+| ..+.+.++.|.++|+|.+.+.+.
T Consensus       136 ~~~~~~i~~ik~~~~~~~iiaGNvaT~e~~~~L~~~GaD~vkVGIG  181 (347)
T PRK05096        136 EHFVQFVAKAREAWPDKTICAGNVVTGEMVEELILSGADIVKVGIG  181 (347)
T ss_pred             HHHHHHHHHHHHHCCCCEEECCCHHHHHHHHHHHHCCCCEEEECCC
T ss_conf             8899999999987899808814312399999999737889997677


No 298
>PRK13132 consensus
Probab=47.71  E-value=20  Score=15.88  Aligned_cols=202  Identities=12%  Similarity=0.142  Sum_probs=111.5

Q ss_pred             CCHHHHHHHHHHHHHCCCEEEEEECCCCCCC-CC---------------CHHHHHHHHHHHCCCCCCEEEE---C-CCCC
Q ss_conf             6857999999999964983899730368887-44---------------2899999887621368832410---2-5699
Q gi|254780485|r   88 INVDQVLKEAKNAKENGATRYCMGAAWREPK-ER---------------DLSIIVDMIKGVKSLGLETCMT---L-GMLS  147 (328)
Q Consensus        88 ~~~Eei~~~a~~~~~~G~~~~~l~~~~~~~~-~~---------------~~~~~~e~i~~i~~~~~~i~~~---~-g~~~  147 (328)
                      -+.|.-++.++.+.+.|+.-+-++--.-+|. +.               .++.+.++++.++...+.+.++   . ....
T Consensus        22 P~~e~s~~~~~~l~~~GaDiiEiGiPfSDP~aDGPvIq~A~~~AL~~G~~~~~~~~~~~~ir~~~pivlM~Y~N~i~~~G  101 (246)
T PRK13132         22 PNLETTKEFLQRLDESPLDILELGIPYSDPLADGKLIADASFIALQQGVNTDTVFELLARVKTKKALVFLVYYNLIFAYG  101 (246)
T ss_pred             CCHHHHHHHHHHHHHCCCCEEEECCCCCCCCCCCHHHHHHHHHHHHCCCCHHHHHHHHHHHCCCCCEEEEEECHHHHHCC
T ss_conf             99899999999999749998997898888765589999999999877998999999999753699979996010887729


Q ss_pred             -HHHHHHHHCCCCCEEEEECCCCHHHHHCCCCCCCHHHHHHHHHHHHHCCCCCCCEEEECCCCCHHHHHHHHHHHHHCCC
Q ss_conf             -9999987415760697513437777320588889899999999999879855770786689899999999999974088
Q gi|254780485|r  148 -FEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLST  226 (328)
Q Consensus       148 -~~~~~~Lk~aG~~~~~~~let~~~~~~~~~~~~~~~~~l~~~~~a~~~G~~~~sg~l~G~gEt~eeri~~l~~lr~l~~  226 (328)
                       +.-+++++++|++.+.+             |.-.+++--+..+.+.+.|+..-  .++-.  |-.+|+..+..  . . 
T Consensus       102 ~e~F~~~~~~~GvdGlIi-------------pDLP~ee~~~~~~~~~~~~i~~I--~lvaP--Ts~~R~~~i~~--~-s-  160 (246)
T PRK13132        102 LEKFVKKAKELGISGLIV-------------PDLPFEESEELIKECEKYNIALI--PLISV--TSPKRAKKILK--H-A-  160 (246)
T ss_pred             HHHHHHHHHHCCCCEEEC-------------CCCCHHHHHHHHHHHHHCCCCEE--EEECC--CCHHHHHHHHH--C-C-
T ss_conf             999999998769985775-------------79997898999999998599701--44257--97899999995--4-8-


Q ss_pred             CCCEEECCCEEECCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCEEEEHHHHHCHHHHHHHHHHCCCEEEECCEEEC-C
Q ss_conf             886020541120487412445687989999999999996868721423115651656899999809988997786651-5
Q gi|254780485|r  227 PPESIPINLLIPIPGSKFEENKKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLT-A  305 (328)
Q Consensus       227 ~~~~v~~~~~~p~~gt~l~~~~~~~~~e~lr~iAi~RL~lP~~~i~i~~~~~~~~~~~~~~~L~~GaN~~~~g~~~~t-~  305 (328)
                       ..++-   .+...|+.-..  .....+....+.-.|-+-   .+++..|-.--.++..+ .+..+||++++|..++. -
T Consensus       161 -~gfiY---~vs~~GvTG~~--~~~~~~~~~~i~~ik~~t---~~Pv~vGFGI~~~e~v~-~~~~~aDGvIVGSa~v~~i  230 (246)
T PRK13132        161 -KGFIY---ALGSIGVTGTK--SVEEARLKDKVKEIKSFT---DLPVAVGFGIKNNQDVK-RMRKYADGVIVGTSIVKLF  230 (246)
T ss_pred             -CCCEE---EEECCCCCCCC--CCCHHHHHHHHHHHHHCC---CCCEEEECCCCCHHHHH-HHHHCCCEEEECHHHHHHH
T ss_conf             -98279---97535677776--663688999999999628---99869977989999999-9982299999709999999


Q ss_pred             CCCCHHHHHHHHHHC
Q ss_conf             888989999999982
Q gi|254780485|r  306 KNPSYNKDTILFNRL  320 (328)
Q Consensus       306 ~g~~~~~~~~~i~~~  320 (328)
                      ...+.++..+.|+++
T Consensus       231 ~~~~~~~~~k~i~el  245 (246)
T PRK13132        231 KKFSLDEIMKDIEEI  245 (246)
T ss_pred             HHCCHHHHHHHHHHH
T ss_conf             872968899999964


No 299
>TIGR02390 RNA_pol_rpoA1 DNA-directed RNA polymerase subunit A'; InterPro: IPR012758   DNA-directed RNA polymerases 2.7.7.6 from EC (also known as DNA-dependent RNA polymerases) are responsible for the polymerisation of ribonucleotides into a sequence complementary to the template DNA. In eukaryotes, there are three different forms of DNA-directed RNA polymerases transcribing different sets of genes. Most RNA polymerases are multimeric enzymes and are composed of a variable number of subunits. The core RNA polymerase complex consists of five subunits (two alpha, one beta, one beta-prime and one omega) and is sufficient for transcription elongation and termination but is unable to initiate transcription. Transcription initiation from promoter elements requires a sixth, dissociable subunit called a sigma factor, which reversibly associates with the core RNA polymerase complex to form a holoenzyme . The core RNA polymerase complex forms a "crab claw"-like structure with an internal channel running along the full length . The key functional sites of the enzyme, as defined by mutational and cross-linking analysis, are located on the inner wall of this channel.   RNA synthesis follows after the attachment of RNA polymerase to a specific site, the promoter, on the template DNA strand. The RNA synthesis process continues until a termination sequence is reached. The RNA product, which is synthesised in the 5' to 3'direction, is known as the primary transcript. Eukaryotic nuclei contain three distinct types of RNA polymerases that differ in the RNA they synthesise:  RNA polymerase I: located in the nucleoli, synthesises precursors of most ribosomal RNAs. RNA polymerase II: occurs in the nucleoplasm, synthesises mRNA precursors.  RNA polymerase III: also occurs in the nucleoplasm, synthesises the precursors of 5S ribosomal RNA, the tRNAs, and a variety of other small nuclear and cytosolic RNAs.  Eukaryotic cells are also known to contain separate mitochondrial and chloroplast RNA polymerases. Eukaryotic RNA polymerases, whose molecular masses vary in size from 500 to 700 kD, contain two non-identical large (>100 kDa) subunits and an array of up to 12 different small (less than 50 kDa) subunits.    This family consists of the archaeal A' subunit of the DNA-directed RNA polymerase. The example from Methanococcus jannaschii contains an intein.; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0008270 zinc ion binding, 0006350 transcription.
Probab=47.59  E-value=10  Score=17.81  Aligned_cols=63  Identities=21%  Similarity=0.361  Sum_probs=33.8

Q ss_pred             CCCCCCCHHHHHHHHC-CCH----HHH--HHHHHHHHHHHCCCCEEE---EEEEEEE--CCCCCCCCCCCCCCCC
Q ss_conf             2344789999999973-991----899--999999988862898569---9986453--0786834232124335
Q gi|254780485|r   14 KKPKVWTSKEVFQIYN-MPF----NDL--LFWSHTVHRKNFEPNHIQ---LSKLLNI--KTGGCPENCGYCNQSV   76 (328)
Q Consensus        14 ~~~e~ls~eea~~L~~-~~~----~el--~~~Aa~~~r~~~~g~~V~---~~~~in~--~TN~C~~~C~fCaf~~   76 (328)
                      .+...+|++|+..|+. +..    .+.  .-..-..-|..+.|+.++   +=-.+|+  .|++|.-.|.-|.+..
T Consensus       533 ~k~~~~t~~ev~~iL~~~~~~~~~~~~~~ie~~~~eGrdywTGK~ifS~~LP~dLn~~~~a~~~~G~c~~C~~e~  607 (901)
T TIGR02390       533 VKSTLFTKEEVVTILKKAGLKGEPEEPKAIEKPKEEGRDYWTGKQIFSAFLPEDLNFEFRAKVCSGKCEACKKEE  607 (901)
T ss_pred             HCCCCCCHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHCCCCCCEEEECCCCCCCCCCCCCCC
T ss_conf             047776889999999860767787666633177866753221035554207887772140136788500100367


No 300
>TIGR01430 aden_deam adenosine deaminase; InterPro: IPR006330    This family includes the experimentally verified adenosine deaminases of mammals and Escherichia coli. Other members of this family are predicted also to be adenosine deaminase, an enzyme of nucleotide degradation. This family is distantly related to AMP deaminase. ; GO: 0004000 adenosine deaminase activity, 0009168 purine ribonucleoside monophosphate biosynthetic process.
Probab=47.23  E-value=20  Score=15.83  Aligned_cols=91  Identities=15%  Similarity=0.210  Sum_probs=41.6

Q ss_pred             HHHHHHHHHHHH--HCCCCCCCEEEEC-CCC-CHHHHHHHHHHHHHCCC--CCCEEECCCEEECCCCCCCCCCCCCHHHH
Q ss_conf             899999999999--8798557707866-898-99999999999974088--88602054112048741244568798999
Q gi|254780485|r  182 FEDRLQTLENVR--KSGIKVCCGGILG-LGE-MIDDRIDMLLTLANLST--PPESIPINLLIPIPGSKFEENKKVDPIEH  255 (328)
Q Consensus       182 ~~~~l~~~~~a~--~~G~~~~sg~l~G-~gE-t~eeri~~l~~lr~l~~--~~~~v~~~~~~p~~gt~l~~~~~~~~~e~  255 (328)
                      ..+.+++.+.|+  ++|+++|++  -| |.+ +++..-+-   |.+|+.  ..|||                ......++
T Consensus       186 ~~~F~~~f~~Arsl~~Gl~~T~H--AGlhE~~g~~~v~~A---ld~l~~~RIgHG~----------------~~~eDp~L  244 (346)
T TIGR01430       186 PEKFVRAFAIARSLELGLKLTVH--AGLHELGGPESVREA---LDDLGATRIGHGV----------------RALEDPEL  244 (346)
T ss_pred             HHHHHHHHHHHHHHHCCCCEEEE--CCCCCCCCHHHHHHH---HHHCCCCCCCCCC----------------CCCCCHHH
T ss_conf             77899999998765169835630--375345774679999---9853885100240----------------00148789


Q ss_pred             HHH-HHHHHHHC---CCCCCEEEEHHHHHCHHHHHHHHHHCCC
Q ss_conf             999-99999968---6872142311565165689999980998
Q gi|254780485|r  256 VRI-ISVARILM---PKSRLRLAAGRAMMSDELQALCFFSGAN  294 (328)
Q Consensus       256 lr~-iAi~RL~l---P~~~i~i~~~~~~~~~~~~~~~L~~GaN  294 (328)
                      ++- ++--++++   |-.++.+++ |.+...-==+.-+..|.+
T Consensus       245 ~~rlL~~~~i~le~CP~SN~~l~~-v~~~~~~Pl~~f~~~G~~  286 (346)
T TIGR01430       245 LKRLLAEEQITLEVCPLSNLALGV-VKSLAEHPLKRFLEAGVK  286 (346)
T ss_pred             HHHHHHHCCCEEEECCHHHHHCCC-CCCCCCHHHHHHHHCCCC
T ss_conf             999998679558875211111013-588652378998865685


No 301
>pfam01729 QRPTase_C Quinolinate phosphoribosyl transferase, C-terminal domain. Quinolinate phosphoribosyl transferase (QPRTase) or nicotinate-nucleotide pyrophosphorylase EC:2.4.2.19 is involved in the de novo synthesis of NAD in both prokaryotes and eukaryotes. It catalyses the reaction of quinolinic acid with 5-phosphoribosyl-1-pyrophosphate (PRPP) in the presence of Mg2+ to give rise to nicotinic acid mononucleotide (NaMN), pyrophosphate and carbon dioxide. The QA substrate is bound between the C-terminal domain of one subunit, and the N-terminal domain of the other. The C-terminal domain has a 7 beta-stranded TIM barrel-like fold.
Probab=46.88  E-value=20  Score=15.80  Aligned_cols=16  Identities=25%  Similarity=0.314  Sum_probs=7.9

Q ss_pred             CHHHHHHHHCCCCCEE
Q ss_conf             9999998741576069
Q gi|254780485|r  147 SFEQAQILSKAGLDYY  162 (328)
Q Consensus       147 ~~~~~~~Lk~aG~~~~  162 (328)
                      +.+++....++|+|.+
T Consensus        89 tl~e~~~a~~~~~d~I  104 (169)
T pfam01729        89 NLEELEEALEAGADII  104 (169)
T ss_pred             HHHHHHHHHHCCCCEE
T ss_conf             1998999984699899


No 302
>PRK00077 eno phosphopyruvate hydratase; Provisional
Probab=46.83  E-value=20  Score=15.79  Aligned_cols=73  Identities=16%  Similarity=0.135  Sum_probs=39.6

Q ss_pred             CCCCCCHHHHHHHHHHHHHHCCCCCCEEEE-HHHHHCHHHHHHHHHHCCCEEEECCEEECCCCC---CHHHHHHHHHHCC
Q ss_conf             456879899999999999968687214231-156516568999998099889977866515888---9899999999829
Q gi|254780485|r  246 ENKKVDPIEHVRIISVARILMPKSRLRLAA-GRAMMSDELQALCFFSGANSIFVGDTLLTAKNP---SYNKDTILFNRLG  321 (328)
Q Consensus       246 ~~~~~~~~e~lr~iAi~RL~lP~~~i~i~~-~~~~~~~~~~~~~L~~GaN~~~~g~~~~t~~g~---~~~~~~~~i~~~G  321 (328)
                      .....|..|.+..+.+++=.-=  ...+|. +-||...-...++.-.||.-+-+|.   ..+|-   ..++.++.=+++|
T Consensus       338 ~NQiGTvset~eai~la~~~g~--~~ivShRSGETeD~~IaDLAVg~ga~~iK~Ga---~~R~ER~aKyNrLlrIeeeLg  412 (427)
T PRK00077        338 VNQIGTLTETLEAIELAKRAGY--TAVISHRSGETEDTTIADLAVATNAGQIKTGS---LSRSERVAKYNQLLRIEEELG  412 (427)
T ss_pred             CCCCCCHHHHHHHHHHHHHCCC--EEEEECCCCCCCCCHHHHHHHHCCCCHHHCCC---CCCHHHHHHHHHHHHHHHHHH
T ss_conf             4346739999999999998698--79997898986621599989860897320589---840788999999999999862


Q ss_pred             CC
Q ss_conf             85
Q gi|254780485|r  322 LI  323 (328)
Q Consensus       322 ~~  323 (328)
                      -.
T Consensus       413 ~~  414 (427)
T PRK00077        413 EK  414 (427)
T ss_pred             HC
T ss_conf             14


No 303
>cd04740 DHOD_1B_like Dihydroorotate dehydrogenase (DHOD) class 1B FMN-binding domain. DHOD catalyzes the oxidation of (S)-dihydroorotate to orotate. This is the fourth step and the only redox reaction in the de novo biosynthesis of UMP, the precursor of all pyrimidine nucleotides. DHOD requires FMN as co-factor. DHOD divides into class 1 and class 2 based on their amino acid sequences and cellular location. Members of class 1 are cytosolic enzymes and multimers while class 2 enzymes are membrane associated and monomeric. The class 1 enzymes can be further divided into subtypes 1A and 1B which are homodimers and heterotetrameric proteins, respectively.
Probab=46.76  E-value=20  Score=15.79  Aligned_cols=189  Identities=15%  Similarity=0.176  Sum_probs=91.1

Q ss_pred             CHHHHHHHHHHH-CCCCCCEEEECCCCCHHH----HHHHHCCCCCEEEEECCCCHH---HHHCCCCCCCHHHHHHHHHHH
Q ss_conf             289999988762-136883241025699999----998741576069751343777---732058888989999999999
Q gi|254780485|r  121 DLSIIVDMIKGV-KSLGLETCMTLGMLSFEQ----AQILSKAGLDYYNHNIDTSER---FYPHVTTTHTFEDRLQTLENV  192 (328)
Q Consensus       121 ~~~~~~e~i~~i-~~~~~~i~~~~g~~~~~~----~~~Lk~aG~~~~~~~let~~~---~~~~~~~~~~~~~~l~~~~~a  192 (328)
                      ..+++++.++.. +..+..+.+|++-.+.++    ++++.++|+|.+.+|+-+ |.   .....  ..+.+..-++++..
T Consensus        73 G~~~~~~~l~~~~~~~~~pvi~si~~~~~~d~~~~~~~~~~~gad~ielNiSc-PNt~~~g~~~--~~~~~~~~~i~~~v  149 (296)
T cd04740          73 GVEAFLEELLPWLREFGTPVIASIAGSTVEEFVEVAEKLADAGADAIELNISC-PNVKGGGMAF--GTDPEAVAEIVKAV  149 (296)
T ss_pred             CHHHHHHHHHHHHCCCCCEEEEEECCCCHHHHHHHHHHHHHCCCCEEEEECCC-CCCCCCHHHH--CCCHHHHHHHHHHH
T ss_conf             64899987898635689718998168987899999999886489889997889-9867636775--74999999999999


Q ss_pred             HHC-CCCCCCEEEECCCCCHHHHHHHHHHHHHCCCCCCEEE-CCCEEEC-----CCCCCCC--CCCCCH----HHHHHHH
Q ss_conf             987-9855770786689899999999999974088886020-5411204-----8741244--568798----9999999
Q gi|254780485|r  193 RKS-GIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIP-INLLIPI-----PGSKFEE--NKKVDP----IEHVRII  259 (328)
Q Consensus       193 ~~~-G~~~~sg~l~G~gEt~eeri~~l~~lr~l~~~~~~v~-~~~~~p~-----~gt~l~~--~~~~~~----~e~lr~i  259 (328)
                      ++. ..+    +++=+.-...+..+....+.+-+.  +++. +|.+...     ...|...  ....|.    .-.|+++
T Consensus       150 k~~~~~P----i~vKlsP~~~~i~~ia~~~~~~g~--dgiv~~NT~~~~~id~~~~~p~l~~~~GGlSG~~l~~~al~~v  223 (296)
T cd04740         150 KKATDVP----VIVKLTPNVTDIVEIARAAEEAGA--DGLTLINTLKGMAIDIETRKPILGNVTGGLSGPAIKPIALRMV  223 (296)
T ss_pred             HHCCCCC----EEEECCCCCCHHHHHHHHHHHCCC--CEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHH
T ss_conf             8604896----699718980009999999997699--8899974678766364446755245578768677889999999


Q ss_pred             HHHHHHCCCCCCEEEEHHHHHCHHHHHHHHHHCCCEEEECCEEECCCCCC-----HHHHHHHHHHCCCC
Q ss_conf             99999686872142311565165689999980998899778665158889-----89999999982985
Q gi|254780485|r  260 SVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPS-----YNKDTILFNRLGLI  323 (328)
Q Consensus       260 Ai~RL~lP~~~i~i~~~~~~~~~~~~~~~L~~GaN~~~~g~~~~t~~g~~-----~~~~~~~i~~~G~~  323 (328)
                      +..|-.+ +..| |.+|=.. ..+-....+.+||+.+.+.--+ - .|+.     .++..+.+++-||.
T Consensus       224 ~~~~~~~-~ipI-ig~GGI~-s~~da~e~i~aGAs~VQi~Tai-~-~Gp~~i~~i~~~L~~~l~~~G~~  287 (296)
T cd04740         224 YQVYKAV-EIPI-IGVGGIA-SGEDALEFLMAGASAVQVGTAN-F-VDPEAFKEIIEGLEAYLDEEGIK  287 (296)
T ss_pred             HHHHHHC-CCCE-EEECCCC-CHHHHHHHHHCCCCHHHHHHHH-H-CCHHHHHHHHHHHHHHHHHCCCC
T ss_conf             9998545-8887-9757979-9999999998399888723667-4-29279999999999999983999


No 304
>PRK09856 fructoselysine 3-epimerase; Provisional
Probab=46.55  E-value=20  Score=15.76  Aligned_cols=168  Identities=13%  Similarity=0.107  Sum_probs=80.9

Q ss_pred             CCCCCHHHHHHHHHHHHHCCCEEEEEECCCCC---CCCCCHHHHHHHHHHH----CCCCCCEEEECC-------CCC-HH
Q ss_conf             00068579999999999649838997303688---8744289999988762----136883241025-------699-99
Q gi|254780485|r   85 SKLINVDQVLKEAKNAKENGATRYCMGAAWRE---PKERDLSIIVDMIKGV----KSLGLETCMTLG-------MLS-FE  149 (328)
Q Consensus        85 ~~~~~~Eei~~~a~~~~~~G~~~~~l~~~~~~---~~~~~~~~~~e~i~~i----~~~~~~i~~~~g-------~~~-~~  149 (328)
                      ....+.+.+.+.++.+.+.|+..+.+.+++..   ++.....++.+.++.+    .+.++.+.+..-       ..+ ++
T Consensus        84 ~R~~~i~~~k~~id~A~~Lga~~v~v~~~~~~~~~~~~~~w~~~~e~l~~l~~~A~~~Gv~l~lE~l~~~e~~li~~~~~  163 (276)
T PRK09856         84 MRRESLDMIKLAMDMAKEMNAGYTLISAAHAGYLTPPNVIWGRLAENLSELCEYAENIGMDLILEPLTPYESNVVCNAND  163 (276)
T ss_pred             HHHHHHHHHHHHHHHHHHHCCCEEEEECCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHCCHHH
T ss_conf             98999999999999999849984999368777888979999999999999999999739989995176111420068999


Q ss_pred             HHHHHHCCCCCEEEEECCCCHHHHHCCCCCCCHHHHHHHHHH-HHHCCCC-----CCCEEEECCCCCHHHHHHHHHHHHH
Q ss_conf             999874157606975134377773205888898999999999-9987985-----5770786689899999999999974
Q gi|254780485|r  150 QAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLEN-VRKSGIK-----VCCGGILGLGEMIDDRIDMLLTLAN  223 (328)
Q Consensus       150 ~~~~Lk~aG~~~~~~~let~~~~~~~~~~~~~~~~~l~~~~~-a~~~G~~-----~~sg~l~G~gEt~eeri~~l~~lr~  223 (328)
                      ....+...|-+.+.+.+|+..-    .+...+..+.++.+.. ..-.-+.     ...+.+.|.|+  -+.-+.+..|++
T Consensus       164 ~~~~~~~v~~~~~~~~lD~~h~----~~~~~~~~~~~~~~g~~l~HvHi~D~~g~~d~hl~pG~G~--~d~~~il~~L~~  237 (276)
T PRK09856        164 VLHALALVPSPRLFSMVDICAP----YVQAEPVMSYFDKLGDKLRHLHIVDSDGASDTHYIPGEGK--MPLRELMRDIID  237 (276)
T ss_pred             HHHHHHHCCCCCEEEEEECHHH----HHCCCCHHHHHHHHCCCEEEEEEECCCCCCCCCCCCCCCC--CCHHHHHHHHHH
T ss_conf             9999985799864899854137----5538999999998588746998767999866773799987--788999999998


Q ss_pred             CCCCCCEEECCCEEECCCCCCCCCCCCCHHH-HHHHHHHHHHHCCC
Q ss_conf             0888860205411204874124456879899-99999999996868
Q gi|254780485|r  224 LSTPPESIPINLLIPIPGSKFEENKKVDPIE-HVRIISVARILMPK  268 (328)
Q Consensus       224 l~~~~~~v~~~~~~p~~gt~l~~~~~~~~~e-~lr~iAi~RL~lP~  268 (328)
                      .+.. ..+.+=.+....         ..|.. ..+.++..|=++|.
T Consensus       238 ~gY~-G~vsvEl~~~y~---------~~P~~~a~~sl~~lR~~~~e  273 (276)
T PRK09856        238 RGYE-GYCTVELVTMYM---------NEPRLYARQALERFRALLPE  273 (276)
T ss_pred             CCCC-CEEEEEECCCCC---------CCHHHHHHHHHHHHHHHCCC
T ss_conf             5998-159999725765---------79999999999999975452


No 305
>COG1717 RPL32 Ribosomal protein L32E [Translation, ribosomal structure and biogenesis]
Probab=46.54  E-value=19  Score=16.04  Aligned_cols=63  Identities=21%  Similarity=0.275  Sum_probs=44.3

Q ss_pred             CEEEECCCCCHHHHHHHHCCCCCEEEEE----CCC-CHHH-HHCCCCCCCHHHHHHHHHHHHHCCCCCC
Q ss_conf             3241025699999998741576069751----343-7777-3205888898999999999998798557
Q gi|254780485|r  138 ETCMTLGMLSFEQAQILSKAGLDYYNHN----IDT-SERF-YPHVTTTHTFEDRLQTLENVRKSGIKVC  200 (328)
Q Consensus       138 ~i~~~~g~~~~~~~~~Lk~aG~~~~~~~----let-~~~~-~~~~~~~~~~~~~l~~~~~a~~~G~~~~  200 (328)
                      ...+++|..+....+.|.-.|...+.+.    ||. .|.. ...|-.......++++++.|.++|+++.
T Consensus        58 p~~v~iGyrsPk~vRglhPSG~~~VlV~Nv~dLe~ldp~~~aarIAs~VG~rKR~eI~~rA~elGikVl  126 (133)
T COG1717          58 PPMVKIGYRSPKAVRGLHPSGYEEVLVHNVKDLEKLDPETQAARIASTVGARKRIEILERARELGIKVL  126 (133)
T ss_pred             CCCCCCCCCCCHHHCCCCCCCCCEEEEECHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCEEE
T ss_conf             998645778827652568776602355168887423804679999976417789999999998291774


No 306
>cd04824 eu_ALAD_PBGS_cysteine_rich Porphobilinogen synthase (PBGS), which is also called delta-aminolevulinic acid dehydratase (ALAD), catalyzes the condensation of two 5-aminolevulinic acid (ALA) molecules to form the pyrrole porphobilinogen (PBG), which is the second step in the biosynthesis of tetrapyrroles, such as heme, vitamin B12 and chlorophyll. This reaction involves the formation of a Schiff base link between the substrate and the enzyme. PBGSs are metalloenzymes, some of which have a second, allosteric metal binding site, beside the metal ion binding site in their active site. Although PBGS is a family of homologous enzymes, its metal ion utilization at catalytic site varies between zinc and magnesium and/or potassium. PBGS can be classified into two groups based on differences in their active site metal binding site. The eukaryotic PBGSs represented by this model, which contain a cysteine-rich zinc binding motif (DXCXCX(Y/F)X3G(H/Q)CG), require zinc for their activity, they
Probab=45.79  E-value=21  Score=15.69  Aligned_cols=57  Identities=11%  Similarity=0.035  Sum_probs=38.6

Q ss_pred             CCCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCCC---------CHHHHHHHHHHHCCCCCCEEE
Q ss_conf             000685799999999996498389973036888744---------289999988762136883241
Q gi|254780485|r   85 SKLINVDQVLKEAKNAKENGATRYCMGAAWREPKER---------DLSIIVDMIKGVKSLGLETCM  141 (328)
Q Consensus        85 ~~~~~~Eei~~~a~~~~~~G~~~~~l~~~~~~~~~~---------~~~~~~e~i~~i~~~~~~i~~  141 (328)
                      -+..+.+.++++++.+.+.|++-+.+-........+         +-..+.+++|.+|+..+.+.+
T Consensus        45 v~R~sid~l~~~i~~~~~lGI~av~LF~v~~~~~kkd~~gs~a~~~~~lv~rAIr~iK~~fpdl~v  110 (320)
T cd04824          45 INRYGVNRLEEFLRPLVAKGLRSVILFGVPLKPGKDDRSGSAADDEDGPVIQAIKLIREEFPELLI  110 (320)
T ss_pred             CCEECHHHHHHHHHHHHHCCCCEEEEECCCCHHCCCCCCCCCCCCCCCHHHHHHHHHHHHCCCEEE
T ss_conf             634489999999999998799979971667610068734450148654999999999987898499


No 307
>PRK12653 fructose-6-phosphate aldolase; Reviewed
Probab=45.76  E-value=21  Score=15.69  Aligned_cols=140  Identities=12%  Similarity=0.145  Sum_probs=72.8

Q ss_pred             HHHHHHHHHHCCCCCCEEEECCCCCH----HHHHHHHCCCCCEEEEECCCCHHHHHCCCCCCCHHHHHHHHHHHHHCCCC
Q ss_conf             99999887621368832410256999----99998741576069751343777732058888989999999999987985
Q gi|254780485|r  123 SIIVDMIKGVKSLGLETCMTLGMLSF----EQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSGIK  198 (328)
Q Consensus       123 ~~~~e~i~~i~~~~~~i~~~~g~~~~----~~~~~Lk~aG~~~~~~~let~~~~~~~~~~~~~~~~~l~~~~~a~~~G~~  198 (328)
                      +.+.++.+.+. ....+++.+..-+.    ++.+++.+.+-+           .+-+++-+   .+.+++++.+.+.|++
T Consensus        41 ~~~~~i~~~~~-~~~~l~~qv~~~~~e~M~~~a~~l~~~~~n-----------vvVKIP~t---~~Gl~ai~~L~~~Gi~  105 (220)
T PRK12653         41 VVLPQLHEAMG-GQGRLFAQVMATTAEGMVNDARKLRSIIAD-----------IVVKVPVT---AEGLAAIKMLKAEGIP  105 (220)
T ss_pred             HHHHHHHHHHC-CCCCEEEEEEECCHHHHHHHHHHHHHHCCC-----------EEEEECCC---HHHHHHHHHHHHCCCC
T ss_conf             99999999808-998589998758899999999999873578-----------08994885---7899999999882987


Q ss_pred             CCCEEEECCCCCHHHHHHHHHHHHHCCCCCCEEECCCEEECCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCEEEEHHH
Q ss_conf             57707866898999999999999740888860205411204874124456879899999999999968687214231156
Q gi|254780485|r  199 VCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEHVRIISVARILMPKSRLRLAAGRA  278 (328)
Q Consensus       199 ~~sg~l~G~gEt~eeri~~l~~lr~l~~~~~~v~~~~~~p~~gt~l~~~~~~~~~e~lr~iAi~RL~lP~~~i~i~~~~~  278 (328)
                      ++.|.+|...+        .......+..+  |+  ||.-    ++.+...-.....-.+..+.+..-.++.|-.++-|.
T Consensus       106 vn~Tavys~~Q--------a~~Aa~aGA~y--vs--Pyvg----R~~d~g~Dg~~~i~~i~~~~~~~~~~tkILaASiR~  169 (220)
T PRK12653        106 TLGTAVYGAAQ--------GLLSALAGAEY--VA--PYVN----RIDAQGGSGIQTVTDLHQLLKMHAPQAKVLAASFKT  169 (220)
T ss_pred             EEEEECCCHHH--------HHHHHHCCCCE--EE--EEEE----EHHHCCCCHHHHHHHHHHHHHHCCCCCEEEEEECCC
T ss_conf             78521067999--------99999859988--84--4425----064338982668999999999769998899983899


Q ss_pred             HHCHHHHHHHHHHCCCEE
Q ss_conf             516568999998099889
Q gi|254780485|r  279 MMSDELQALCFFSGANSI  296 (328)
Q Consensus       279 ~~~~~~~~~~L~~GaN~~  296 (328)
                      .   ..-..+..+||+.+
T Consensus       170 ~---~~v~~a~~~Gad~i  184 (220)
T PRK12653        170 P---RQALDCLLAGCESI  184 (220)
T ss_pred             H---HHHHHHHHCCCCEE
T ss_conf             9---99999998699999


No 308
>smart00052 EAL Putative diguanylate phosphodiesterase. Putative diguanylate phosphodiesterase, present in a variety of bacteria.
Probab=45.63  E-value=21  Score=15.67  Aligned_cols=96  Identities=20%  Similarity=0.235  Sum_probs=54.3

Q ss_pred             CCHHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHCCCCCEEEEECCCCHHHHHCCCCCCCHHHHHH-HHHHHHHCCCC
Q ss_conf             42899999887621368832410256999999987415760697513437777320588889899999-99999987985
Q gi|254780485|r  120 RDLSIIVDMIKGVKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQ-TLENVRKSGIK  198 (328)
Q Consensus       120 ~~~~~~~e~i~~i~~~~~~i~~~~g~~~~~~~~~Lk~aG~~~~~~~let~~~~~~~~~~~~~~~~~l~-~~~~a~~~G~~  198 (328)
                      ...+...+.++.++..+..+++.-.-.....+..|+...++.+.+    ++.+...+.........++ ..+.||++|++
T Consensus       130 ~~~~~~~~~i~~l~~~G~~iaiDdfG~~~~~~~~l~~l~~d~iKl----d~~li~~~~~~~~~~~~~~~l~~~a~~~g~~  205 (241)
T smart00052      130 DDDESAVATLQRLRELGVRIALDDFGTGYSSLSYLKRLPVDLLKI----DKSFVRDLQTDPEDEAIVQSIIELAQKLGLQ  205 (241)
T ss_pred             CCHHHHHHHHHHHHHCCCCEEECCCCCCCCHHHHHHHCCCHHHCC----CHHHHHHCCCCHHHHHHHHHHHHHHHHCCCE
T ss_conf             089999999999997099787537899810189998657204224----7999961326845589999999999985998


Q ss_pred             CCCEEEECCCCCHHHHHHHHHHHHHCCCC
Q ss_conf             57707866898999999999999740888
Q gi|254780485|r  199 VCCGGILGLGEMIDDRIDMLLTLANLSTP  227 (328)
Q Consensus       199 ~~sg~l~G~gEt~eeri~~l~~lr~l~~~  227 (328)
                      +-+..    +||.++    +..+++++..
T Consensus       206 viaeg----VE~~~~----~~~l~~~Gi~  226 (241)
T smart00052      206 VVAEG----VETPEQ----LDLLRSLGCD  226 (241)
T ss_pred             EEEEE----CCCHHH----HHHHHHCCCC
T ss_conf             99971----881999----9999974999


No 309
>TIGR00411 redox_disulf_1 redox-active disulfide protein 1; InterPro: IPR004502 This group of proteins includes thioredoxins, glutaredoxins, protein-disulphide isomerases, and others, some of which have several such domains. The sequence of proteins in this group at the redox-active disufide site, CPYC, matches glutaredoxins rather than thioredoxins, although overall the sequence seems closer to thioredoxins. Proteins may be involved in a ribonucleotide-reducing system component distinct from thioredoxin or glutaredoxin.; GO: 0009055 electron carrier activity, 0015035 protein disulfide oxidoreductase activity, 0045454 cell redox homeostasis.
Probab=45.59  E-value=21  Score=15.67  Aligned_cols=37  Identities=11%  Similarity=0.047  Sum_probs=21.0

Q ss_pred             HHHHHHHHHCCC---EEEECCEEECCCCCCHHHHHHHHHH
Q ss_conf             689999980998---8997786651588898999999998
Q gi|254780485|r  283 ELQALCFFSGAN---SIFVGDTLLTAKNPSYNKDTILFNR  319 (328)
Q Consensus       283 ~~~~~~L~~GaN---~~~~g~~~~t~~g~~~~~~~~~i~~  319 (328)
                      +..+.||.+|.-   .+.+.+.+.--|-++-++..++|++
T Consensus        41 e~~~kA~~yGi~aVPaivINg~v~f~GaP~~eeL~eaI~k   80 (82)
T TIGR00411        41 EDLKKALEYGIMAVPAIVINGKVRFVGAPDKEELVEAIRK   80 (82)
T ss_pred             CCHHHHHHCCCCCCCEEEECCEEEEEEECCHHHHHHHHHH
T ss_conf             4847887516352684787790688530886899999763


No 310
>pfam00343 Phosphorylase Carbohydrate phosphorylase. The members of this family catalyse the formation of glucose 1-phosphate from one of the following polyglucoses; glycogen, starch, glucan or maltodextrin.
Probab=45.53  E-value=14  Score=16.94  Aligned_cols=66  Identities=11%  Similarity=0.125  Sum_probs=35.5

Q ss_pred             HHHHHHHCCCCCCEEEE---HHHHHCHHHHHHHHHHCCC-EEEECCEEE----------CCCCCCHHHHHHHHHHCCCCC
Q ss_conf             99999968687214231---1565165689999980998-899778665----------158889899999999829853
Q gi|254780485|r  259 ISVARILMPKSRLRLAA---GRAMMSDELQALCFFSGAN-SIFVGDTLL----------TAKNPSYNKDTILFNRLGLIP  324 (328)
Q Consensus       259 iAi~RL~lP~~~i~i~~---~~~~~~~~~~~~~L~~GaN-~~~~g~~~~----------t~~g~~~~~~~~~i~~~G~~P  324 (328)
                      |.++|.+.|-+.+..+.   +.|.-|......+|..+.| ||+-|-++.          -.=|.+.++..+ ++.-|+.|
T Consensus       533 VslAe~lipa~Dvseqis~a~~EASGTsnMK~~lNGaltlgtlDGanvEi~e~vG~eN~fiFG~~~~ev~~-~~~~gY~~  611 (712)
T pfam00343       533 VSLAEKIIPASDISEQISTAGTEASGTSNMKFALNGALTIGTLDGANVEIAEEVGEENIFIFGLTAEEVEA-LRKKGYRS  611 (712)
T ss_pred             HHHHHHHCCCCCHHHHCCCCCCCCCCCCCHHHHHCCCEEEECCCCHHHHHHHHCCCCCEEEECCCHHHHHH-HHHCCCCH
T ss_conf             69998753420046437888734578620689976872673366526788986285536870687789999-98659885


Q ss_pred             C
Q ss_conf             2
Q gi|254780485|r  325 D  325 (328)
Q Consensus       325 ~  325 (328)
                      .
T Consensus       612 ~  612 (712)
T pfam00343       612 R  612 (712)
T ss_pred             H
T ss_conf             6


No 311
>COG0149 TpiA Triosephosphate isomerase [Carbohydrate transport and metabolism]
Probab=45.49  E-value=21  Score=15.66  Aligned_cols=171  Identities=18%  Similarity=0.288  Sum_probs=89.8

Q ss_pred             CCCCHHHHHHHHHH----HCCCCCCEEEECCCCC-HHHHHHHHCCCCCEEEEECCCCHHHHHCCCCCCCHHHHHHHHHHH
Q ss_conf             74428999998876----2136883241025699-999998741576069751343777732058888989999999999
Q gi|254780485|r  118 KERDLSIIVDMIKG----VKSLGLETCMTLGMLS-FEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENV  192 (328)
Q Consensus       118 ~~~~~~~~~e~i~~----i~~~~~~i~~~~g~~~-~~~~~~Lk~aG~~~~~~~let~~~~~~~~~~~~~~~~~l~~~~~a  192 (328)
                      +.-++....+.++.    +-..+++..- .|.-| +-....|++.|++.+.++.--.|.+|.+.     -+.--...+.|
T Consensus        44 p~~~L~~~~~~~~~g~i~~gAQn~~~~~-~GA~TGeiS~~mL~d~G~~~viiGHSERR~~~~E~-----d~~i~~K~~aa  117 (251)
T COG0149          44 PFTDLRRVAELVEIGNIKVGAQNVDPED-SGAFTGEISAEMLKDLGAKYVLIGHSERRLYFGET-----DELIAKKVKAA  117 (251)
T ss_pred             CHHHHHHHHHHHCCCCCEEEECCCCCCC-CCCCCCCCCHHHHHHCCCCEEEECCCCCCCCCCCC-----HHHHHHHHHHH
T ss_conf             8778999999852478317746688655-77866838899999869988997850112435634-----69999999999


Q ss_pred             HHCCCCCCCEEEECCCCCHHHHHH--HHHHHH--------HCCCCCCEEECCCEEEC--CCCCCCCCCCCCHHHHHHHHH
Q ss_conf             987985577078668989999999--999997--------40888860205411204--874124456879899999999
Q gi|254780485|r  193 RKSGIKVCCGGILGLGEMIDDRID--MLLTLA--------NLSTPPESIPINLLIPI--PGSKFEENKKVDPIEHVRIIS  260 (328)
Q Consensus       193 ~~~G~~~~sg~l~G~gEt~eeri~--~l~~lr--------~l~~~~~~v~~~~~~p~--~gt~l~~~~~~~~~e~lr~iA  260 (328)
                      ++.|+.+    ++=.|||.++|-.  ++..+.        .+......+  -..=|.  -||    -.++|+.+.-.+.+
T Consensus       118 ~~~Gl~p----IlCvGEtl~~reag~t~~v~~~Ql~~~l~~l~~~~~~v--IAYEPvWAIGT----G~~at~~~a~~v~~  187 (251)
T COG0149         118 KEAGLTP----ILCVGETLEEREAGKTLEVLKRQLAAALAALSPEANIV--IAYEPVWAIGT----GKSASPADAEEVHA  187 (251)
T ss_pred             HHCCCEE----EEECCCCHHHHHCCCHHHHHHHHHHHHHHHCCCCCCEE--EEECCHHHHCC----CCCCCHHHHHHHHH
T ss_conf             9889968----99858977777555668899999999987448543739--99878888458----98889888999999


Q ss_pred             HHHHHCCC-----CCCEEEE-HHHHHCHHHHHHHHHHCCCEEEECCEEECC
Q ss_conf             99996868-----7214231-156516568999998099889977866515
Q gi|254780485|r  261 VARILMPK-----SRLRLAA-GRAMMSDELQALCFFSGANSIFVGDTLLTA  305 (328)
Q Consensus       261 i~RL~lP~-----~~i~i~~-~~~~~~~~~~~~~L~~GaN~~~~g~~~~t~  305 (328)
                      ..|-.+-.     ..++|+- |=++ ......++..-++||.++|+-.+.+
T Consensus       188 ~Ir~~~~~~~~~~~~v~IlYGGSV~-~~N~~e~~~~~~idG~LVGgAslka  237 (251)
T COG0149         188 FIRAVLAELFGAEEKVRILYGGSVK-PGNAAELAAQPDIDGALVGGASLKA  237 (251)
T ss_pred             HHHHHHHHHCCCCCCEEEEEECCCC-HHHHHHHHCCCCCCEEEECCEEECC
T ss_conf             9999999744877875799717768-5579999658999868972133052


No 312
>PRK10551 hypothetical protein; Provisional
Probab=45.45  E-value=21  Score=15.65  Aligned_cols=10  Identities=10%  Similarity=0.149  Sum_probs=4.8

Q ss_pred             HHHHHHCCCC
Q ss_conf             9999982985
Q gi|254780485|r  314 TILFNRLGLI  323 (328)
Q Consensus       314 ~~~i~~~G~~  323 (328)
                      .+-++++|+.
T Consensus       403 l~~Lr~~Gv~  412 (518)
T PRK10551        403 FAWLHSQGIE  412 (518)
T ss_pred             HHHHHHCCCE
T ss_conf             9999976994


No 313
>PRK02271 methylenetetrahydromethanopterin reductase; Provisional
Probab=45.18  E-value=21  Score=15.63  Aligned_cols=41  Identities=20%  Similarity=0.344  Sum_probs=24.5

Q ss_pred             EEEEHHHHHCHHHHHHHHHHCCCEEEECCEEECCCCCCHHHHHHHH
Q ss_conf             4231156516568999998099889977866515888989999999
Q gi|254780485|r  272 RLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTILF  317 (328)
Q Consensus       272 ~i~~~~~~~~~~~~~~~L~~GaN~~~~g~~~~t~~g~~~~~~~~~i  317 (328)
                      .+.+.-+.+-..++++ ..+|+|.++.+-.    -|...++-++++
T Consensus       279 ~l~Gtpe~v~~~l~~~-~d~Gvd~i~~~~~----~g~~~~~~le~~  319 (324)
T PRK02271        279 SIAGTPDDVVEKIEDL-LEAGVTQIVAGSP----IGPDKEKSIKLI  319 (324)
T ss_pred             EEECCHHHHHHHHHHH-HHCCCCEEEEECC----CCCCHHHHHHHH
T ss_conf             7878999999999999-9669988998589----997989999999


No 314
>PRK09427 bifunctional indole-3-glycerol phosphate synthase/phosphoribosylanthranilate isomerase; Provisional
Probab=44.73  E-value=22  Score=15.58  Aligned_cols=45  Identities=18%  Similarity=0.158  Sum_probs=20.9

Q ss_pred             EEEEHHHHHCHHHHHHHHHHCCCEEEECCEEECCCC-CCHHHHHHHHHH
Q ss_conf             423115651656899999809988997786651588-898999999998
Q gi|254780485|r  272 RLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKN-PSYNKDTILFNR  319 (328)
Q Consensus       272 ~i~~~~~~~~~~~~~~~L~~GaN~~~~g~~~~t~~g-~~~~~~~~~i~~  319 (328)
                      .+++|   ++++.-..++..+..++=+...+.+.+| .+.+.+.++++.
T Consensus       410 iLAGG---L~peNV~eAi~~~p~gVDVSSGVE~~pGvKD~~KI~~Fi~~  455 (459)
T PRK09427        410 LLAGG---LNADNCAQAAQLGCAGLDFNSGVESAPGIKDAQKLAAVFQT  455 (459)
T ss_pred             EEECC---CCHHHHHHHHHCCCCEEEECCCCCCCCCCCCHHHHHHHHHH
T ss_conf             99766---99899999995699999916531899997699999999999


No 315
>pfam09587 PGA_cap Bacterial capsule synthesis protein PGA_cap. This protein is a putative poly-gamma-glutamate capsule biosynthesis protein found in bacteria. Poly-gamma-glutamate is a natural polymer that may be involved in virulence and may help bacteria survive in high salt concentrations. It is a surface-associated protein.
Probab=43.95  E-value=22  Score=15.50  Aligned_cols=135  Identities=18%  Similarity=0.124  Sum_probs=64.3

Q ss_pred             CCCHHHHHHHHCCCCCEEEEECCCCHHHHHCCCCCCCHHHHHHHHHHHHHCCCCCCCEEEECCCCCHHHHHHHHHHHHHC
Q ss_conf             69999999874157606975134377773205888898999999999998798557707866898999999999999740
Q gi|254780485|r  145 MLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANL  224 (328)
Q Consensus       145 ~~~~~~~~~Lk~aG~~~~~~~let~~~~~~~~~~~~~~~~~l~~~~~a~~~G~~~~sg~l~G~gEt~eeri~~l~~lr~l  224 (328)
                      -...+.+..|+++|++.+.+.    .    ...-....+--.+|++.+.+.|+..     +|.|.+.++.-.-  .+.+.
T Consensus        62 ~~~~~~~~~L~~~G~d~vslA----N----NH~~D~G~~G~~~T~~~L~~~gi~~-----~G~g~~~~~a~~p--~~~~~  126 (237)
T pfam09587        62 RAPPENAEALKAAGFDVVSLA----N----NHSLDYGEEGLLDTLDALDRAGIAH-----AGAGRNLEEARRP--AILEV  126 (237)
T ss_pred             ECCHHHHHHHHHCCCCEEEEC----C----CCCCCCCHHHHHHHHHHHHHCCCCC-----CCCCCCHHHCCCC--EEEEE
T ss_conf             799999999998499999957----7----6433257799999999999879960-----5888994662780--89997


Q ss_pred             CCCCCEEECCCEEECCCCC-----CCCCCCCCHHHHHHHHHHHHHHCCCCCC-EEEEHHH------HHCHHHHHHHHHHC
Q ss_conf             8888602054112048741-----2445687989999999999996868721-4231156------51656899999809
Q gi|254780485|r  225 STPPESIPINLLIPIPGSK-----FEENKKVDPIEHVRIISVARILMPKSRL-RLAAGRA------MMSDELQALCFFSG  292 (328)
Q Consensus       225 ~~~~~~v~~~~~~p~~gt~-----l~~~~~~~~~e~lr~iAi~RL~lP~~~i-~i~~~~~------~~~~~~~~~~L~~G  292 (328)
                      ...  -|.+..+....+..     -......+.....+.|+-+|=- .+..| .+-.|.|      ....++....+.+|
T Consensus       127 ~g~--kia~l~~t~~~~~~~~~~~~~~~~~~~~~~i~~~i~~~k~~-~D~vIv~~HwG~E~~~~p~~~q~~~a~~lidaG  203 (237)
T pfam09587       127 NGI--RIAFLAYTYGTNGWGAGPYRPGVNPLDEEKIKADIRRAKKK-ADIVIVSLHWGVEYQYEPTPEQRELAHALIDAG  203 (237)
T ss_pred             CCC--EEEEEEEECCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHCC-CCEEEEECCCCCCCCCCCCHHHHHHHHHHHHCC
T ss_conf             993--89999987587875678888755756999999999987507-999999877566787699999999999999779


Q ss_pred             CCEEE
Q ss_conf             98899
Q gi|254780485|r  293 ANSIF  297 (328)
Q Consensus       293 aN~~~  297 (328)
                      ||-++
T Consensus       204 aDlIi  208 (237)
T pfam09587       204 ADLVI  208 (237)
T ss_pred             CCEEE
T ss_conf             99999


No 316
>cd00953 KDG_aldolase KDG (2-keto-3-deoxygluconate) aldolases found in archaea. This subfamily of enzymes is adapted for high thermostability and shows specificity for non-phosphorylated substrates. The enzyme catalyses the reversible aldol cleavage of 2-keto-3-dexoygluconate to pyruvate and glyceraldehyde, the third step of a modified non-phosphorylated Entner-Doudoroff pathway of glucose oxidation. KDG aldolase shows no significant sequence similarity to microbial 2-keto-3-deoxyphosphogluconate (KDPG) aldolases, and the enzyme shows no activity with glyceraldehyde 3-phosphate as substrate. The enzyme is a tetramer and a member of the DHDPS family of Schiff-base-dependent class I aldolases.
Probab=43.71  E-value=22  Score=15.48  Aligned_cols=77  Identities=13%  Similarity=0.176  Sum_probs=43.4

Q ss_pred             CCHHHHHHHHHHHHHCCCEEEEEECCCCCCCCCCHHHHHHHHHHHCCCCCCEEEECCCCCHHH----HHHHHCCCCCEEE
Q ss_conf             685799999999996498389973036888744289999988762136883241025699999----9987415760697
Q gi|254780485|r   88 INVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLGLETCMTLGMLSFEQ----AQILSKAGLDYYN  163 (328)
Q Consensus        88 ~~~Eei~~~a~~~~~~G~~~~~l~~~~~~~~~~~~~~~~e~i~~i~~~~~~i~~~~g~~~~~~----~~~Lk~aG~~~~~  163 (328)
                      .+.+.+.+.++...+.|+.-++..++..+-...+.+...++++...+..-.+.+.+|..+-++    .+.-+++|+|.+.
T Consensus        17 iD~~~l~~~i~~l~~~Gv~gi~v~GstGE~~~Ls~eEr~~vi~~~~~~~~~vi~~vg~~~~~~ai~la~~A~~~Gad~i~   96 (279)
T cd00953          17 IDKEKFKKHCENLISKGIDYVFVAGTTGLGPSLSFQEKLELLKAYSDITDKVIFQVGSLNLEESIELARAAKSFGIYAIA   96 (279)
T ss_pred             CCHHHHHHHHHHHHHCCCCEEEECCHHHHHHHCCHHHHHHHHHHHHHHCCCEEEEECCCCHHHHHHHHHHHHHCCCCEEE
T ss_conf             79999999999999779999997813121655899999999999999679818997778799999999999977999899


Q ss_pred             E
Q ss_conf             5
Q gi|254780485|r  164 H  164 (328)
Q Consensus       164 ~  164 (328)
                      +
T Consensus        97 ~   97 (279)
T cd00953          97 S   97 (279)
T ss_pred             E
T ss_conf             7


No 317
>PRK11572 copper homeostasis protein CutC; Provisional
Probab=43.56  E-value=23  Score=15.46  Aligned_cols=118  Identities=12%  Similarity=0.092  Sum_probs=56.9

Q ss_pred             CCCCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCCCCHHHHHHHHHHHCCCCCCEEEECCCC---CHHHHHHHHCCCCC
Q ss_conf             100068579999999999649838997303688874428999998876213688324102569---99999987415760
Q gi|254780485|r   84 ASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLGLETCMTLGML---SFEQAQILSKAGLD  160 (328)
Q Consensus        84 ~~~~~~~Eei~~~a~~~~~~G~~~~~l~~~~~~~~~~~~~~~~e~i~~i~~~~~~i~~~~g~~---~~~~~~~Lk~aG~~  160 (328)
                      .|.....+.+.+.++..++.|+..++++ .......-+.+...+++...+....-.| -++..   ..+.++.|.+.|++
T Consensus        66 ~Ys~~E~~~M~~dI~~~~~~Ga~GvV~G-~L~~dg~iD~~~~~~Li~~a~~l~vTFH-RAfD~~~dp~~ale~Li~lG~~  143 (248)
T PRK11572         66 CYSDGEFAAMLEDIRTVRELGFPGLVTG-VLDVDGHVDMPRMEKIMAAAGPLAVTFH-RAFDMCANPLNALKNLAELGVA  143 (248)
T ss_pred             CCCHHHHHHHHHHHHHHHHCCCCEEEEE-EECCCCCCCHHHHHHHHHHHCCCEEEEE-CHHHCCCCHHHHHHHHHHCCCC
T ss_conf             6798999999999999998699967996-6889998499999999997489807986-2022149999999999975999


Q ss_pred             EEEEECCCCHHHHHCCCCCCCHHHHHHHHHHHHHCCCCCCCEEEECCCCCHHHHHH
Q ss_conf             69751343777732058888989999999999987985577078668989999999
Q gi|254780485|r  161 YYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSGIKVCCGGILGLGEMIDDRID  216 (328)
Q Consensus       161 ~~~~~let~~~~~~~~~~~~~~~~~l~~~~~a~~~G~~~~sg~l~G~gEt~eeri~  216 (328)
                      +++.    +       -...+..+=++.++...+.+=..  -+|-|-|=+.+..-.
T Consensus       144 rILT----S-------G~~~~A~~G~~~L~~L~~~a~~~--iIm~GgGV~~~Ni~~  186 (248)
T PRK11572        144 RILT----S-------GQQSDAEQGLSLIMELIAQGDAP--IIMAGAGVRAENLQK  186 (248)
T ss_pred             EEEC----C-------CCCCCHHHHHHHHHHHHHHCCCC--EEEECCCCCHHHHHH
T ss_conf             8988----9-------99787778899999999844996--898789989999999


No 318
>pfam00701 DHDPS Dihydrodipicolinate synthetase family. This family has a TIM barrel structure.
Probab=43.16  E-value=23  Score=15.42  Aligned_cols=78  Identities=17%  Similarity=0.040  Sum_probs=45.5

Q ss_pred             CCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCCCCHHHHHHHHHHHC---CCCCCEEEECCCCCHH----HHHHHHCCCC
Q ss_conf             06857999999999964983899730368887442899999887621---3688324102569999----9998741576
Q gi|254780485|r   87 LINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVK---SLGLETCMTLGMLSFE----QAQILSKAGL  159 (328)
Q Consensus        87 ~~~~Eei~~~a~~~~~~G~~~~~l~~~~~~~~~~~~~~~~e~i~~i~---~~~~~i~~~~g~~~~~----~~~~Lk~aG~  159 (328)
                      ..+.+.+.+.++...+.|+.-+.+.++..+......+...++++...   .....+.+.+|..+-.    ..+..+++|+
T Consensus        18 ~iD~~~~~~~i~~l~~~Gv~gi~v~GstGE~~~Ls~~Er~~v~~~~~~~~~~~~pvi~gv~~~st~~~i~~a~~A~~~Ga   97 (289)
T pfam00701        18 RLDEEALRKLIEFLINKGADGLFVGGTTGESFTLSTEEHEQLIEITVDEAKGRIPVIAGTGSNSTREAIHLAQLAEAAGA   97 (289)
T ss_pred             CCCHHHHHHHHHHHHHCCCCEEEECEECCCCCCCCHHHHHHHHHHHHHHCCCCCEEEECCCCCCHHHHHHHHHHHHHCCC
T ss_conf             96999999999999977999999783640311388999999999999981998628637888789999999999997499


Q ss_pred             CEEEE
Q ss_conf             06975
Q gi|254780485|r  160 DYYNH  164 (328)
Q Consensus       160 ~~~~~  164 (328)
                      |.+.+
T Consensus        98 d~i~v  102 (289)
T pfam00701        98 DGVLA  102 (289)
T ss_pred             CEEEE
T ss_conf             97887


No 319
>PRK06740 histidinol-phosphatase; Validated
Probab=42.80  E-value=23  Score=15.39  Aligned_cols=111  Identities=14%  Similarity=0.076  Sum_probs=50.3

Q ss_pred             CHHHHHHHHHHHHHCCCEEEEEECCCCCCCC-----------------------------CCHHHHHHHHHHHC----CC
Q ss_conf             8579999999999649838997303688874-----------------------------42899999887621----36
Q gi|254780485|r   89 NVDQVLKEAKNAKENGATRYCMGAAWREPKE-----------------------------RDLSIIVDMIKGVK----SL  135 (328)
Q Consensus        89 ~~Eei~~~a~~~~~~G~~~~~l~~~~~~~~~-----------------------------~~~~~~~e~i~~i~----~~  135 (328)
                      +.|=+-.-.+++++.|+++++++-..+.-..                             ..++.+...|...|    +.
T Consensus        59 ~~~W~~~y~e~a~~~Gi~evgi~eH~yrF~E~k~~y~~~~~l~ds~~G~~Q~~Wl~~v~~~~~~df~~~i~~~k~~~~~~  138 (338)
T PRK06740         59 TTKWIDLYLEEAVRKGIKEVGIVDHLYRFYEAKEYYERYVDISDSRLGRLQKEWLDQVRVASLHDFTKAIEEAKERWSKR  138 (338)
T ss_pred             CHHHHHHHHHHHHHCCCCEEEEHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHC
T ss_conf             89999999999997586246311644211777888998851670667699999985441010999999999999876642


Q ss_pred             CCCEE--EEC--CCCCHHHHHHHHC-CCCCEEE---EECCC----CHHH---HHCCCCCCCHHHHHHHHHHHHHCCCCC
Q ss_conf             88324--102--5699999998741-5760697---51343----7777---320588889899999999999879855
Q gi|254780485|r  136 GLETC--MTL--GMLSFEQAQILSK-AGLDYYN---HNIDT----SERF---YPHVTTTHTFEDRLQTLENVRKSGIKV  199 (328)
Q Consensus       136 ~~~i~--~~~--g~~~~~~~~~Lk~-aG~~~~~---~~let----~~~~---~~~~~~~~~~~~~l~~~~~a~~~G~~~  199 (328)
                      ++.+-  +.+  .+-.++.++++-. ...|.++   |.++.    .|+.   |.+.....-|.+..+.++.+-+.|+--
T Consensus       139 gi~lKLGIEaDY~pG~E~~l~~lL~~YpfDYvIGSVHFl~gWgFDnPe~~~~~~~~Dl~~iy~~YF~~ve~~A~SGLFD  217 (338)
T PRK06740        139 GVTLKLGIEADYFIGGEQELQSLLALGDFDYVIGSVHFLNGWGFDNPDTKEYFEEHDLYALYDTFFKTVECAVRSELFD  217 (338)
T ss_pred             CCCEEEEEEEECCCCHHHHHHHHHHCCCCCEEEEEEEEECCCCCCCHHHHHHHHHCCHHHHHHHHHHHHHHHHHCCCCC
T ss_conf             8735888774047885999999974499755998888607878889789988850899999999999999999759972


No 320
>cd03316 MR_like Mandelate racemase (MR)-like subfamily of the enolase superfamily. Enzymes of this subgroup share three conserved carboxylate ligands for the essential divalent metal ion (usually Mg2+), two aspartates and a glutamate, and conserved catalytic residues,  a Lys-X-Lys motif and a conserved histidine-aspartate dyad. Members of the MR subgroup are mandelate racemase, D-glucarate/L-idarate dehydratase (GlucD),  D-altronate/D-mannonate dehydratase , D-galactonate dehydratase (GalD) , D-gluconate dehydratase (GlcD), and L-rhamnonate dehydratase (RhamD).
Probab=42.35  E-value=24  Score=15.34  Aligned_cols=144  Identities=17%  Similarity=0.187  Sum_probs=72.0

Q ss_pred             CCHHHHHHHHHHHHHCCCEEEEEECCCCCCCCCCHHHHHHHHHHHCCC-CC----CEEEECCCCCHHH----HHHHHCCC
Q ss_conf             685799999999996498389973036888744289999988762136-88----3241025699999----99874157
Q gi|254780485|r   88 INVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSL-GL----ETCMTLGMLSFEQ----AQILSKAG  158 (328)
Q Consensus        88 ~~~Eei~~~a~~~~~~G~~~~~l~~~~~~~~~~~~~~~~e~i~~i~~~-~~----~i~~~~g~~~~~~----~~~Lk~aG  158 (328)
                      .++|++.+.++...+.|++.+-+-.+.......+++.-++.++.+++. +.    .+-++-+ .+.++    .+.|.+.+
T Consensus       138 ~~~~~~~~~~~~~~~~Gf~~~K~k~g~~~~~~~~~~~di~~v~~ir~~~g~~~~l~vDaN~~-~~~~~A~~~~~~l~~~~  216 (357)
T cd03316         138 DSPEELAEEAKRAVAEGFTAVKLKVGGPDSGGEDLREDLARVRAVREAVGPDVDLMVDANGR-WDLAEAIRLARALEEYD  216 (357)
T ss_pred             CCHHHHHHHHHHHHHCCCCEEEECCCCCCCCCCCHHHHHHHHHHHHHHHCCCCEEEECCCCC-CCHHHHHHHHHHHHHHH
T ss_conf             99999999999999769978985368886441269999999999999829995698657655-57999999999886544


Q ss_pred             CCEEEEECCCCHHHHHCCCCCCCHHHHHHHHHHHH-HCCCCCCCEEEECCCCCHHHHHHHHHHHHHCCCCCCEEECCCEE
Q ss_conf             60697513437777320588889899999999999-87985577078668989999999999997408888602054112
Q gi|254780485|r  159 LDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVR-KSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLI  237 (328)
Q Consensus       159 ~~~~~~~let~~~~~~~~~~~~~~~~~l~~~~~a~-~~G~~~~sg~l~G~gEt~eeri~~l~~lr~l~~~~~~v~~~~~~  237 (328)
                      +..+           .+=++..++    +-++..+ +..++      +..+|+.-..-+....++. +.    +-  .+.
T Consensus       217 l~~i-----------EqP~~~~d~----~~~~~l~~~~~~p------I~~~Es~~~~~~~~~~i~~-~a----~d--i~~  268 (357)
T cd03316         217 LFWF-----------EEPVPPDDL----EGLARLRQATSVP------IAAGENLYTRWEFRDLLEA-GA----VD--IIQ  268 (357)
T ss_pred             HHHH-----------CCCCCCCCH----HHHHHHHHCCCCC------EEECCCCCCHHHHHHHHHC-CC----CC--EEE
T ss_conf             6650-----------589895579----9999998628996------8817887887888888870-77----76--376


Q ss_pred             ECCCCCCCCCCCCCHHHHHHHHHHHHHHC
Q ss_conf             04874124456879899999999999968
Q gi|254780485|r  238 PIPGSKFEENKKVDPIEHVRIISVARILM  266 (328)
Q Consensus       238 p~~gt~l~~~~~~~~~e~lr~iAi~RL~l  266 (328)
                      |..      .......+.+|+.++++-.-
T Consensus       269 ~d~------~~~GGit~~~~i~~~A~~~g  291 (357)
T cd03316         269 PDV------TKVGGITEAKKIAALAEAHG  291 (357)
T ss_pred             ECC------CCCCCHHHHHHHHHHHHHCC
T ss_conf             267------44698799999999999869


No 321
>PRK13811 orotate phosphoribosyltransferase; Provisional
Probab=42.01  E-value=24  Score=15.31  Aligned_cols=28  Identities=21%  Similarity=0.271  Sum_probs=14.1

Q ss_pred             HHHHHHHHHCCCCC-CCEEEECCCCCHHH
Q ss_conf             99999999879855-77078668989999
Q gi|254780485|r  186 LQTLENVRKSGIKV-CCGGILGLGEMIDD  213 (328)
Q Consensus       186 l~~~~~a~~~G~~~-~sg~l~G~gEt~ee  213 (328)
                      +++++..++.|..+ ....++--.|.-.|
T Consensus       121 ~e~i~~l~~~G~~V~~v~~ivDR~eg~~e  149 (170)
T PRK13811        121 LYGIEQLRSAGAVVDDVVTVVDREEGAEE  149 (170)
T ss_pred             HHHHHHHHHCCCEEEEEEEEEECCCCHHH
T ss_conf             99999999889979999999977747799


No 322
>cd03319 L-Ala-DL-Glu_epimerase L-Ala-D/L-Glu epimerase catalyzes the epimerization of L-Ala-D/L-Glu and other dipeptides. The genomic context and the substrate specificity of characterized members of this family from E.coli and B.subtilis indicates a possible role in the metabolism of the murein peptide of peptidoglycan, of which L-Ala-D-Glu is a component. L-Ala-D/L-Glu epimerase is a member of the enolase-superfamily, which is characterized by the presence of an enolate anion intermediate which is generated by abstraction of the alpha-proton of the carboxylate substrate by an active site residue and is stabilized by coordination to the essential Mg2+ ion.
Probab=41.69  E-value=24  Score=15.28  Aligned_cols=153  Identities=17%  Similarity=0.069  Sum_probs=67.9

Q ss_pred             CCHHHHHHHHHHHHHCCCEEEEEECCCCCCCCCCHHHHHHHHHHH-CCCCCCEEEECCCCCHHHH----HHHHCCCCCEE
Q ss_conf             685799999999996498389973036888744289999988762-1368832410256999999----98741576069
Q gi|254780485|r   88 INVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGV-KSLGLETCMTLGMLSFEQA----QILSKAGLDYY  162 (328)
Q Consensus        88 ~~~Eei~~~a~~~~~~G~~~~~l~~~~~~~~~~~~~~~~e~i~~i-~~~~~~i~~~~g~~~~~~~----~~Lk~aG~~~~  162 (328)
                      .++|+..+.++...+.|++.+-+-.|.  +...+++.+ +.+|.. .+..+.+-+|-+ .+.++.    +.|.+.++.. 
T Consensus       133 ~~~e~~~~~~~~~~~~G~~~~KiKvg~--~~~~d~~~v-~~vr~~~~~~~l~vDaN~~-~~~~~A~~~~~~l~~~~i~~-  207 (316)
T cd03319         133 DTPEAMAAAAKKAAKRGFPLLKIKLGG--DLEDDIERI-RAIREAAPDARLRVDANQG-WTPEEAVELLRELAELGVEL-  207 (316)
T ss_pred             CCHHHHHHHHHHHHHCCCCEEEEECCC--CHHHHHHHH-HHHHHHCCCCEEEEECCCC-CCHHHHHHHHHHHHHHHHHH-
T ss_conf             999999999999997598768632489--979999999-9999668996299846888-89999999999752443444-


Q ss_pred             EEECCCCHHHHHCCCCCCCHHHHHHHHHHHHHCCCCCCCEEEECCCCCHHHHHHHHHHHHHCCCCCCEEECCCEEECCCC
Q ss_conf             75134377773205888898999999999998798557707866898999999999999740888860205411204874
Q gi|254780485|r  163 NHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGS  242 (328)
Q Consensus       163 ~~~let~~~~~~~~~~~~~~~~~l~~~~~a~~~G~~~~sg~l~G~gEt~eeri~~l~~lr~l~~~~~~v~~~~~~p~~gt  242 (328)
                                +.+=.+..+++..   -+-..+.++++.      .+|+.-..-+ +..+.+.+. .+     .+.|.+  
T Consensus       208 ----------iEqP~~~~d~~~~---~~l~~~~~~pIa------~dEs~~~~~d-~~~~~~~~a-~d-----~v~~k~--  259 (316)
T cd03319         208 ----------IEQPVPAGDDDGL---AYLRDKSPLPIM------ADESCFSAAD-AARLAGGGA-YD-----GINIKL--  259 (316)
T ss_pred             ----------HCCCCCCCCHHHH---HHHHHHCCCCEE------ECCCCCCHHH-HHHHHHCCC-CC-----EEEECC--
T ss_conf             ----------3089899999999---999996899999------3588799999-999997699-88-----698451--


Q ss_pred             CCCCCCCCCHHHHHHHHHHHHHHCCCCCCEEEEHHHH
Q ss_conf             1244568798999999999999686872142311565
Q gi|254780485|r  243 KFEENKKVDPIEHVRIISVARILMPKSRLRLAAGRAM  279 (328)
Q Consensus       243 ~l~~~~~~~~~e~lr~iAi~RL~lP~~~i~i~~~~~~  279 (328)
                          .......+.+|+.++++-.-  ..+.+.+.+++
T Consensus       260 ----~~~GGit~~~~ia~~A~~~g--i~~~~g~~~es  290 (316)
T cd03319         260 ----MKTGGLTEALRIADLARAAG--LKVMVGCMVES  290 (316)
T ss_pred             ----HHHCCHHHHHHHHHHHHHCC--CEEEECCCCCC
T ss_conf             ----44089899999999999869--94998188546


No 323
>pfam00563 EAL EAL domain. This domain is found in diverse bacterial signaling proteins. It is called EAL after its conserved residues. The EAL domain is a good candidate for a diguanylate phosphodiesterase function. The domain contains many conserved acidic residues that could participate in metal binding and might form the phosphodiesterase active site.
Probab=41.60  E-value=24  Score=15.27  Aligned_cols=90  Identities=21%  Similarity=0.283  Sum_probs=42.2

Q ss_pred             HHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHCCCCCEEEEECCCCHHHHHCCCCCCCHHHHHH-HHHHHHHCCCCCCCE
Q ss_conf             9999887621368832410256999999987415760697513437777320588889899999-999999879855770
Q gi|254780485|r  124 IIVDMIKGVKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQ-TLENVRKSGIKVCCG  202 (328)
Q Consensus       124 ~~~e~i~~i~~~~~~i~~~~g~~~~~~~~~Lk~aG~~~~~~~let~~~~~~~~~~~~~~~~~l~-~~~~a~~~G~~~~sg  202 (328)
                      ...+.++.++..+..+++.-.-.....+..+....+|.+.+    ++.+...+. .......++ ....|+++|+++.+.
T Consensus       132 ~~~~~i~~lk~~G~~iaiDdfG~~~~~~~~l~~l~~d~iKi----d~~~~~~~~-~~~~~~~~~~l~~~a~~~~~~viae  206 (233)
T pfam00563       132 RLLEALARLRSLGFRLALDDFGTGYSSLSYLSRLPPDYIKI----DRSFIKDLS-DPESRALLRALIALARELGIKVVAE  206 (233)
T ss_pred             HHHHHHHHHHHCCCCEEECCCCCCCCCHHHHHHCCCCEEEE----CHHHHHHCC-CCCHHHHHHHHHHHHHHCCCEEEEE
T ss_conf             99999999997799589617899976778997488878999----899984077-7218999999999999879989997


Q ss_pred             EEECCCCCHHHHHHHHHHHHHCCC
Q ss_conf             786689899999999999974088
Q gi|254780485|r  203 GILGLGEMIDDRIDMLLTLANLST  226 (328)
Q Consensus       203 ~l~G~gEt~eeri~~l~~lr~l~~  226 (328)
                      .    +|+.++    +..+++++.
T Consensus       207 G----VE~~~~----~~~l~~~Gv  222 (233)
T pfam00563       207 G----VETEEQ----LELLKELGI  222 (233)
T ss_pred             E----CCCHHH----HHHHHHCCC
T ss_conf             0----863999----999997599


No 324
>COG2350 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=41.58  E-value=24  Score=15.33  Aligned_cols=34  Identities=15%  Similarity=0.055  Sum_probs=26.2

Q ss_pred             CHHHHHHHHHHHHHCCCCCCEEECCCEEECCCCC
Q ss_conf             9999999999997408888602054112048741
Q gi|254780485|r  210 MIDDRIDMLLTLANLSTPPESIPINLLIPIPGSK  243 (328)
Q Consensus       210 t~eeri~~l~~lr~l~~~~~~v~~~~~~p~~gt~  243 (328)
                      ..+.|-.|+.+|+.++.....+..+||.+..|++
T Consensus        17 r~~~r~~H~~~L~~~~a~G~ll~sGP~~~~dg~~   50 (92)
T COG2350          17 RLAVRPAHLARLKQLYAEGRLLTSGPFPDRDGGP   50 (92)
T ss_pred             HHHHHHHHHHHHHHHHHCCEEEEECCCCCCCCCC
T ss_conf             8621488999999753368499847997877897


No 325
>PRK13135 consensus
Probab=41.51  E-value=24  Score=15.26  Aligned_cols=182  Identities=16%  Similarity=0.107  Sum_probs=100.5

Q ss_pred             CHHHHHHHHHHHHHCCCEEEEEECCCCCCCCC-----------------CHHHHHHHHHHHCCC-C-CCEEEECCCCC--
Q ss_conf             85799999999996498389973036888744-----------------289999988762136-8-83241025699--
Q gi|254780485|r   89 NVDQVLKEAKNAKENGATRYCMGAAWREPKER-----------------DLSIIVDMIKGVKSL-G-LETCMTLGMLS--  147 (328)
Q Consensus        89 ~~Eei~~~a~~~~~~G~~~~~l~~~~~~~~~~-----------------~~~~~~e~i~~i~~~-~-~~i~~~~g~~~--  147 (328)
                      +.|.-++.++.+.+.|+.-+-++ -...++.-                 .++.++++++.++.. . +.+.+  +..+  
T Consensus        29 ~~~~s~~~l~~l~~~GaDiiElG-iPfSDP~ADGPvIq~A~~rAL~~G~~~~~~~~~~~~~r~~~~~PivlM--~Y~N~i  105 (267)
T PRK13135         29 DLATTEALIPLLAESGADIIELG-VPFSDPMADGPTIQLSSERALAAGTTLPRILAMVRSVRRRCQVPIVLM--GYYNPI  105 (267)
T ss_pred             CHHHHHHHHHHHHHCCCCEEEEC-CCCCCCCCCCHHHHHHHHHHHHCCCCHHHHHHHHHHHHCCCCCCEEEE--ECCHHH
T ss_conf             98999999999997599999978-998986665899999999999769849999999998633589988998--423099


Q ss_pred             -----HHHHHHHHCCCCCEEEEECCCCHHHHHCCCCCCCHHHHHHHHHHHHHCCCCCCCEEEECCCCCHHHHHHHHHHHH
Q ss_conf             -----999998741576069751343777732058888989999999999987985577078668989999999999997
Q gi|254780485|r  148 -----FEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLA  222 (328)
Q Consensus       148 -----~~~~~~Lk~aG~~~~~~~let~~~~~~~~~~~~~~~~~l~~~~~a~~~G~~~~sg~l~G~gEt~eeri~~l~~lr  222 (328)
                           +.-++..+++|++.+.+             |.-.+++.-+....+.+.|+..-  .++- --|.++|+..+....
T Consensus       106 ~~yG~e~F~~~~~~~GvdGlIi-------------pDLP~ee~~~~~~~~~~~~l~~I--~lvs-Ptt~~~Ri~~i~~~s  169 (267)
T PRK13135        106 FAYGLERFAADAAAAGVDGVLL-------------VDLPPEEAEEFKACADRHGLDVI--FLLT-PTSDESRIRTVARLG  169 (267)
T ss_pred             HHHHHHHHHHHHHHCCCCEEEC-------------CCCCHHHHHHHHHHHHHCCCCEE--EEEC-CCCCHHHHHHHHHCC
T ss_conf             8846899999999749974763-------------78997888999999987296189--9808-989579999999618


Q ss_pred             HCCCCCCEEECCCEEECCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCEEEEHHHHHCHHHHHHHHHHCCCEEEECCEE
Q ss_conf             40888860205411204874124456879899999999999968687214231156516568999998099889977866
Q gi|254780485|r  223 NLSTPPESIPINLLIPIPGSKFEENKKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTL  302 (328)
Q Consensus       223 ~l~~~~~~v~~~~~~p~~gt~l~~~~~~~~~e~lr~iAi~RL~lP~~~i~i~~~~~~~~~~~~~~~L~~GaN~~~~g~~~  302 (328)
                           ..++-   .+...|+.-  .......+....+.-.|-..   .+++..|-.--.++..+ .+..+||++++|..+
T Consensus       170 -----~GFiY---~Vs~~GvTG--~~~~~~~~~~~~i~~ik~~t---~~Pv~vGFGI~~~e~v~-~i~~~ADGvIVGSai  235 (267)
T PRK13135        170 -----RGFVY---YVSVTGVTG--ARSGVEATVGGNVAKIREKI---TVPVVVGFGISTPQQAA-DVAAMADGVVVGSAL  235 (267)
T ss_pred             -----CCEEE---EEECCCCCC--CCCCCHHHHHHHHHHHHHHC---CCCEEEEECCCCHHHHH-HHHCCCCEEEECHHH
T ss_conf             -----98189---985456667--76444488999999998606---89848981679999999-998059999987899


Q ss_pred             E
Q ss_conf             5
Q gi|254780485|r  303 L  303 (328)
Q Consensus       303 ~  303 (328)
                      +
T Consensus       236 V  236 (267)
T PRK13135        236 V  236 (267)
T ss_pred             H
T ss_conf             9


No 326
>TIGR03247 glucar-dehydr glucarate dehydratase. Glucarate dehydratase converts D-glucarate (and L-idarate, a stereoisomer) to 5-dehydro-4-deoxyglucarate which is subsequently acted on by GarL, tartronate semialdehyde reductase and glycerate kinase (, GenProp0716). The E. coli enzyme has been well-characterized.
Probab=41.49  E-value=24  Score=15.26  Aligned_cols=107  Identities=14%  Similarity=0.139  Sum_probs=58.5

Q ss_pred             CCCCHHHHHHHHHHHHHC-CCEEEEEECCCCCCCCCCHHHHHHHHHHHCCCCCCEEEEC---CCCCHHHHHHHHCCCCCE
Q ss_conf             006857999999999964-9838997303688874428999998876213688324102---569999999874157606
Q gi|254780485|r   86 KLINVDQVLKEAKNAKEN-GATRYCMGAAWREPKERDLSIIVDMIKGVKSLGLETCMTL---GMLSFEQAQILSKAGLDY  161 (328)
Q Consensus        86 ~~~~~Eei~~~a~~~~~~-G~~~~~l~~~~~~~~~~~~~~~~e~i~~i~~~~~~i~~~~---g~~~~~~~~~Lk~aG~~~  161 (328)
                      .-+++|.+++.|+.+.+. |++-+-+-+|.- ++    ++-+++++++++.++..-+.+   |..+.++..++-.. +..
T Consensus       177 ealtpe~iv~~A~a~~~~yGF~~~KLKgGV~-~~----~eEi~~v~AL~eafP~~~lrlDPNgaWs~~~Airl~r~-l~~  250 (441)
T TIGR03247       177 EALTPEAVVRLAEAAYDRYGFRDFKLKGGVL-RG----EEEIEAVTALAKRFPQARITLDPNGAWSLDEAIALCKD-LKG  250 (441)
T ss_pred             CCCCHHHHHHHHHHHHHHCCCCEEEECCCCC-CH----HHHHHHHHHHHHHCCCCCEEECCCCCCCHHHHHHHHHH-HHC
T ss_conf             1289999999999988741860044147888-81----88999999999868998662579988688999999997-234


Q ss_pred             EEEECCCCHHHHHCCCCCCCHHHHHHHHHH-HHHCCCCCCCEEEE
Q ss_conf             975134377773205888898999999999-99879855770786
Q gi|254780485|r  162 YNHNIDTSERFYPHVTTTHTFEDRLQTLEN-VRKSGIKVCCGGIL  205 (328)
Q Consensus       162 ~~~~let~~~~~~~~~~~~~~~~~l~~~~~-a~~~G~~~~sg~l~  205 (328)
                      +.-++|       .=|+....--=.++|.. .++.|+++.+.|+.
T Consensus       251 ~l~Y~E-------DP~~~e~g~~gre~MAe~r~~t~iPlATNm~~  288 (441)
T TIGR03247       251 VLAYAE-------DPCGAEQGYSGREVMAEFRRATGLPTATNMIA  288 (441)
T ss_pred             CHHHHC-------CCCCCCCCCCHHHHHHHHHHCCCCCCCCCEEE
T ss_conf             055651-------88754467226899999985389873023165


No 327
>PRK13810 orotate phosphoribosyltransferase; Provisional
Probab=41.39  E-value=24  Score=15.25  Aligned_cols=13  Identities=31%  Similarity=0.452  Sum_probs=5.8

Q ss_pred             HHHHHHHHHCCCC
Q ss_conf             9999999987985
Q gi|254780485|r  186 LQTLENVRKSGIK  198 (328)
Q Consensus       186 l~~~~~a~~~G~~  198 (328)
                      +++++..++.|..
T Consensus       139 ~eai~~l~~~G~~  151 (187)
T PRK13810        139 RDAIEVVREAGAI  151 (187)
T ss_pred             HHHHHHHHHCCCE
T ss_conf             9999999988997


No 328
>PRK13136 consensus
Probab=41.26  E-value=24  Score=15.23  Aligned_cols=203  Identities=14%  Similarity=0.170  Sum_probs=112.4

Q ss_pred             CCHHHHHHHHHHHHHCCCEEEEEECCCCCCC-CC---------------CHHHHHHHHHHHCCC-CCC-EEE---EC-CC
Q ss_conf             6857999999999964983899730368887-44---------------289999988762136-883-241---02-56
Q gi|254780485|r   88 INVDQVLKEAKNAKENGATRYCMGAAWREPK-ER---------------DLSIIVDMIKGVKSL-GLE-TCM---TL-GM  145 (328)
Q Consensus        88 ~~~Eei~~~a~~~~~~G~~~~~l~~~~~~~~-~~---------------~~~~~~e~i~~i~~~-~~~-i~~---~~-g~  145 (328)
                      -+.|.-++.++.+.+.|+.-+-++-=.-+|. +.               .++.+.++++.+++. ... +.+   |. .-
T Consensus        23 P~~e~s~~~~~~l~~~G~DiiElGiPfSDP~ADGpvIq~A~~rAL~~G~~~~~~~~~v~~~r~~~~~pivlM~Y~N~i~~  102 (253)
T PRK13136         23 GGLERSLESLLALAKGGVNILEVGVPFSDPVADGPVIQEASIRALAQGTTLHDVLTLITSFRQHSEIPIILFTYFNPLLA  102 (253)
T ss_pred             CCHHHHHHHHHHHHHCCCCEEEECCCCCCCCCCCHHHHHHHHHHHHCCCCHHHHHHHHHHHCCCCCCCEEEECCCHHHHH
T ss_conf             99899999999999659998997899888666579999999999986997999999999822578988899865179999


Q ss_pred             CCHHHHHHHHCCCCCEEEEECCCCHHHHHCCCCCCCHHHHHHHHHHHHHCCCCCCCEEEECCCCCHHHHHHHHHHHHHCC
Q ss_conf             99999998741576069751343777732058888989999999999987985577078668989999999999997408
Q gi|254780485|r  146 LSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLS  225 (328)
Q Consensus       146 ~~~~~~~~Lk~aG~~~~~~~let~~~~~~~~~~~~~~~~~l~~~~~a~~~G~~~~sg~l~G~gEt~eeri~~l~~lr~l~  225 (328)
                      ..++-+++.+++|++.+.+             |.-.+++--+..+.+++.|+..-  .++- --|.++|+..+.....  
T Consensus       103 ~G~~f~~~~~~~GvdGlIi-------------pDLP~eE~~~~~~~~~~~~i~~I--~lia-Ptt~~eRi~~i~~~a~--  164 (253)
T PRK13136        103 AGDKIYQQMKSAGVDGCLV-------------VDLPVEEAAPHLTACKTAKIAPI--LLIS-PSTTQERLKKINEHGE--  164 (253)
T ss_pred             HHHHHHHHHHHCCCCCEEC-------------CCCCHHHHHHHHHHHHHCCCCCE--EEEC-CCCCHHHHHHHHHCCC--
T ss_conf             7999999999749872006-------------78997776999999997588712--5526-8998899999996089--


Q ss_pred             CCCCEEECCCEEECCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCEEEEHHHHHCHHHHHHHHHHCCCEEEECCEEE--
Q ss_conf             888602054112048741244568798999999999999686872142311565165689999980998899778665--
Q gi|254780485|r  226 TPPESIPINLLIPIPGSKFEENKKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLL--  303 (328)
Q Consensus       226 ~~~~~v~~~~~~p~~gt~l~~~~~~~~~e~lr~iAi~RL~lP~~~i~i~~~~~~~~~~~~~~~L~~GaN~~~~g~~~~--  303 (328)
                         .++   ..+...|+.-..  ..-+.+....+.-.|-.-   .+++..|-.--.++..+..... ||++++|..++  
T Consensus       165 ---gFi---Y~vs~~GvTG~~--~~~~~~~~~~i~~ik~~t---~~Pv~vGFGIs~~e~v~~~~~~-ADGvIVGSaiV~~  232 (253)
T PRK13136        165 ---GML---YYVCRPGTTGVR--ATLPENFPAKMNQIKSMT---SLPIVTGFGIANRKMAAQALQY-ADGFVIGSLFVKA  232 (253)
T ss_pred             ---CEE---EEEECCCCCCCC--CCCHHHHHHHHHHHHHHC---CCCEEEECCCCCHHHHHHHHHH-CCEEEECHHHHHH
T ss_conf             ---819---998555236876--446388999999999726---9986997154999999999822-9999985899999


Q ss_pred             CCCCCCHHHHHHHHHHC
Q ss_conf             15888989999999982
Q gi|254780485|r  304 TAKNPSYNKDTILFNRL  320 (328)
Q Consensus       304 t~~g~~~~~~~~~i~~~  320 (328)
                      -..|.+.++..++.+.+
T Consensus       233 i~e~~~~~~~~~~~~~l  249 (253)
T PRK13136        233 IAEGISKNALTRLAQSL  249 (253)
T ss_pred             HHHCCCHHHHHHHHHHH
T ss_conf             98649988999999870


No 329
>PRK07107 inositol-5-monophosphate dehydrogenase; Validated
Probab=40.56  E-value=25  Score=15.16  Aligned_cols=147  Identities=16%  Similarity=0.138  Sum_probs=68.4

Q ss_pred             CCCEEEECCCCCH-HHHHHHHCCCCCEEEEECCCCHHHHHCCCCCCCHHHHHHHHHHHHHCCCCCCCEEEECCCCCHHHH
Q ss_conf             8832410256999-999987415760697513437777320588889899999999999879855770786689899999
Q gi|254780485|r  136 GLETCMTLGMLSF-EQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSGIKVCCGGILGLGEMIDDR  214 (328)
Q Consensus       136 ~~~i~~~~g~~~~-~~~~~Lk~aG~~~~~~~let~~~~~~~~~~~~~~~~~l~~~~~a~~~G~~~~sg~l~G~gEt~eer  214 (328)
                      .+.+.+.+|..+. +-.+.|.++|+|.+.  +||+-.        | ...-++++++.++. ++...-++.|=.-|.+-.
T Consensus       231 rL~VgAAIg~~d~~eRa~~Lv~aGvD~lv--iD~AhG--------h-s~~v~~~ik~ik~~-~~~~~~i~aGNVaT~~~~  298 (497)
T PRK07107        231 RYVVGAGINTRDYEERVPALVEAGADVLC--IDSSDG--------Y-SEWQKRTLDYIKEK-YGDTVKVGAGNVVDRDGF  298 (497)
T ss_pred             CEEEEEECCCCCHHHHHHHHHHCCCCEEE--ECCCCC--------C-HHHHHHHHHHHHHH-CCCCCCCCCCCHHCHHHH
T ss_conf             88899963777899999999985999998--034353--------5-29999999999986-698763414521269999


Q ss_pred             HHHHHHHHH---CCCCCCEEECCCEEECCCCCCCCCCCCCHHHHHHHHHHHHHHCCC--CCCE-EEEHHHHHCHHHHHHH
Q ss_conf             999999974---088886020541120487412445687989999999999996868--7214-2311565165689999
Q gi|254780485|r  215 IDMLLTLAN---LSTPPESIPINLLIPIPGSKFEENKKVDPIEHVRIISVARILMPK--SRLR-LAAGRAMMSDELQALC  288 (328)
Q Consensus       215 i~~l~~lr~---l~~~~~~v~~~~~~p~~gt~l~~~~~~~~~e~lr~iAi~RL~lP~--~~i~-i~~~~~~~~~~~~~~~  288 (328)
                      .+.+..-.+   .+.-+.++-.  -.-..|   -+.|+.++.  +.+-.+++=+.-.  ..++ |+-|=.+...+. -+|
T Consensus       299 ~~L~~aGad~vkVGiGpGSiCt--Tr~v~g---vG~pQ~sAv--~~~a~~~~~~~~~~g~~vpiiADGGi~~sGDi-~KA  370 (497)
T PRK07107        299 LYLAEAGADFVKVGIGGGSICI--TREQKG---IGRGQATAL--IDVAKARDEYFERTGVYIPICSDGGIVHDYHM-TLA  370 (497)
T ss_pred             HHHHHCCCCEEEECCCCCCCCE--ECCCCC---CCCCHHHHH--HHHHHHHHHHHHHCCCCCEEECCCCCCCCCHH-HHH
T ss_conf             9999808986897115996621--130125---677348899--99999988877741676328717875655459-999


Q ss_pred             HHHCCCEEEECCEE
Q ss_conf             98099889977866
Q gi|254780485|r  289 FFSGANSIFVGDTL  302 (328)
Q Consensus       289 L~~GaN~~~~g~~~  302 (328)
                      |-+||+.+|+|..+
T Consensus       371 laaGA~~VMlGsll  384 (497)
T PRK07107        371 LAMGADFIMLGRYF  384 (497)
T ss_pred             HHCCCCEEEECCCC
T ss_conf             85389889988110


No 330
>pfam00962 A_deaminase Adenosine/AMP deaminase.
Probab=40.50  E-value=25  Score=15.16  Aligned_cols=39  Identities=21%  Similarity=0.239  Sum_probs=21.2

Q ss_pred             CCCHHHHHHHHHHHHHCCCCCCCEEEECCCCCHHHHHHHHH
Q ss_conf             88989999999999987985577078668989999999999
Q gi|254780485|r  179 THTFEDRLQTLENVRKSGIKVCCGGILGLGEMIDDRIDMLL  219 (328)
Q Consensus       179 ~~~~~~~l~~~~~a~~~G~~~~sg~l~G~gEt~eeri~~l~  219 (328)
                      +..+.+..+..+.|++.|++++.+.  |=....++..+.+.
T Consensus       174 ~~~~~~f~~~f~~a~~~gl~~T~Ha--GE~~~~~~v~~ai~  212 (329)
T pfam00962       174 GEPLPDFLYAFAEAGKYGLHLTPHA--GEAGGPQSVVDALL  212 (329)
T ss_pred             CCCHHHHHHHHHHHHHCCCCEEEEC--CCCCCHHHHHHHHH
T ss_conf             7997999999999998098126734--78898899999998


No 331
>COG3246 Uncharacterized conserved protein [Function unknown]
Probab=39.99  E-value=26  Score=15.11  Aligned_cols=229  Identities=19%  Similarity=0.144  Sum_probs=104.7

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCEEEEEECC-CCCCCCCCHHHHHHHHHHHCCCCC--CEEEECC
Q ss_conf             2321243354777564100068579999999999649838997303-688874428999998876213688--3241025
Q gi|254780485|r   68 NCGYCNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAA-WREPKERDLSIIVDMIKGVKSLGL--ETCMTLG  144 (328)
Q Consensus        68 ~C~fCaf~~~~~~~~~~~~~~~~Eei~~~a~~~~~~G~~~~~l~~~-~~~~~~~~~~~~~e~i~~i~~~~~--~i~~~~g  144 (328)
                      .|.-|+ +++.++..+. .-.+++||.+.|.++.+.|+.-+++--- ...-+..+.+-|.+.+..||+...  .+..+.|
T Consensus         8 tcAvtG-a~~T~~~~Pa-lP~TP~qIA~~a~~aa~AGAai~HlHvRp~dG~pt~d~~~yr~~l~rIr~~~~D~vin~ttg   85 (298)
T COG3246           8 TCAVTG-ARHTPADHPA-LPVTPDQIASDAIAAAKAGAAILHLHVRPEDGRPTLDPEAYREVLERIRAAVGDAVINLTTG   85 (298)
T ss_pred             EEECCC-CCCCCCCCCC-CCCCHHHHHHHHHHHHHCCCCEEEEEECCCCCCCCCCHHHHHHHHHHHHCCCCCEEEEECCC
T ss_conf             983168-8678566999-99999999999999996484168987458999866699999999999971489869995044


Q ss_pred             C------CCHHHHH--HHHCCCCCEEEEECCCCHHHHHCCCCCCCHHHHH-HHHHHHHHCCCCCCCEEEECCC-----CC
Q ss_conf             6------9999999--8741576069751343777732058888989999-9999999879855770786689-----89
Q gi|254780485|r  145 M------LSFEQAQ--ILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRL-QTLENVRKSGIKVCCGGILGLG-----EM  210 (328)
Q Consensus       145 ~------~~~~~~~--~Lk~aG~~~~~~~let~~~~~~~~~~~~~~~~~l-~~~~~a~~~G~~~~sg~l~G~g-----Et  210 (328)
                      .      .+++...  .++.-+.+..+.+                  .++ .+.+.+++.+.-.+.++.++-+     -+
T Consensus        86 ~g~~~~~~~~er~~~~~~~Pe~~~~~~~~------------------~~~~~v~el~~e~~~~~~~~~~~~~~d~vf~nt  147 (298)
T COG3246          86 EGGDLVMPTEERASPWALRPEALSMNLSE------------------FRLPHVLELLPEIGTLDEGGLNFAERDEVFRNL  147 (298)
T ss_pred             CCCCCCCCHHHHCCCCCCCCCCCCCCCCC------------------CCCHHHHHHHHHHHHCCCCCCCCCCCCEEEECC
T ss_conf             45556556565415554587512233311------------------362779987587663213200034664257537


Q ss_pred             HHHH--------------------HHHHHHHHHCCCCCCEEECCC-EEECCCCCCCCCCCCCHHHHHHHHHHHHHHCCCC
Q ss_conf             9999--------------------999999974088886020541-1204874124456879899999999999968687
Q gi|254780485|r  211 IDDR--------------------IDMLLTLANLSTPPESIPINL-LIPIPGSKFEENKKVDPIEHVRIISVARILMPKS  269 (328)
Q Consensus       211 ~eer--------------------i~~l~~lr~l~~~~~~v~~~~-~~p~~gt~l~~~~~~~~~e~lr~iAi~RL~lP~~  269 (328)
                      ..+.                    ..|+..+..+..  +++.-++ +++.-    -+.+..-+.+..-+.+.+....+++
T Consensus       148 ~~~~r~~~~~~~~~gvrpele~~D~ghl~~~~~l~~--~g~~~ppll~q~~----~gi~~g~p~~~~~~~~m~d~~~~~~  221 (298)
T COG3246         148 PGDLRAVRRRIEELGVRPELECADTGHLYFAGRLAD--EGLLEPPLLHQFV----LGILGGAPADLNTMKAMADRLPSGT  221 (298)
T ss_pred             HHHHHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHHH--CCCCCCCHHHHHH----HCCCCCCCCHHHHHHHHHHCCCCCC
T ss_conf             678999999988627666744132788999998612--4767873555333----3145677503678998875278787


Q ss_pred             CCE-EEEHHHHHCHHHHHHHHHHCCCE-EEECCEEECCCC-------CCHHHHHHHHHHCCCCC
Q ss_conf             214-23115651656899999809988-997786651588-------89899999999829853
Q gi|254780485|r  270 RLR-LAAGRAMMSDELQALCFFSGANS-IFVGDTLLTAKN-------PSYNKDTILFNRLGLIP  324 (328)
Q Consensus       270 ~i~-i~~~~~~~~~~~~~~~L~~GaN~-~~~g~~~~t~~g-------~~~~~~~~~i~~~G~~P  324 (328)
                      .=+ ++.||-.+  ...-.+...|-|+ +=.++++.-.+|       .-++..++.++.+|...
T Consensus       222 ~Ws~~~~GR~qm--~~~a~AallGGnvRVGlEDnl~L~kG~lA~sNa~LV~ra~~i~~~lg~~i  283 (298)
T COG3246         222 TWSVLAIGRQQM--PLAAQAALLGGNVRVGLEDNLWLPKGSLAKSNADLVERARRIVEALGAEI  283 (298)
T ss_pred             EEEEEECCHHHC--HHHHHHHHHCCCEEEECCCCEECCCCCCCCCHHHHHHHHHHHHHHCCCCC
T ss_conf             110000143223--25899997178637741232353789607654999999999998538876


No 332
>PRK00455 pyrE orotate phosphoribosyltransferase; Validated
Probab=39.47  E-value=26  Score=15.06  Aligned_cols=22  Identities=27%  Similarity=0.447  Sum_probs=13.5

Q ss_pred             HHHHHHHHHHCCCCC-CCEEEEC
Q ss_conf             999999999879855-7707866
Q gi|254780485|r  185 RLQTLENVRKSGIKV-CCGGILG  206 (328)
Q Consensus       185 ~l~~~~~a~~~G~~~-~sg~l~G  206 (328)
                      -+++++.+++.|..+ ....++-
T Consensus       127 ~~~ai~~l~~~G~~V~~v~vivD  149 (200)
T PRK00455        127 VLEAVEAIRAAGAEVVGVAVIVD  149 (200)
T ss_pred             HHHHHHHHHHCCCEEEEEEEEEE
T ss_conf             99999999987997999999995


No 333
>PRK08562 rpl32e 50S ribosomal protein L32e; Validated
Probab=38.99  E-value=26  Score=15.00  Aligned_cols=64  Identities=16%  Similarity=0.213  Sum_probs=38.7

Q ss_pred             CCEEEECCCCCHHHHHHHHCCCCCEEEEE----CCC-CHHHH-HCCCCCCCHHHHHHHHHHHHHCCCCCC
Q ss_conf             83241025699999998741576069751----343-77773-205888898999999999998798557
Q gi|254780485|r  137 LETCMTLGMLSFEQAQILSKAGLDYYNHN----IDT-SERFY-PHVTTTHTFEDRLQTLENVRKSGIKVC  200 (328)
Q Consensus       137 ~~i~~~~g~~~~~~~~~Lk~aG~~~~~~~----let-~~~~~-~~~~~~~~~~~~l~~~~~a~~~G~~~~  200 (328)
                      .....++|.-+....+.|.-.|...+.+.    ||. .++.+ ..+..+.+...+.++++.|.++|+++.
T Consensus        56 ~~~mp~iGYgs~k~~Rgl~PsG~~~vlV~n~~dLe~L~~~~~a~~Ia~~Vg~kKR~~I~erA~el~ikV~  125 (127)
T PRK08562         56 KPAPVEVGYRSPKAVRGLHPSGYEEVLVHNVKELEALDPETQAARIASTVGKRKRIEIVKKAKELGIKVL  125 (127)
T ss_pred             CCCCCCCCCCCCHHHCCCCCCCCEEEEECCHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHHHHCCCCCC
T ss_conf             7788757778758766869776878886788998854887648998734330359999999998198716


No 334
>TIGR00337 PyrG CTP synthase; InterPro: IPR004468 CTP synthase is involved in pyrimidine ribonucleotide/ribonucleoside metabolism. The enzyme catalyzes the reaction L-glutamine + H2O + UTP + ATP = CTP + phosphate + ADP + L-glutamate. The enzyme exists as a dimer of identical chains that aggregates as a tetramer. This gene has been found circa 500 bp 5 upstream of enolase in both beta (Nitrosomonas europaea) and gamma (Escherichia coli) subdivisions of Proteobacterium .; GO: 0003883 CTP synthase activity, 0006221 pyrimidine nucleotide biosynthetic process.
Probab=38.92  E-value=27  Score=15.00  Aligned_cols=73  Identities=16%  Similarity=0.188  Sum_probs=48.4

Q ss_pred             HHHHHHHHHHHHC-----C-CEEEEEECCCCCCCCCCHH--HHHHHHHHHCC-----CCCCEEEEC-------C----CC
Q ss_conf             7999999999964-----9-8389973036888744289--99998876213-----688324102-------5----69
Q gi|254780485|r   91 DQVLKEAKNAKEN-----G-ATRYCMGAAWREPKERDLS--IIVDMIKGVKS-----LGLETCMTL-------G----ML  146 (328)
Q Consensus        91 Eei~~~a~~~~~~-----G-~~~~~l~~~~~~~~~~~~~--~~~e~i~~i~~-----~~~~i~~~~-------g----~~  146 (328)
                      +||.+.++.+.+.     | -..+||+--|.  ...|+|  -++|+||.++.     ..+.+|+++       |    -.
T Consensus       122 nEIK~~I~~~A~~P~eDtG~~~Dv~IvEiGG--TVGDIEs~PFLEAiRQ~~~e~G~Env~~iHvTLVP~i~aagE~KTKP  199 (571)
T TIGR00337       122 NEIKDRIKRVAKKPVEDTGSGADVVIVEIGG--TVGDIESLPFLEAIRQLKKEVGRENVLFIHVTLVPYIAAAGELKTKP  199 (571)
T ss_pred             HHHHHHHHHHHCCCCCCCCCCCCEEEEEECC--CCCCCCCHHHHHHHHHHHHHHCCCCEEEEEEEECCCCCCCCCCCCCC
T ss_conf             6789999996037764567997479998377--00000362589999999987389867999840026314487478775


Q ss_pred             CHHHHHHHHCCCC--CEEEEE
Q ss_conf             9999998741576--069751
Q gi|254780485|r  147 SFEQAQILSKAGL--DYYNHN  165 (328)
Q Consensus       147 ~~~~~~~Lk~aG~--~~~~~~  165 (328)
                      |+...+.|+..|+  |.+.++
T Consensus       200 TQhSVKeLRs~Gi~PD~i~cR  220 (571)
T TIGR00337       200 TQHSVKELRSLGIQPDIIICR  220 (571)
T ss_pred             CHHHHHHHHHCCCCCCEEEEC
T ss_conf             127899998609888689981


No 335
>pfam01373 Glyco_hydro_14 Glycosyl hydrolase family 14. This family are beta amylases.
Probab=38.86  E-value=27  Score=14.99  Aligned_cols=12  Identities=25%  Similarity=-0.053  Sum_probs=6.3

Q ss_pred             HHHHHHHHHCCC
Q ss_conf             999999996868
Q gi|254780485|r  257 RIISVARILMPK  268 (328)
Q Consensus       257 r~iAi~RL~lP~  268 (328)
                      |+++++|.+++.
T Consensus       251 rvL~~A~~~F~~  262 (399)
T pfam01373       251 VIGSAAHKNFDP  262 (399)
T ss_pred             HHHHHHHHHHCC
T ss_conf             999999986088


No 336
>cd04723 HisA_HisF Phosphoribosylformimino-5-aminoimidazole carboxamide ribonucleotide (ProFAR) isomerase (HisA) and the cyclase subunit of imidazoleglycerol phosphate synthase (HisF). The ProFAR isomerase catalyzes the fourth step in histidine biosynthesis, an isomerisation of the aminoaldose moiety of ProFAR to the aminoketose of PRFAR (N-(5'-phospho-D-1'-ribulosylformimino)-5-amino-1-(5''-phospho-ribosyl)-4-imidazolecarboxamide). In bacteria and archaea, ProFAR isomerase is encoded by the HisA gene. The Imidazole glycerol phosphate synthase (IGPS) catalyzes the fifth step of histidine biosynthesis, the formation of the imidazole ring. IGPS converts N1-(5'-phosphoribulosyl)-formimino-5-aminoimidazole-4-carboxamide ribonucleotide (PRFAR) to imidazole glycerol phosphate (ImGP) and 5'-(5-aminoimidazole-4-carboxamide) ribonucleotide (AICAR). This conversion involves two tightly coupled reactions in distinct active sites of IGPS. The two catalytic domains can be fused, like in fungi and pl
Probab=38.81  E-value=27  Score=14.99  Aligned_cols=187  Identities=18%  Similarity=0.099  Sum_probs=93.6

Q ss_pred             HHHHHHHHHHHHCCCEEEEEECCCCCCCCCCHHHHHHHHHHH-CCCCCCEEEECCCCCHHHHHHHHCCCCCEEEEECCCC
Q ss_conf             799999999996498389973036888744289999988762-1368832410256999999987415760697513437
Q gi|254780485|r   91 DQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGV-KSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTS  169 (328)
Q Consensus        91 Eei~~~a~~~~~~G~~~~~l~~~~~~~~~~~~~~~~e~i~~i-~~~~~~i~~~~g~~~~~~~~~Lk~aG~~~~~~~let~  169 (328)
                      ...++.|+...+.|+.+++++--. .......  -.++++.+ ++.++.+.+.-|..+.++.+++.++|++.+.++-++.
T Consensus        35 ~dP~~~a~~~~~~ga~~lhivDLd-a~~g~~~--n~~~I~~i~~~~~~pi~vGGGIrs~~~~~~~l~~Gadkvvigs~~~  111 (233)
T cd04723          35 SDPLDVARAYKELGFRGLYIADLD-AIMGRGD--NDEAIRELAAAWPLGLWVDGGIRSLENAQEWLKRGASRVIVGTETL  111 (233)
T ss_pred             CCHHHHHHHHHHCCCCEEEEEECC-CCCCCCC--HHHHHHHHHHHCCCCEEEECCCCCHHHHHHHHHCCCCEEECCCHHC
T ss_conf             799999999998798989999786-5469975--3999999998789988997022769999999860720152451004


Q ss_pred             HHHHHCCCCCCCHHHHHHHHHHHHHCCCC-CCC--------EEEECCCCCHHHHHHHHHHHHHCCCCCCEEECCCEEECC
Q ss_conf             77732058888989999999999987985-577--------078668989999999999997408888602054112048
Q gi|254780485|r  170 ERFYPHVTTTHTFEDRLQTLENVRKSGIK-VCC--------GGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIP  240 (328)
Q Consensus       170 ~~~~~~~~~~~~~~~~l~~~~~a~~~G~~-~~s--------g~l~G~gEt~eeri~~l~~lr~l~~~~~~v~~~~~~p~~  240 (328)
                      ..           ....   +.+.+.|-+ +..        ....|-.+..++.++   .+.+.   ...+-+.- +-..
T Consensus       112 ~~-----------~~~~---~~~~~~g~~~ivvslD~k~~~~~~~~~~~~~~~~~~---~~~~~---~~eii~t~-Id~d  170 (233)
T cd04723         112 PS-----------DDDE---DRLAALGEQRLVLSLDFRGGQLLKPTDFIGPEELLR---RLAKW---PEELIVLD-IDRV  170 (233)
T ss_pred             CC-----------HHHH---HHHHHHCCCCEEEEEEEECCCCCCCCCCCCHHHHHH---HHHHH---CCEEEEEE-ECCC
T ss_conf             99-----------8999---999997899989999998997872464348999999---99965---89599986-4344


Q ss_pred             CCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCEEEEHHHHHCHHHHHHHHHHCCCEEEECCEEECCCCCCHHHH
Q ss_conf             7412445687989999999999996868721423115651656899999809988997786651588898999
Q gi|254780485|r  241 GSKFEENKKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKD  313 (328)
Q Consensus       241 gt~l~~~~~~~~~e~lr~iAi~RL~lP~~~i~i~~~~~~~~~~~~~~~L~~GaN~~~~g~~~~t~~g~~~~~~  313 (328)
                      ||-     .....+.++-++  .. . +..+.+++|--++ .+.. .....|++++++|.-+ -.+.-+.++.
T Consensus       171 Gt~-----~G~d~~l~~~i~--~~-~-~~pvi~sGGv~s~-~di~-~l~~~g~~gvivg~al-h~g~i~l~e~  231 (233)
T cd04723         171 GSG-----QGPDLELLERLA--AR-A-DIPVIAAGGVRSV-EDLE-LLKKLGASGALVASAL-HDGGLTLEDV  231 (233)
T ss_pred             CCC-----CCCCHHHHHHHH--HH-C-CCCEEEECCCCCH-HHHH-HHHHCCCCEEEEEHHH-HCCCCCHHHH
T ss_conf             656-----777999999999--86-8-9989998899999-9999-9997899899986397-7899788997


No 337
>COG3867 Arabinogalactan endo-1,4-beta-galactosidase [Carbohydrate transport and metabolism]
Probab=38.79  E-value=27  Score=14.98  Aligned_cols=95  Identities=15%  Similarity=0.078  Sum_probs=45.8

Q ss_pred             CCHHHHHHHHCCCCC--EEEEECCCCHHHH-HCCCCCCCHHHHHHHHHHHHHCCCCCCCEEEEC--C--CCCHHHHHHH-
Q ss_conf             999999987415760--6975134377773-205888898999999999998798557707866--8--9899999999-
Q gi|254780485|r  146 LSFEQAQILSKAGLD--YYNHNIDTSERFY-PHVTTTHTFEDRLQTLENVRKSGIKVCCGGILG--L--GEMIDDRIDM-  217 (328)
Q Consensus       146 ~~~~~~~~Lk~aG~~--~~~~~let~~~~~-~~~~~~~~~~~~l~~~~~a~~~G~~~~sg~l~G--~--gEt~eeri~~-  217 (328)
                      -+++.+..|++.|++  ++-+.-||.-.+. +. ..+..|+.|-+.+..+-++=-.+..++.+-  +  ||+.. +... 
T Consensus       157 yTk~~l~~m~~eGi~pdmVQVGNEtn~gflwp~-Ge~~~f~k~a~L~n~g~~avrev~p~ikv~lHla~g~~n~-~y~~~  234 (403)
T COG3867         157 YTKYVLTTMKKEGILPDMVQVGNETNGGFLWPD-GEGRNFDKMAALLNAGIRAVREVSPTIKVALHLAEGENNS-LYRWI  234 (403)
T ss_pred             HHHHHHHHHHHCCCCCCCEEECCCCCCCEECCC-CCCCCHHHHHHHHHHHHHHHHHCCCCCEEEEEECCCCCCC-HHHHH
T ss_conf             999999999974899451675454677132467-8876768999999977656532489716999934788875-23588


Q ss_pred             HHHHHHCCCCCCEEECCCEEECCCC
Q ss_conf             9999740888860205411204874
Q gi|254780485|r  218 LLTLANLSTPPESIPINLLIPIPGS  242 (328)
Q Consensus       218 l~~lr~l~~~~~~v~~~~~~p~~gt  242 (328)
                      ...|-+-.+..+-|..+......||
T Consensus       235 fd~ltk~nvdfDVig~SyYpyWhgt  259 (403)
T COG3867         235 FDELTKRNVDFDVIGSSYYPYWHGT  259 (403)
T ss_pred             HHHHHHCCCCCEEEEEECCCCCCCC
T ss_conf             8788773898407763125434574


No 338
>TIGR02033 D-hydantoinase dihydropyrimidinase; InterPro: IPR011778    This entry represents the D-hydantoinase (dihydropyrimidinase) which primarily converts 5,6-dihydrouracil to 3-ureidopropanoate but also acts on dihydrothymine and hydantoin. The enzyme is a metalloenzyme ..
Probab=37.35  E-value=28  Score=14.84  Aligned_cols=60  Identities=20%  Similarity=0.209  Sum_probs=25.9

Q ss_pred             HHHCCCEEEEEECCCCCCCCCCHHHHHHHHHHHCCCCC--CEEEECCCCCHHHHHHHHCCCC
Q ss_conf             99649838997303688874428999998876213688--3241025699999998741576
Q gi|254780485|r  100 AKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLGL--ETCMTLGMLSFEQAQILSKAGL  159 (328)
Q Consensus       100 ~~~~G~~~~~l~~~~~~~~~~~~~~~~e~i~~i~~~~~--~i~~~~g~~~~~~~~~Lk~aG~  159 (328)
                      ..+.|++-|-+-.......--+-+.+.++++.+++.+-  .+|+..|.+-.+..+++-+.|.
T Consensus       146 ~~~~Gi~SfK~fMAY~~~l~~~D~~L~~~L~~~~~~GA~~~VHAENgd~ia~~~~~~~a~G~  207 (466)
T TIGR02033       146 LVEEGISSFKVFMAYKNLLMVDDEELFEILKRLKELGALLQVHAENGDVIAELQARLLAQGK  207 (466)
T ss_pred             HHHCCCHHHHHHHHHCHHHCCCCHHHHHHHHHHHHCCCEEEEECCCCHHHHHHHHHHHHCCC
T ss_conf             98625401025546142211575789999999875198178604630589999999996478


No 339
>PRK13137 consensus
Probab=36.89  E-value=28  Score=14.79  Aligned_cols=167  Identities=13%  Similarity=0.137  Sum_probs=88.5

Q ss_pred             HHHHHHHHHHHCCC-CC-CEEEE---C-CC-CCHHHHHHHHCCCCCEEEEECCCCHHHHHCCCCCCCHHHHHHHHHHHHH
Q ss_conf             89999988762136-88-32410---2-56-9999999874157606975134377773205888898999999999998
Q gi|254780485|r  122 LSIIVDMIKGVKSL-GL-ETCMT---L-GM-LSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRK  194 (328)
Q Consensus       122 ~~~~~e~i~~i~~~-~~-~i~~~---~-g~-~~~~~~~~Lk~aG~~~~~~~let~~~~~~~~~~~~~~~~~l~~~~~a~~  194 (328)
                      ++.++++++.+++. .. .+.+.   + .. -.+.-+++.+++|++.+++             |.-.+++--+..+.+++
T Consensus        85 l~~~l~~~~~~r~~~~~PivlM~Y~N~i~~yG~e~F~~~a~~aGvdGlIi-------------pDLP~eE~~~~~~~~~~  151 (266)
T PRK13137         85 TRRTLELVRELRALTDTPLVIMTYLNPIYAVGPEEFMRLFQEAGVDGLIL-------------PDLPPDQDPEIADLAAE  151 (266)
T ss_pred             HHHHHHHHHHHCCCCCCCEEEEECHHHHHHHCHHHHHHHHHHCCCCEEEE-------------CCCCHHHHHHHHHHHHH
T ss_conf             77899999975556898789993458998758999999999769609994-------------79997888999999987


Q ss_pred             CCCCCCCEEEECCCCCHHHHHHHHHHHHHCCCCCCEEECCCEEECCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCEEE
Q ss_conf             79855770786689899999999999974088886020541120487412445687989999999999996868721423
Q gi|254780485|r  195 SGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEHVRIISVARILMPKSRLRLA  274 (328)
Q Consensus       195 ~G~~~~sg~l~G~gEt~eeri~~l~~lr~l~~~~~~v~~~~~~p~~gt~l~~~~~~~~~e~lr~iAi~RL~lP~~~i~i~  274 (328)
                      .|+..-  .++- --|.++|+..+....+     .++   ..+...|+.-.. ...+..+....+...|-.-   .+++.
T Consensus       152 ~gi~~I--~lva-PtT~~eRi~~i~~~a~-----GFi---Y~Vs~~GvTG~r-~~~~~~~l~~~i~~ik~~t---~~Pv~  216 (266)
T PRK13137        152 IGLAVT--FLIA-PTSTPERVKLVARACT-----GFL---YAVSVTGVTGMR-EGLALGEVPDMLRLARQYA---ALPVA  216 (266)
T ss_pred             CCCCEE--EEEC-CCCCHHHHHHHHHHCC-----CCE---EEEECCCCCCCC-CCCCHHHHHHHHHHHHHCC---CCCEE
T ss_conf             599789--9937-9999999999996088-----828---997446766777-6678799999999998638---99879


Q ss_pred             EHHHHHCHHHHHHHHHHCCCEEEECCEEEC--CCCCCHHHHHHHH
Q ss_conf             115651656899999809988997786651--5888989999999
Q gi|254780485|r  275 AGRAMMSDELQALCFFSGANSIFVGDTLLT--AKNPSYNKDTILF  317 (328)
Q Consensus       275 ~~~~~~~~~~~~~~L~~GaN~~~~g~~~~t--~~g~~~~~~~~~i  317 (328)
                      .|-.--.++..+. +...||++++|.-++.  ..|...++..+-+
T Consensus       217 vGFGIs~~e~~~~-~~~~aDGvIVGSaiV~~i~e~~d~~~~~~el  260 (266)
T PRK13137        217 VGFGVKDKATAAQ-VAQVADGVVVGSAFINAVEEGRDVAALAQEI  260 (266)
T ss_pred             EECCCCCHHHHHH-HHHHCCEEEEHHHHHHHHHHCCCHHHHHHHH
T ss_conf             9826698899999-9831999998099999999589899999999


No 340
>cd00537 MTHFR Methylenetetrahydrofolate reductase (MTHFR). 5,10-Methylenetetrahydrofolate is reduced to 5-methyltetrahydrofolate by methylenetetrahydrofolate reductase, a cytoplasmic, NAD(P)-dependent enzyme. 5-methyltetrahydrofolate is utilized by methionine synthase to convert homocysteine to methionine. The enzymatic mechanism is a ping-pong bi-bi mechanism, in which NAD(P)+ release precedes the binding of methylenetetrahydrofolate and the acceptor is free FAD. The family includes the 5,10-methylenetetrahydrofolate reductase EC:1.7.99.5 from prokaryotes and methylenetetrahydrofolate reductase EC: 1.5.1.20 from eukaryotes. The bacterial enzyme is a homotetramer and NADH is the preferred reductant while the eukaryotic enzyme is a homodimer and NADPH is the preferred reductant. In humans, there are several clinically significant mutations in MTHFR that result in hyperhomocysteinemia, which is a risk factor for the development of cardiovascular disease.
Probab=36.88  E-value=28  Score=14.79  Aligned_cols=105  Identities=18%  Similarity=0.153  Sum_probs=52.0

Q ss_pred             CCHHHHHHHHHHHHHCCCEEEEEECCCCCC-------CCCCHHHHHHHHHHHCCC---CCCEEEE------CCCCC-HHH
Q ss_conf             685799999999996498389973036888-------744289999988762136---8832410------25699-999
Q gi|254780485|r   88 INVDQVLKEAKNAKENGATRYCMGAAWREP-------KERDLSIIVDMIKGVKSL---GLETCMT------LGMLS-FEQ  150 (328)
Q Consensus        88 ~~~Eei~~~a~~~~~~G~~~~~l~~~~~~~-------~~~~~~~~~e~i~~i~~~---~~~i~~~------~g~~~-~~~  150 (328)
                      .+.+++......+...|++.+...+|..+.       ...++.+-.++++.++..   +..+.+.      +...+ +.+
T Consensus        70 ~n~~~l~~~L~~~~~~Gi~niLaLrGD~p~~~~~~~~~~~~~~~a~~Li~~i~~~~~~~~~igva~yPe~hp~~~~~~~d  149 (274)
T cd00537          70 RNRIELQSILLGAHALGIRNILALRGDPPKGGDQPGAKPVGFVYAVDLVELIRKENGGGFSIGVAAYPEGHPEAPSLEED  149 (274)
T ss_pred             CCHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHCCCCCEECCCCCCCCCCCCCHHHHH
T ss_conf             99999999999999859863887358888778888888877467999999999975898500566687768774168899


Q ss_pred             HHHH---HCCCCCEEEEECCCCHHHHHCCCCCCCHHHHHHHHHHHHHCCC--CCCCEEE
Q ss_conf             9987---4157606975134377773205888898999999999998798--5577078
Q gi|254780485|r  151 AQIL---SKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSGI--KVCCGGI  204 (328)
Q Consensus       151 ~~~L---k~aG~~~~~~~let~~~~~~~~~~~~~~~~~l~~~~~a~~~G~--~~~sg~l  204 (328)
                      ++.|   .++|++.+..     .-.       .+.+..++.++.+++.|+  ++-.|+|
T Consensus       150 i~~L~~K~~aGA~f~iT-----Q~~-------Fd~~~~~~f~~~~~~~Gi~vPIi~GIm  196 (274)
T cd00537         150 IKRLKRKVDAGADFIIT-----QLF-------FDNDAFLRFVDRCRAAGITVPIIPGIM  196 (274)
T ss_pred             HHHHHHHHHHHHHHHHH-----HHE-------ECHHHHHHHHHHHHHCCCCCCEEEEEE
T ss_conf             99999999814266786-----443-------339999999999997499986563211


No 341
>cd02812 PcrB_like PcrB_like proteins. One member of this family, a protein from Archaeoglobus fulgidus, has been characterized as a (S)-3-O-geranylgeranylglyceryl phosphate synthase (AfGGGPS). AfGGGPS catalyzes the formation of an ether linkage between sn-glycerol-1-phosphate (G1P) and geranylgeranyl diphosphate (GGPP), the committed step in archaeal lipid biosynthesis. Therefore, it has been proposed that PcrB-like proteins are either prenyltransferases or are involved in lipoteichoic acid biosynthesis although the exact function is still unknown.
Probab=36.86  E-value=29  Score=14.79  Aligned_cols=177  Identities=18%  Similarity=0.231  Sum_probs=83.6

Q ss_pred             CCHHHHHHHHHHHHHCCCEEEEEECCCCCCCCCCHHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHCCCCCEEEE--E
Q ss_conf             68579999999999649838997303688874428999998876213688324102569999999874157606975--1
Q gi|254780485|r   88 INVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLGLETCMTLGMLSFEQAQILSKAGLDYYNH--N  165 (328)
Q Consensus        88 ~~~Eei~~~a~~~~~~G~~~~~l~~~~~~~~~~~~~~~~e~i~~i~~~~~~i~~~~g~~~~~~~~~Lk~aG~~~~~~--~  165 (328)
                      .+.+++.+   .+.+.|.--+.+ +|...-. ..++.++..++..+. .+.+..-  +.+..++.    -++|.+..  -
T Consensus        12 ~~~~~l~~---~~~~sgtDai~V-GGS~~~~-~~~~~~v~~ik~~~~-~~Pvilf--Pg~~~~is----~~aDa~lf~sl   79 (219)
T cd02812          12 LVDEEIAK---LAEESGTDAIMV-GGSDGVS-STLDNVVRLIKRIRR-PVPVILF--PSNPEAVS----PGADAYLFPSV   79 (219)
T ss_pred             CCHHHHHH---HHHHHCCCEEEE-CCCCCCH-HHHHHHHHHHHHHCC-CCCEEEE--CCCHHHCC----CCCCEEEEEEE
T ss_conf             98899999---999769999999-3755744-779999999997378-9998995--79866568----67786886875


Q ss_pred             CCC-CHHHHHCCCCCCCHHHHHHHHHHHHH--CCCCC--CCEEEECCC------------CCHHHHHHHHHHHHHCCCCC
Q ss_conf             343-77773205888898999999999998--79855--770786689------------89999999999997408888
Q gi|254780485|r  166 IDT-SERFYPHVTTTHTFEDRLQTLENVRK--SGIKV--CCGGILGLG------------EMIDDRIDMLLTLANLSTPP  228 (328)
Q Consensus       166 let-~~~~~~~~~~~~~~~~~l~~~~~a~~--~G~~~--~sg~l~G~g------------Et~eeri~~l~~lr~l~~~~  228 (328)
                      +.+ .+...        ...-++.....++  .++.+  +.-++++.+            .+.++.+.+.+.-+.++   
T Consensus        80 lNs~n~~~l--------ig~~~~aa~~~~~~~~~~e~ip~gYiv~~~g~~v~~v~~a~~~~~~~~~~ayAlaae~lg---  148 (219)
T cd02812          80 LNSGDPYWI--------IGAQAEAAPEVGKIIPWLELIPEGYLVLNPDSTVARVTGAKTDLKPEDAAAYALAAEYLG---  148 (219)
T ss_pred             ECCCCCHHH--------HHHHHHHHHHHHHCCCCCCEEEEEEEEECCCCCEEEEECCCCCCCHHHHHHHHHHHHHHC---
T ss_conf             338992367--------788999999874316763220057899879981488824647999899999999999829---


Q ss_pred             CEEECCCEEECCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCEEEEHHHHHCHHHHHHHHHHCCCEEEECCEE
Q ss_conf             60205411204874124456879899999999999968687214231156516568999998099889977866
Q gi|254780485|r  229 ESIPINLLIPIPGSKFEENKKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTL  302 (328)
Q Consensus       229 ~~v~~~~~~p~~gt~l~~~~~~~~~e~lr~iAi~RL~lP~~~i~i~~~~~~~~~~~~~~~L~~GaN~~~~g~~~  302 (328)
                        +++..+- ..|+      +.++    .+|+..|=.+.+..+-..+|--  .++....++.+|||.+.+|+-+
T Consensus       149 --~~~iYLE-gSGa------~v~~----e~V~~vk~~l~~~~LivGGGIr--s~e~a~~~~~AgAD~IVvGn~i  207 (219)
T cd02812         149 --MPIVYLE-YSGA------YGPP----EVVRAVKKVLGDTPLIVGGGIR--SGEQAKEMAEAGADTIVVGNIV  207 (219)
T ss_pred             --CCEEEEE-CCCC------CCCH----HHHHHHHHHCCCCEEEEECCCC--CHHHHHHHHHCCCCEEEECCCE
T ss_conf             --9389995-6899------7999----9999999846797099928979--9999999998699999988722


No 342
>cd00951 KDGDH 5-dehydro-4-deoxyglucarate dehydratase, also called 5-keto-4-deoxy-glucarate dehydratase (KDGDH), which is member of dihydrodipicolinate synthase (DHDPS) family that comprises several pyruvate-dependent class I aldolases. The enzyme is involved in glucarate metabolism, and its mechanism presumbly involves a Schiff-base intermediate similar to members of DHDPS family. While in the case of Pseudomonas sp. 5-dehydro-4-deoxy-D-glucarate is degraded by KDGDH to 2,5-dioxopentanoate, in certain species of Enterobacteriaceae it is degraded instead to pyruvate and glycerate.
Probab=36.66  E-value=29  Score=14.77  Aligned_cols=77  Identities=14%  Similarity=-0.003  Sum_probs=43.4

Q ss_pred             CCHHHHHHHHHHHHHCCCEEEEEECCCCCCCCCCHHHHHHHHHHHCC---CCCCEEEECCCCCHHH---HHHHHCCCCCE
Q ss_conf             68579999999999649838997303688874428999998876213---6883241025699999---99874157606
Q gi|254780485|r   88 INVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKS---LGLETCMTLGMLSFEQ---AQILSKAGLDY  161 (328)
Q Consensus        88 ~~~Eei~~~a~~~~~~G~~~~~l~~~~~~~~~~~~~~~~e~i~~i~~---~~~~i~~~~g~~~~~~---~~~Lk~aG~~~  161 (328)
                      .+.|...+.++...+.|+.-+++.++..+-.....+...++++...+   ....+.+.+|..+.+.   .+.-+++|+|.
T Consensus        18 iD~~~~~~~i~~l~~~Gv~gi~v~GstGE~~~Ls~eEr~~v~~~~~~~~~g~~~vi~g~g~~t~~~i~la~~a~~~Gada   97 (289)
T cd00951          18 FDEDAYRAHVEWLLSYGAAALFAAGGTGEFFSLTPDEYAQVVRAAVEETAGRVPVLAGAGYGTATAIAYAQAAEKAGADG   97 (289)
T ss_pred             CCHHHHHHHHHHHHHCCCCEEEECCHHHCCCCCCHHHHHHHHHHHHHHCCCCCEEEECCCCHHHHHHHHHHHHHHCCCCE
T ss_conf             79999999999999779999997933006212899999999999999818985174067631999999999999759999


Q ss_pred             EEE
Q ss_conf             975
Q gi|254780485|r  162 YNH  164 (328)
Q Consensus       162 ~~~  164 (328)
                      +.+
T Consensus        98 v~v  100 (289)
T cd00951          98 ILL  100 (289)
T ss_pred             EEE
T ss_conf             997


No 343
>TIGR03249 KdgD 5-dehydro-4-deoxyglucarate dehydratase. 5-dehydro-4-deoxyglucarate dehydratase not only catalyzes the dehydration of the substrate (diol to ketone + water), but causes the decarboxylation of the intermediate product to yield 2-oxoglutarate semialdehyde (2,5-dioxopentanoate). The gene for the enzyme is usually observed in the vicinity of transporters and dehydratases handling D-galactarate and D-gluconate as well as aldehyde dehydrogenases which convert the product to alpha-ketoglutarate.
Probab=36.13  E-value=29  Score=14.71  Aligned_cols=77  Identities=13%  Similarity=-0.002  Sum_probs=42.5

Q ss_pred             CCHHHHHHHHHHHHHCCCEEEEEECCCCCCCCCCHHHHHHHHHHHCC---CCCCEEEECCCCCHHH---HHHHHCCCCCE
Q ss_conf             68579999999999649838997303688874428999998876213---6883241025699999---99874157606
Q gi|254780485|r   88 INVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKS---LGLETCMTLGMLSFEQ---AQILSKAGLDY  161 (328)
Q Consensus        88 ~~~Eei~~~a~~~~~~G~~~~~l~~~~~~~~~~~~~~~~e~i~~i~~---~~~~i~~~~g~~~~~~---~~~Lk~aG~~~  161 (328)
                      .+.+...+.++...+.|+.-+.+.++..+-.....+...++++...+   ....+.+.+|..+.+.   .+..+++|+|.
T Consensus        23 iD~~~~~~~i~~l~~~Gv~gi~v~GstGE~~~Ls~eEr~~l~~~~~~~~~g~~~vi~gvg~~t~~ai~la~~a~~~Gad~  102 (296)
T TIGR03249        23 FDEAAYRENIEWLLGYGLEALFAAGGTGEFFSLTPAEYEQVVEIAVSTAKGKVPVYTGVGGNTSDAIEIARLAEKAGADG  102 (296)
T ss_pred             CCHHHHHHHHHHHHHCCCCEEEECCCCCCHHHCCHHHHHHHHHHHHHHCCCCCEEECCCCHHHHHHHHHHHHHHHCCCCE
T ss_conf             79999999999999779998997830516665899999999999999838984151278612999999999998759997


Q ss_pred             EEE
Q ss_conf             975
Q gi|254780485|r  162 YNH  164 (328)
Q Consensus       162 ~~~  164 (328)
                      +.+
T Consensus       103 v~v  105 (296)
T TIGR03249       103 YLL  105 (296)
T ss_pred             EEE
T ss_conf             897


No 344
>PRK13126 consensus
Probab=35.69  E-value=30  Score=14.67  Aligned_cols=144  Identities=19%  Similarity=0.168  Sum_probs=71.7

Q ss_pred             HHHHHHHHCCCCCEEEEECCCCHHHHHCCCCCCCHHHHHHHHHHHHHCCCCCCCEEEECCCCCHHHHHHHHHHHHHCCCC
Q ss_conf             99999874157606975134377773205888898999999999998798557707866898999999999999740888
Q gi|254780485|r  148 FEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTP  227 (328)
Q Consensus       148 ~~~~~~Lk~aG~~~~~~~let~~~~~~~~~~~~~~~~~l~~~~~a~~~G~~~~sg~l~G~gEt~eeri~~l~~lr~l~~~  227 (328)
                      ++-+++.+++|++.+.+     |    ..+-. -.++--+..+.+++.|+..-   .+=---|.++|+..+.....    
T Consensus        85 ~~f~~~~~~aGvdGlIi-----p----DLP~e-~~ee~~~~~~~~~~~gl~~I---~lv~ptt~~~ri~~i~~~s~----  147 (237)
T PRK13126         85 AELFETAAEVGARGVLA-----P----DLLID-FPGDLERYLELSREYGLAPS---FFIPSKFPHRLLRRLASLEP----  147 (237)
T ss_pred             HHHHHHHHHCCCCEEEE-----C----CCCCC-CCHHHHHHHHHHHHCCCCEE---EEECCCCHHHHHHHHHHHCC----
T ss_conf             99999998749973883-----6----88877-81778999999997699779---97389983999999998589----


Q ss_pred             CCEEECCCEEECCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCEEEEHHHHHCHHHHHHHHHHCCCEEEECCEEECCCC
Q ss_conf             86020541120487412445687989999999999996868721423115651656899999809988997786651588
Q gi|254780485|r  228 PESIPINLLIPIPGSKFEENKKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKN  307 (328)
Q Consensus       228 ~~~v~~~~~~p~~gt~l~~~~~~~~~e~lr~iAi~RL~lP~~~i~i~~~~~~~~~~~~~~~L~~GaN~~~~g~~~~t~~g  307 (328)
                       .++-+ -....-|+.+       +....+.+...|=..++  +++..|-.--.++.....+..|||++++|.-++..=.
T Consensus       148 -gfiYv-s~~gvTG~~~-------~~~~~~~i~~ir~~~~~--~Pv~vGFGI~t~e~~~~~~~~~aDGvIVGSaiV~~i~  216 (237)
T PRK13126        148 -DFIYL-GLYAATGIEL-------PVYVERNVKTIRGLAGD--VYLVAGFAIDSPEKAARLVKAGADGVVVGTAFMRRLS  216 (237)
T ss_pred             -CEEEE-EEECCCCCCC-------HHHHHHHHHHHHHHCCC--CCEEEEECCCCHHHHHHHHHCCCCEEEECHHHHHHHH
T ss_conf             -87999-8652667641-------56799999999985789--9779994539999999998648999998789999999


Q ss_pred             CCHHHHHHHHHH
Q ss_conf             898999999998
Q gi|254780485|r  308 PSYNKDTILFNR  319 (328)
Q Consensus       308 ~~~~~~~~~i~~  319 (328)
                      .+.++-.+++++
T Consensus       217 ~~~~~~~~~v~~  228 (237)
T PRK13126        217 SSVEEALSFLKE  228 (237)
T ss_pred             HHHHHHHHHHHH
T ss_conf             755999999999


No 345
>cd02801 DUS_like_FMN Dihydrouridine synthase-like (DUS-like) FMN-binding domain. Members of this family catalyze the reduction of the 5,6-double bond of a uridine residue on tRNA. Dihydrouridine modification of tRNA is widely observed in prokaryotes and eukaryotes, and also in some archaea. Most dihydrouridines are found in the D loop of t-RNAs. The role of dihydrouridine in tRNA is currently unknown, but may increase conformational flexibility of the tRNA. It is likely that different family members have different substrate specificities, which may overlap. 1VHN, a putative flavin oxidoreductase, has high sequence similarity to DUS.  The enzymatic mechanism of 1VHN is not known at the present.
Probab=35.56  E-value=30  Score=14.65  Aligned_cols=158  Identities=11%  Similarity=0.079  Sum_probs=76.5

Q ss_pred             EEEEECCCCCCCCCCHHHHHHHHHHHCCC-CCCEEEECCCCCHHHHHHHHCCCCCEEEEECCCCHHHHHCCCCCCCHHHH
Q ss_conf             89973036888744289999988762136-88324102569999999874157606975134377773205888898999
Q gi|254780485|r  107 RYCMGAAWREPKERDLSIIVDMIKGVKSL-GLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDR  185 (328)
Q Consensus       107 ~~~l~~~~~~~~~~~~~~~~e~i~~i~~~-~~~i~~~~g~~~~~~~~~Lk~aG~~~~~~~let~~~~~~~~~~~~~~~~~  185 (328)
                      -+.+|.++.+     .+.+.++.+.+.+. .-.|.+|+|.......+    .|.....+   ..|            +.-
T Consensus        56 p~~~Ql~g~~-----p~~~~~aa~~~~~~g~d~IDlN~GCP~~~v~~----~g~Ga~Ll---~~p------------~~v  111 (231)
T cd02801          56 PLIVQLGGSD-----PETLAEAAKIVEELGADGIDLNMGCPSPKVTK----GGAGAALL---KDP------------ELV  111 (231)
T ss_pred             EEEEEECCCC-----HHHHHHHHHHHHHCCCCEEEEECCCCHHHHCC----CCCCHHHH---HCH------------HHH
T ss_conf             0799875898-----99999999988753999999838999699708----98307876---297------------899


Q ss_pred             HHHHHHHHH-CCCCCCCEEEECCCCCHHHHHHHHHHHHHCCCCCCEEECCCEEECCCCCCCCCCCCCHHHHHHHHHHHHH
Q ss_conf             999999998-7985577078668989999999999997408888602054112048741244568798999999999999
Q gi|254780485|r  186 LQTLENVRK-SGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEHVRIISVARI  264 (328)
Q Consensus       186 l~~~~~a~~-~G~~~~sg~l~G~gEt~eeri~~l~~lr~l~~~~~~v~~~~~~p~~gt~l~~~~~~~~~e~lr~iAi~RL  264 (328)
                      -++++..++ .+++++.-+=+|..+. ++..+.+..+.+-+.  .     .++=|+-|.-+...++-..|+++-+.-   
T Consensus       112 ~~iv~~~~~~~~ipVsvKiRlg~~~~-~~~~~~~~~l~~~G~--~-----~ltvH~Rt~~q~~~~~a~~e~i~~~~~---  180 (231)
T cd02801         112 AEIVRAVREAVPIPVTVKIRLGWDDE-EETLELAKALEDAGA--S-----ALTVHGRTREQRYSGPADWDYIAEIKE---  180 (231)
T ss_pred             HHHHHHHHHHCCCCEEEEEEECCCCH-HHHHHHHHHHHHCCC--C-----EEEEECCCHHHCCCCCCCHHHHHHHHH---
T ss_conf             99999999756994799997077863-479999999997699--8-----999835614414677622699999986---


Q ss_pred             HCCCCCCEEEEHHHHHCHHHHHHHHHHCCCEEEECCE
Q ss_conf             6868721423115651656899999809988997786
Q gi|254780485|r  265 LMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDT  301 (328)
Q Consensus       265 ~lP~~~i~i~~~~~~~~~~~~~~~L~~GaN~~~~g~~  301 (328)
                       .++..+..-++ ..--.+.....-..|++++|+|--
T Consensus       181 -~~~ipvi~NGd-I~s~~d~~~~~~~tg~dgvMigRg  215 (231)
T cd02801         181 -AVSIPVIANGD-IFSLEDALRCLEQTGVDGVMIGRG  215 (231)
T ss_pred             -CCCCEEEEECC-CCCHHHHHHHHHHHCCCEEEECHH
T ss_conf             -59977998389-099999999998509999998788


No 346
>pfam02219 MTHFR Methylenetetrahydrofolate reductase. This family includes the 5,10-methylenetetrahydrofolate reductase EC:1.7.99.5 from bacteria and methylenetetrahydrofolate reductase EC: 1.5.1.20 from eukaryotes. The structure for this domain is known to be a TIM barrel.
Probab=35.52  E-value=30  Score=14.65  Aligned_cols=185  Identities=20%  Similarity=0.238  Sum_probs=86.0

Q ss_pred             CCCHHHHHHHHHHHHHCCCEEEEEECCCCCC-------CCCCHHHHHHHHHHHCCC-C--CCEEEE------CCCCC-HH
Q ss_conf             0685799999999996498389973036888-------744289999988762136-8--832410------25699-99
Q gi|254780485|r   87 LINVDQVLKEAKNAKENGATRYCMGAAWREP-------KERDLSIIVDMIKGVKSL-G--LETCMT------LGMLS-FE  149 (328)
Q Consensus        87 ~~~~Eei~~~a~~~~~~G~~~~~l~~~~~~~-------~~~~~~~~~e~i~~i~~~-~--~~i~~~------~g~~~-~~  149 (328)
                      -.+..++......+...|++.++..+|..+.       +..++.+..++++.++.. +  ..+.+.      +...+ +.
T Consensus        80 d~n~~~l~~~L~~~~~~GI~niLaLrGD~p~~~~~~~~~~~~~~~a~~Li~~i~~~~~~~f~igva~yPe~hp~a~~~~~  159 (286)
T pfam02219        80 DMNKEELDDALEDAKALGIRNILALRGDPPKGGDHWEKPEGGFKYALDLVRLIRQEYGDYFDIGVAAYPEGHPEAKSWQA  159 (286)
T ss_pred             CCCHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCHHH
T ss_conf             79899999999999985988587614889887777789986633399999999973598777554558877865121999


Q ss_pred             HHHHH---HCCCCCEEEEECCCCHHHHHCCCCCCCHHHHHHHHHHHHHCCCCCCCEEEECC--CCCHHHHHHHHHHHHHC
Q ss_conf             99987---41576069751343777732058888989999999999987985577078668--98999999999999740
Q gi|254780485|r  150 QAQIL---SKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSGIKVCCGGILGL--GEMIDDRIDMLLTLANL  224 (328)
Q Consensus       150 ~~~~L---k~aG~~~~~~~let~~~~~~~~~~~~~~~~~l~~~~~a~~~G~~~~sg~l~G~--gEt~eeri~~l~~lr~l  224 (328)
                      ++.+|   .++|++...    | .-.       .+.+...+.++.+++.|+.+  -++.|+  ..+..    .+.++.++
T Consensus       160 di~~L~~Ki~aGA~f~i----T-Q~~-------fd~~~~~~f~~~~~~~Gi~~--PIi~GI~Pi~s~~----~~~~~~~~  221 (286)
T pfam02219       160 DLKYLKEKVDAGADFII----T-QLF-------FDVDNFLRFVDRCRAAGIDI--PIIPGIMPITSYK----SLKRIAKL  221 (286)
T ss_pred             HHHHHHHHHHCCCHHHH----H-HHE-------ECHHHHHHHHHHHHHCCCCC--EEECCCEEECCHH----HHHHHHHH
T ss_conf             99999999984610536----4-353-------24999999999999749982--0421521114688----99999973


Q ss_pred             CCCCCEEECCCEEECCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCEEEEHHHHHCHHHHHHHHHHCCCEEEECCEEEC
Q ss_conf             88886020541120487412445687989999999999996868721423115651656899999809988997786651
Q gi|254780485|r  225 STPPESIPINLLIPIPGSKFEENKKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLT  304 (328)
Q Consensus       225 ~~~~~~v~~~~~~p~~gt~l~~~~~~~~~e~lr~iAi~RL~lP~~~i~i~~~~~~~~~~~~~~~L~~GaN~~~~g~~~~t  304 (328)
                          .++.+|...-.   .|+...  +..+..+-+          .|.+       ..+..+..+..|++++-.    -|
T Consensus       222 ----~Gi~iP~~l~~---~l~~~~--~~~e~~~~~----------gi~~-------a~e~~~~l~~~Gv~GiH~----yt  271 (286)
T pfam02219       222 ----SGVSIPQELID---RLEPIK--DDDEAVKSI----------GIEL-------AVEMCKKLLAEGVPGLHF----YT  271 (286)
T ss_pred             ----CCCCCCHHHHH---HHHHCC--CCHHHHHHH----------HHHH-------HHHHHHHHHHCCCCEEEE----EC
T ss_conf             ----59989499999---998547--999999999----------9999-------999999999779986699----50


Q ss_pred             CCCCCHHHHHHHHHHCC
Q ss_conf             58889899999999829
Q gi|254780485|r  305 AKNPSYNKDTILFNRLG  321 (328)
Q Consensus       305 ~~g~~~~~~~~~i~~~G  321 (328)
                      - | ..+-..+.++++|
T Consensus       272 ~-N-~~~~~~~Il~~lG  286 (286)
T pfam02219       272 L-N-REEAILEILEQLG  286 (286)
T ss_pred             C-C-CHHHHHHHHHHCC
T ss_conf             8-9-7599999999729


No 347
>cd00384 ALAD_PBGS Porphobilinogen synthase (PBGS), which is also called delta-aminolevulinic acid dehydratase (ALAD), catalyzes the condensation of two 5-aminolevulinic acid (ALA) molecules to form the pyrrole porphobilinogen (PBG), which is the second step in the biosynthesis of tetrapyrroles, such as heme, vitamin B12 and chlorophyll. This reaction involves the formation of a Schiff base link between the substrate and the enzyme. PBGSs are metalloenzymes, some of which have a second, allosteric metal binding site, beside the metal ion binding site in their active site. Although PBGS is a family of homologous enzymes, its metal ion utilization at catalytic site varies between zinc and magnesium and/or potassium. PBGS can be classified into two groups based on differences in their active site metal binding site. They either contain a cysteine-rich zinc binding site (consensus DXCXCX(Y/F)X3G(H/Q)CG) or an aspartate-rich magnesium binding site (consensus DXALDX(Y/F)X3G(H/Q)DG). The cyste
Probab=35.05  E-value=30  Score=14.60  Aligned_cols=55  Identities=18%  Similarity=0.167  Sum_probs=37.6

Q ss_pred             CCCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCC-------CCHHHHHHHHHHHCCCCCCEE
Q ss_conf             00068579999999999649838997303688874-------428999998876213688324
Q gi|254780485|r   85 SKLINVDQVLKEAKNAKENGATRYCMGAAWREPKE-------RDLSIIVDMIKGVKSLGLETC  140 (328)
Q Consensus        85 ~~~~~~Eei~~~a~~~~~~G~~~~~l~~~~~~~~~-------~~~~~~~e~i~~i~~~~~~i~  140 (328)
                      -+..+.+.++++++.+.+.|++.+.+-.... .+.       .+-..+..+|+.+|+.++.+.
T Consensus        45 i~R~sid~l~~~v~~~~~lGI~av~LFpvp~-~Kd~~gseA~n~~glv~raIr~iK~~fpdl~  106 (314)
T cd00384          45 VYRLSVDSLVEEAEELADLGIRAVILFGIPE-HKDEIGSEAYDPDGIVQRAIRAIKEAVPELV  106 (314)
T ss_pred             CEEECHHHHHHHHHHHHHCCCCEEEEECCCC-CCCCCCCCCCCCCCHHHHHHHHHHHHCCCCE
T ss_conf             5032899999999999987998899638988-8997755346986589999999999779868


No 348
>TIGR00078 nadC nicotinate-nucleotide pyrophosphorylase; InterPro: IPR004393   Nicotinate-nucleotide pyrophosphorylase (2.4.2.19 from EC), also known as quinolinate phosphoribosyltransferase (decarboxylating), catalyses the conversion of nicotinate D-ribonucleotide, pyrophosphate and carbon dioxide into pyridine-2,3-dicarboxylate and 5-phospho-alpha-D-ribose 1-diphosphate. This enzyme is a type II phosphoribosyltransferase which provides the de novo source of nicotinate mononucleotide (NAMN) for NAD biosynthesis in both prokaryotes and eukaryotes , .   Structural studies have shown that the active form of this enzyme is a homodimer with an unsual fold , , . The N-terminal forms a mixed alpha/beta domain, while the C-terminal region forms a multi-stranded, open alpha/beta barrel. The active site is found at the C-terminal ends of the beta strands of the alpha/beta barrel, and is bordered by the N-terminal domain of the second subunit of the dimer. It contains several conserved charged residues thought to be important determinants of substrate binding and catalysis. ; GO: 0004514 nicotinate-nucleotide diphosphorylase (carboxylating) activity, 0019363 pyridine nucleotide biosynthetic process.
Probab=35.03  E-value=30  Score=14.60  Aligned_cols=39  Identities=21%  Similarity=0.297  Sum_probs=18.9

Q ss_pred             HHHHHHHHCC-CCCCEEEECCCCCHHHHHHHHCCCCCEEE
Q ss_conf             9998876213-68832410256999999987415760697
Q gi|254780485|r  125 IVDMIKGVKS-LGLETCMTLGMLSFEQAQILSKAGLDYYN  163 (328)
Q Consensus       125 ~~e~i~~i~~-~~~~i~~~~g~~~~~~~~~Lk~aG~~~~~  163 (328)
                      +.++|+..|. .+....+.+-..+.|++.+--+||+|-+.
T Consensus       172 ~~~Av~~aR~~~~~~~kiEVEVenlE~a~eA~~AGADiIm  211 (276)
T TIGR00078       172 IEKAVKRARAALPFAKKIEVEVENLEEAEEAAEAGADIIM  211 (276)
T ss_pred             HHHHHHHHHHHCCCCCEEEEEECCHHHHHHHHHCCCCEEE
T ss_conf             8999999998489980799862898999999970995998


No 349
>PRK13122 consensus
Probab=34.37  E-value=31  Score=14.53  Aligned_cols=194  Identities=15%  Similarity=0.144  Sum_probs=102.7

Q ss_pred             HHHHHHHHHCCCEEEEEECCCCCCC-CC---------------CHHHHHHHHHHHCCC-C-CCEEEECCCC-------CH
Q ss_conf             9999999964983899730368887-44---------------289999988762136-8-8324102569-------99
Q gi|254780485|r   94 LKEAKNAKENGATRYCMGAAWREPK-ER---------------DLSIIVDMIKGVKSL-G-LETCMTLGML-------SF  148 (328)
Q Consensus        94 ~~~a~~~~~~G~~~~~l~~~~~~~~-~~---------------~~~~~~e~i~~i~~~-~-~~i~~~~g~~-------~~  148 (328)
                      .+.++.+.+.|+.-+-++--.-+|. +.               .++.+.+.++.++.. . +.+.+  +..       .+
T Consensus        16 ~~~~~~l~~~GaDiiElGiPfSDP~ADGpvIQ~A~~rAL~~G~~~~~~~~~l~~~r~~~~~pivlM--~Y~N~i~~~G~~   93 (242)
T PRK13122         16 IENATLLSENGADIIEIGVPFSDPVADGPVIMEAGQQAIKQGITIDYIFNQLEKHGDQIKCNYVLM--TYYNIICHYGEQ   93 (242)
T ss_pred             HHHHHHHHHCCCCEEEECCCCCCCCCCCHHHHHHHHHHHHCCCCHHHHHHHHHHHCCCCCCCEEEE--EECHHHHHHCHH
T ss_conf             999999997599999978988886665899999999999769989999999997313679877999--851698872799


Q ss_pred             HHHHHHHCCCCCEEEEECCCCHHHHHCCCCCCCHHHHHHHHHHHHHCCCCCCCEEEECCCCCHHHHHHHHHHHHHCCCCC
Q ss_conf             99998741576069751343777732058888989999999999987985577078668989999999999997408888
Q gi|254780485|r  149 EQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPP  228 (328)
Q Consensus       149 ~~~~~Lk~aG~~~~~~~let~~~~~~~~~~~~~~~~~l~~~~~a~~~G~~~~sg~l~G~gEt~eeri~~l~~lr~l~~~~  228 (328)
                      .-+++.+++|++.+.+             |.-.+++--+..+.+++.|+..   +.+=-.-|.++|+..+.....     
T Consensus        94 ~F~~~~~~~GvdGvIi-------------pDLP~ee~~~~~~~~~~~gi~~---I~lvaPtt~~~Ri~~i~~~s~-----  152 (242)
T PRK13122         94 AFFEKCRDTGVYGLII-------------PDLPYELSQRLKQQFSHYGVKI---ISLVAMTTDDKRIKDIVSHAE-----  152 (242)
T ss_pred             HHHHHHHHCCCCEEEC-------------CCCCHHHHHHHHHHHHHCCCCE---EEEECCCCCHHHHHHHHHHCC-----
T ss_conf             9999998769986777-------------8998788999999998679868---987189998999999998299-----


Q ss_pred             CEEECCCEEECCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCEEEEHHHHHCHHHHHHHHHHCCCEEEECCEEEC--CC
Q ss_conf             6020541120487412445687989999999999996868721423115651656899999809988997786651--58
Q gi|254780485|r  229 ESIPINLLIPIPGSKFEENKKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLT--AK  306 (328)
Q Consensus       229 ~~v~~~~~~p~~gt~l~~~~~~~~~e~lr~iAi~RL~lP~~~i~i~~~~~~~~~~~~~~~L~~GaN~~~~g~~~~t--~~  306 (328)
                      .++   ..+...|+.-.....  ..+....+.-.|=.-   .+++..|..--.++..+. +..+||++++|..++.  ..
T Consensus       153 GFi---Y~vs~~GvTG~~~~~--~~~~~~~i~~ik~~t---~~Pv~vGFGI~~~e~v~~-i~~~ADGvIVGSaivk~i~~  223 (242)
T PRK13122        153 GFI---YTVTMNATTGQNGAF--HPELKRKIESIKAIA---NVPVVAGFGIRTPQHVAD-IKEVADGIVIGSEIVKRFKS  223 (242)
T ss_pred             CCE---EEEECCCCCCCCCCC--CHHHHHHHHHHHHHC---CCCEEEECCCCCHHHHHH-HHHHCCEEEECHHHHHHHHH
T ss_conf             966---987335435765556--588999999999725---998587158799999999-98119999984899999996


Q ss_pred             CCCHHHHHHHHHHC
Q ss_conf             88989999999982
Q gi|254780485|r  307 NPSYNKDTILFNRL  320 (328)
Q Consensus       307 g~~~~~~~~~i~~~  320 (328)
                      + +.++..+.|+++
T Consensus       224 ~-~~e~~~~~i~~l  236 (242)
T PRK13122        224 N-TREEIIKYLQSI  236 (242)
T ss_pred             C-CHHHHHHHHHHH
T ss_conf             7-989999999999


No 350
>PRK13139 consensus
Probab=33.96  E-value=32  Score=14.48  Aligned_cols=200  Identities=14%  Similarity=0.104  Sum_probs=109.0

Q ss_pred             CHHHHHHHHHHHHHCCCEEEEEECCCCCCC-CC---------------CHHHHHHHHHHHCCC-CCC-EEEE---C--CC
Q ss_conf             857999999999964983899730368887-44---------------289999988762136-883-2410---2--56
Q gi|254780485|r   89 NVDQVLKEAKNAKENGATRYCMGAAWREPK-ER---------------DLSIIVDMIKGVKSL-GLE-TCMT---L--GM  145 (328)
Q Consensus        89 ~~Eei~~~a~~~~~~G~~~~~l~~~~~~~~-~~---------------~~~~~~e~i~~i~~~-~~~-i~~~---~--g~  145 (328)
                      +.|.-++.++.+.+.|+.-+-++-=.-+|. +.               .++.+.++++.+++. ... +.+.   +  ..
T Consensus        28 ~~e~s~~~~~~l~~~GaDiiElGiPFSDP~ADGpvIq~A~~~AL~~G~~~~~~~~~~~~~~~~~~~pivlM~Y~N~i~~~  107 (254)
T PRK13139         28 SLQANREVIRAMVAGGVDLMELQIPFSEPMADGPVILKANQAALAGGFKVRECFDFAREVVAAFNIPFLFMTYYNILFKY  107 (254)
T ss_pred             CHHHHHHHHHHHHHCCCCEEEECCCCCCCCCCCHHHHHHHHHHHHCCCCHHHHHHHHHHHHHCCCCCEEEEEEHHHHHHC
T ss_conf             97999999999996699999978988886665899999999999769979999999999972489768999525999870


Q ss_pred             CCHHHHHHHHCCCCCEEEEECCCCHHHHHCCCCCCCHHHHHHHHHHHHHCCCCCCCEEEECCCCCHHHHHHHHHHHHHCC
Q ss_conf             99999998741576069751343777732058888989999999999987985577078668989999999999997408
Q gi|254780485|r  146 LSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLS  225 (328)
Q Consensus       146 ~~~~~~~~Lk~aG~~~~~~~let~~~~~~~~~~~~~~~~~l~~~~~a~~~G~~~~sg~l~G~gEt~eeri~~l~~lr~l~  225 (328)
                      -.+.-+++.+++|++.+++             |.-.+++.-+..+.+++.|+..-.  ++-. -|.++|+..+....+  
T Consensus       108 G~e~F~~~~~~~Gv~GvIi-------------pDLP~eE~~~~~~~~~~~gl~~I~--lvaP-tt~~~Ri~~i~~~a~--  169 (254)
T PRK13139        108 GVERFIDEVADIGVKGLIV-------------PDLPPEQAQDYIAQCRAKGMAPIG--IYAP-TSTDERMGKIAAAAD--  169 (254)
T ss_pred             CHHHHHHHHHHCCCCEEEC-------------CCCCHHHHHHHHHHHHHCCCCEEE--EECC-CCCHHHHHHHHHCCC--
T ss_conf             9999999999759985864-------------799978899999999846975799--9458-999899999985169--


Q ss_pred             CCCCEEECCCEEECCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCEEEEHHHHHCHHHHHHHHHHCCCEEEECCEEE--
Q ss_conf             888602054112048741244568798999999999999686872142311565165689999980998899778665--
Q gi|254780485|r  226 TPPESIPINLLIPIPGSKFEENKKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLL--  303 (328)
Q Consensus       226 ~~~~~v~~~~~~p~~gt~l~~~~~~~~~e~lr~iAi~RL~lP~~~i~i~~~~~~~~~~~~~~~L~~GaN~~~~g~~~~--  303 (328)
                         .++   ..+...|+.-...  .-+.+....+...|-.-   .+++..|-.--.++. -..+..+|+++++|..++  
T Consensus       170 ---gFi---Y~vs~~GvTG~~~--~~~~~~~~~i~~ik~~t---~~Pv~vGFGI~~~e~-v~~~~~~aDGvIVGSaiVk~  237 (254)
T PRK13139        170 ---GFI---YCVARRGVTGSKT--SFDEHVGAFLHRCRAAT---PLPLAVGFGVKSAAD-VDYLKGKADIAVVGSQAIRL  237 (254)
T ss_pred             ---CEE---EEEECCCCCCCCC--CCHHHHHHHHHHHHHCC---CCCEEEECCCCCHHH-HHHHHCCCCEEEECHHHHHH
T ss_conf             ---869---9996666679886--64588999999998558---998799737799999-99997169999988899999


Q ss_pred             -CCCCCCHHHHHHHHHHC
Q ss_conf             -15888989999999982
Q gi|254780485|r  304 -TAKNPSYNKDTILFNRL  320 (328)
Q Consensus       304 -t~~g~~~~~~~~~i~~~  320 (328)
                       ..+  ..+...++++++
T Consensus       238 ie~~--g~~~v~~f~~~l  253 (254)
T PRK13139        238 FDEA--GAAAVEPFFRSL  253 (254)
T ss_pred             HHHC--CHHHHHHHHHHH
T ss_conf             9975--999999999970


No 351
>cd00513 Ribosomal_L32_L32e Ribosomal_L32_L32e: L32 is a protein from the large subunit that contains a surface-exposed globular domain and a finger-like projection that extends into the RNA core to stabilize the tertiary structure. L32 does not appear to play a role in forming the A (aminacyl), P (peptidyl) or E (exit) sites of the ribosome, but does interact with 23S rRNA, which has a "kink-turn" secondary structure motif. L32 is overexpressed in human prostate cancer and has been identified as a stably expressed housekeeping gene in macrophages of human chronic obstructive pulmonary disease (COPD) patients. In Schizosaccharomyces pombe, L32 has also been suggested to play a role as a transcriptional regulator in the nucleus. Found in archaea and eukaryotes, this protein is known as L32 in eukaryotes and L32e in archaea.
Probab=33.50  E-value=32  Score=14.44  Aligned_cols=65  Identities=18%  Similarity=0.256  Sum_probs=40.8

Q ss_pred             CCCEEEECCCCCHHHHHHHHCCCCCEEEEE----CCC-C---HHHHHCCCCCCCHHHHHHHHHHHHHCCCCCC
Q ss_conf             883241025699999998741576069751----343-7---7773205888898999999999998798557
Q gi|254780485|r  136 GLETCMTLGMLSFEQAQILSKAGLDYYNHN----IDT-S---ERFYPHVTTTHTFEDRLQTLENVRKSGIKVC  200 (328)
Q Consensus       136 ~~~i~~~~g~~~~~~~~~Lk~aG~~~~~~~----let-~---~~~~~~~~~~~~~~~~l~~~~~a~~~G~~~~  200 (328)
                      +.....++|.-+....+-|.-.|...+.+.    ||. .   +.....+..+.+...+.++++.|.++|+++.
T Consensus        34 g~~~~p~iGYgs~k~~Rgl~PsG~~~vlV~n~~dLe~l~~~n~~~aa~Ia~~Vg~kKR~~I~erA~el~ikV~  106 (107)
T cd00513          34 GKPAMPKIGYGSPKKTRGLHPSGFKKVLVHNVKELEVLDMHNRTYAARIAHTVGARKRKEIVERAKELGIKVL  106 (107)
T ss_pred             CCCCCCCCCCCCCHHHCCCCCCCCEEEEECCHHHHHHHCCCCCEEEEEEECCCCHHHHHHHHHHHHHHCCCCC
T ss_conf             8667876677877766577978888888669889888603597069998354233379999999999698815


No 352
>PRK01362 putative translaldolase; Provisional
Probab=33.36  E-value=32  Score=14.42  Aligned_cols=102  Identities=14%  Similarity=0.090  Sum_probs=55.4

Q ss_pred             HHCCCCCCCHHHHHHHHHHHHHCCCCCCCEEEECCCCCHHHHHHHHHHHHHCCCCCCEEECCCEEECCCCCCCCCCCCCH
Q ss_conf             32058888989999999999987985577078668989999999999997408888602054112048741244568798
Q gi|254780485|r  173 YPHVTTTHTFEDRLQTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDP  252 (328)
Q Consensus       173 ~~~~~~~~~~~~~l~~~~~a~~~G~~~~sg~l~G~gEt~eeri~~l~~lr~l~~~~~~v~~~~~~p~~gt~l~~~~~~~~  252 (328)
                      +-+++-+   .+.+++++.+.+.|++++.|.+|-.    .+.    ......+..+  |+  +|.   | ++.+...-..
T Consensus        81 ~VKIP~t---~~Gl~ai~~L~~~Gi~vn~Tai~s~----~Qa----~~Aa~aga~y--is--py~---g-R~~d~G~Dg~  141 (214)
T PRK01362         81 VVKIPMT---TEGLKAVKALSKEGIKTNVTLCFSA----NQA----LLAAKAGATY--VS--PFV---G-RLDDIGTDGM  141 (214)
T ss_pred             EEECCCC---HHHHHHHHHHHHCCCCEEEEECCCH----HHH----HHHHHCCCCE--EE--EEC---C-HHHHCCCCHH
T ss_conf             9981896---6699999999984997576645889----999----9998759968--98--631---2-1865589828


Q ss_pred             HHHHHHHHHHHHHCCCCCCEEEEHHHHHCHHHHHHHHHHCCCEE
Q ss_conf             99999999999968687214231156516568999998099889
Q gi|254780485|r  253 IEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSI  296 (328)
Q Consensus       253 ~e~lr~iAi~RL~lP~~~i~i~~~~~~~~~~~~~~~L~~GaN~~  296 (328)
                      .....+..+..-.-.++.|-.++-|..   ..-..++.+||+.+
T Consensus       142 ~~i~~i~~~~~~~~~~tkIL~AS~r~~---~~i~~a~~~G~~~i  182 (214)
T PRK01362        142 ELIEDIREIYDNYGFETEIIAASVRHP---MHVLEAALIGADIA  182 (214)
T ss_pred             HHHHHHHHHHHHCCCCCEEEEEECCCH---HHHHHHHHCCCCEE
T ss_conf             999999999996399813752003889---99999998699999


No 353
>COG4943 Predicted signal transduction protein containing sensor and EAL domains [Signal transduction mechanisms]
Probab=33.27  E-value=32  Score=14.41  Aligned_cols=92  Identities=16%  Similarity=0.113  Sum_probs=45.0

Q ss_pred             HHHHHHHCCCCCEEEEECCC--C----------------HHHHHCCCCCCCHHH-HHHHHHHHHHCCCCCCCEEEECCCC
Q ss_conf             99998741576069751343--7----------------777320588889899-9999999998798557707866898
Q gi|254780485|r  149 EQAQILSKAGLDYYNHNIDT--S----------------ERFYPHVTTTHTFED-RLQTLENVRKSGIKVCCGGILGLGE  209 (328)
Q Consensus       149 ~~~~~Lk~aG~~~~~~~let--~----------------~~~~~~~~~~~~~~~-~l~~~~~a~~~G~~~~sg~l~G~gE  209 (328)
                      ....+++++|-.-|.-.+.|  +                ..+-..+-.+....- -=.+++.|+++|+++-+-    =+|
T Consensus       405 ~iI~r~ReaG~~IyIDDFGTGYSnL~YLq~L~VDaLKIDKsFvdtlg~~~a~~~I~~hII~MAk~L~L~iVaE----GVE  480 (524)
T COG4943         405 PIILRLREAGHEIYIDDFGTGYSNLHYLQSLPVDALKIDKSFVDTLGTDSASHLIAPHIIEMAKSLGLKIVAE----GVE  480 (524)
T ss_pred             HHHHHHHHCCCEEEECCCCCCCHHHHHHHHCCCCCEECCHHHHHHHCCCCCCCHHHHHHHHHHHHCCCCEEEE----CCC
T ss_conf             9999998669869973576760247788539950500007898764358641113899999998759727750----113


Q ss_pred             CHHHHHHHHHHHHHCCCCCCEEECCCEEECCCCCCCCCCCCCHHHHHHHHH
Q ss_conf             999999999999740888860205411204874124456879899999999
Q gi|254780485|r  210 MIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEHVRIIS  260 (328)
Q Consensus       210 t~eeri~~l~~lr~l~~~~~~v~~~~~~p~~gt~l~~~~~~~~~e~lr~iA  260 (328)
                      |.|+.    ..||..++++.   -.+|.         .+++++.+++.+..
T Consensus       481 teeQ~----~~LR~~Gv~~g---QGW~f---------skaLp~q~Fi~~~~  515 (524)
T COG4943         481 TEEQV----DWLRKRGVHYG---QGWLF---------SKALPAQAFLDWAE  515 (524)
T ss_pred             HHHHH----HHHHHCCCCCC---CCCCC---------CCCCCHHHHHHHHH
T ss_conf             78999----99997497423---44004---------78889899999998


No 354
>KOG1643 consensus
Probab=33.23  E-value=32  Score=14.41  Aligned_cols=157  Identities=15%  Similarity=0.219  Sum_probs=75.8

Q ss_pred             CHHHHHHHHHHHHHCCCEEEEEECCCCCCCCCCHHHHHHHHHHHCCCCCCEEE------ECCCCC-HHHHHHHHCCCCCE
Q ss_conf             85799999999996498389973036888744289999988762136883241------025699-99999874157606
Q gi|254780485|r   89 NVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLGLETCM------TLGMLS-FEQAQILSKAGLDY  161 (328)
Q Consensus        89 ~~Eei~~~a~~~~~~G~~~~~l~~~~~~~~~~~~~~~~e~i~~i~~~~~~i~~------~~g~~~-~~~~~~Lk~aG~~~  161 (328)
                      |..+|.+....+.-.+-.++++.     |+.-++.|.-.+++    ..+.+..      .-|..+ +.....++++|+..
T Consensus        19 s~~eii~~ln~a~~~~~vevvi~-----pP~~Yl~~ak~~l~----~~i~v~aQn~~~~k~GafTGEiS~~mlkd~G~~w   89 (247)
T KOG1643          19 SIKEIIKTLNAAKLPANVEVVIA-----PPAPYLDYAKSKLK----PDIGVAAQNCYKVKSGAFTGEISAEMLKDLGAEW   89 (247)
T ss_pred             HHHHHHHHHHHCCCCCCCCEEEE-----CCHHHHHHHHHHCC----CCCEEECCEEEECCCCCCCCCCCHHHHHHCCCCE
T ss_conf             99999998665117888768980-----88258999987477----5335621211203676634756899998679978


Q ss_pred             EEEECCCCHHHHHCCCCCCCHHHHHHHHHHHHHCCCCCCCEEEECCCCCHHHHHH--HHH-------HHHH-CCCCCCEE
Q ss_conf             9751343777732058888989999999999987985577078668989999999--999-------9974-08888602
Q gi|254780485|r  162 YNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSGIKVCCGGILGLGEMIDDRID--MLL-------TLAN-LSTPPESI  231 (328)
Q Consensus       162 ~~~~let~~~~~~~~~~~~~~~~~l~~~~~a~~~G~~~~sg~l~G~gEt~eeri~--~l~-------~lr~-l~~~~~~v  231 (328)
                      +.+..---+..|.+     +-+---+-.+.|..-|+++    +.=+||+.+||-.  ++.       .+.+ .+....-+
T Consensus        90 VIlGHSERR~~fgE-----sd~~i~~K~~~Al~eGl~V----iaCIGE~leeREaG~t~dVv~~Ql~aiad~v~~w~niv  160 (247)
T KOG1643          90 VILGHSERRHVFGE-----SDEFIADKTAHALAEGLKV----IACIGETLEEREAGKTLDVVFRQLKAIADKVKDWSNIV  160 (247)
T ss_pred             EEECCHHHHHHHCC-----CHHHHHHHHHHHHHCCCEE----EEEECCCHHHHHCCCHHHHHHHHHHHHHHHCCCCCCEE
T ss_conf             99544666435077-----3478999999999758759----99946627766348627899999999998547864328


Q ss_pred             -ECCCEEECCCCCCCCCCCCCHHHHHHHHHHHHHHCCC
Q ss_conf             -0541120487412445687989999999999996868
Q gi|254780485|r  232 -PINLLIPIPGSKFEENKKVDPIEHVRIISVARILMPK  268 (328)
Q Consensus       232 -~~~~~~p~~gt~l~~~~~~~~~e~lr~iAi~RL~lP~  268 (328)
                       ..-|... -||    -..+||+..--+++-.|-.+-+
T Consensus       161 iAYEPVWA-IGT----Gk~atp~QaqEVh~~iR~wl~~  193 (247)
T KOG1643         161 IAYEPVWA-IGT----GKTATPEQAQEVHAEIRKWLKS  193 (247)
T ss_pred             EEEECEEE-ECC----CCCCCHHHHHHHHHHHHHHHHH
T ss_conf             98503366-517----8779878999999999999863


No 355
>COG0434 SgcQ Predicted TIM-barrel enzyme [General function prediction only]
Probab=33.16  E-value=33  Score=14.40  Aligned_cols=212  Identities=12%  Similarity=0.132  Sum_probs=87.6

Q ss_pred             CCCCCHHHHHHH----HHHHHHCCCEEEEEECCCCCCCCCC-----HHHHHHHHHHHC-CCCCCEEEECC-CCCHHHHHH
Q ss_conf             000685799999----9999964983899730368887442-----899999887621-36883241025-699999998
Q gi|254780485|r   85 SKLINVDQVLKE----AKNAKENGATRYCMGAAWREPKERD-----LSIIVDMIKGVK-SLGLETCMTLG-MLSFEQAQI  153 (328)
Q Consensus        85 ~~~~~~Eei~~~----a~~~~~~G~~~~~l~~~~~~~~~~~-----~~~~~e~i~~i~-~~~~~i~~~~g-~~~~~~~~~  153 (328)
                      |+--+.|+|.+.    |..+.+.|+.-+.+---+..|..++     ...+.-+++.++ +..+.+.+|.- --....+..
T Consensus        24 ~~~~~~~~vid~A~~dA~~leegG~DavivEN~gD~Pf~k~v~~~tvaaMa~iv~~v~r~v~iPvGvNVLrNd~vaA~~I  103 (263)
T COG0434          24 YDAGSLEAVIDRAVRDAAALEEGGVDAVIVENYGDAPFLKDVGPETVAAMAVIVREVVREVSIPVGVNVLRNDAVAALAI  103 (263)
T ss_pred             CCCCCHHHHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCEEEEECCCCHHHHHH
T ss_conf             55678799999999899999848976899713578877777974788999999999987507661032102662888999


Q ss_pred             HHCCCCCEEEEECCCCHHHHHC-CCCCCCHHHHHHHHHHHHHCC--CCCCCEEEECCCCCHHHHHHHHHHHHH-CC-CCC
Q ss_conf             7415760697513437777320-588889899999999999879--855770786689899999999999974-08-888
Q gi|254780485|r  154 LSKAGLDYYNHNIDTSERFYPH-VTTTHTFEDRLQTLENVRKSG--IKVCCGGILGLGEMIDDRIDMLLTLAN-LS-TPP  228 (328)
Q Consensus       154 Lk~aG~~~~~~~let~~~~~~~-~~~~~~~~~~l~~~~~a~~~G--~~~~sg~l~G~gEt~eeri~~l~~lr~-l~-~~~  228 (328)
                      -+..|.+.+-.|+-|.-..-++ +..+.    --++++.-+.+|  +++-+-+.+-|+-..-++ ..-..+++ +. ...
T Consensus       104 A~a~gA~FIRVN~~tg~~~tdqGiieg~----A~e~~r~r~~L~~~v~vlADv~VKHa~~l~~~-~~~~~v~dtver~~a  178 (263)
T COG0434         104 AYAVGADFIRVNVLTGAYATDQGIIEGN----AAELARYRARLGSRVKVLADVHVKHAVHLGNR-SLEEAVKDTVERGLA  178 (263)
T ss_pred             HHHCCCCEEEEEEEECEEECCCCCCCCH----HHHHHHHHHHCCCCCEEEEECHHHCCCCCCCC-CHHHHHHHHHHCCCC
T ss_conf             9860797799873434276356501444----88999989861677379761113215323786-889999999970488


Q ss_pred             CEEECCCEEECCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCEEEEHHHHHCHHHHHHHHHHCCCEEEECCEEECCCCC
Q ss_conf             60205411204874124456879899999999999968687214231156516568999998099889977866515888
Q gi|254780485|r  229 ESIPINLLIPIPGSKFEENKKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNP  308 (328)
Q Consensus       229 ~~v~~~~~~p~~gt~l~~~~~~~~~e~lr~iAi~RL~lP~~~i~i~~~~~~~~~~~~~~~L~~GaN~~~~g~~~~t~~g~  308 (328)
                      +.|.+.-.    .    .-.+++. +.|+.+.-+.= +|    -+.+|=  ..++.....|.. |||.++|-++ ..+|.
T Consensus       179 DaVI~tG~----~----TG~~~d~-~el~~a~~~~~-~p----vlvGSG--v~~eN~~~~l~~-adG~IvgT~l-K~~G~  240 (263)
T COG0434         179 DAVIVTGS----R----TGSPPDL-EELKLAKEAVD-TP----VLVGSG--VNPENIEELLKI-ADGVIVGTSL-KKGGV  240 (263)
T ss_pred             CEEEEECC----C----CCCCCCH-HHHHHHHHCCC-CC----EEEECC--CCHHHHHHHHHH-CCCEEEEEEE-CCCCE
T ss_conf             77999566----6----7899998-99999986269-87----897368--888899999987-2866997866-03886


Q ss_pred             -----CHHHHHHHHHH
Q ss_conf             -----98999999998
Q gi|254780485|r  309 -----SYNKDTILFNR  319 (328)
Q Consensus       309 -----~~~~~~~~i~~  319 (328)
                           ..++..++++.
T Consensus       241 ~~n~VD~~Rv~~~v~~  256 (263)
T COG0434         241 TWNPVDLERVRRFVEA  256 (263)
T ss_pred             ECCCCCHHHHHHHHHH
T ss_conf             3684599999999999


No 356
>pfam10443 RNA12 RNA12 protein. This family includes RNA12 from S. cerevisiae. That protein contains an RRM domain. This region is C-terminal to that and includes a P-loop motif suggesting this region binds to NTP. The RNA12 proteins is involved in pre-rRNA maturation.
Probab=33.14  E-value=33  Score=14.40  Aligned_cols=58  Identities=12%  Similarity=0.035  Sum_probs=33.2

Q ss_pred             CHHHHHHHHHHHHHCCCEEEEEECCCCCCCCCCHHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHH
Q ss_conf             857999999999964983899730368887442899999887621368832410256999999987
Q gi|254780485|r   89 NVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLGLETCMTLGMLSFEQAQIL  154 (328)
Q Consensus        89 ~~Eei~~~a~~~~~~G~~~~~l~~~~~~~~~~~~~~~~e~i~~i~~~~~~i~~~~g~~~~~~~~~L  154 (328)
                      -.+.+.++|-.....++-|+.+.+..-.. .   .   .+-+.+.. -+.-.+++|..+.+..+..
T Consensus       167 iy~~laeWAa~Lvq~niAHVIFLT~Dv~~-~---k---~LskaLPn-~vf~tI~L~Das~~~ak~y  224 (428)
T pfam10443       167 VYDKLAEWAASLVQSNIAHVIFLTEDVSA-G---K---PLSKALPN-QVFKTISLGDASPDVARNY  224 (428)
T ss_pred             HHHHHHHHHHHHHHCCCCEEEEECCCCCC-C---H---HHHHHCCC-CCEEEEECCCCCHHHHHHH
T ss_conf             79999999999873571269997799851-1---4---47875797-5012654145898999999


No 357
>PRK10415 tRNA-dihydrouridine synthase B; Provisional
Probab=32.75  E-value=33  Score=14.36  Aligned_cols=123  Identities=13%  Similarity=0.107  Sum_probs=66.1

Q ss_pred             CCHHHHHHHHHHHHHCCCEEEEEECCC----------CCCCCCCHHHHHHHHHHHCC-CCCCEEE--ECCCCC-----HH
Q ss_conf             685799999999996498389973036----------88874428999998876213-6883241--025699-----99
Q gi|254780485|r   88 INVDQVLKEAKNAKENGATRYCMGAAW----------REPKERDLSIIVDMIKGVKS-LGLETCM--TLGMLS-----FE  149 (328)
Q Consensus        88 ~~~Eei~~~a~~~~~~G~~~~~l~~~~----------~~~~~~~~~~~~e~i~~i~~-~~~~i~~--~~g~~~-----~~  149 (328)
                      .++|++.+.|+.+.+.|+..+-|-.|=          ..-...+.+...++++.+++ ....+.+  -+|.-.     .+
T Consensus        74 ~dp~~~a~Aa~~~~~~g~~~IDiN~GCP~~kV~k~g~GsaLl~~p~~~~~iv~a~~~a~~iPVTvKiRlG~~~~~~~~~~  153 (321)
T PRK10415         74 SDPKEMADAARINVESGAQIIDINMGCPAKKVNRKLAGSALLQYPDLVKSILTEVVNAVDVPVTLKIRTGWAPEHRNCEE  153 (321)
T ss_pred             CCHHHHHHHHHHHHHCCCCEEEEECCCCHHHHCCCCCEEEHHCCHHHHHHHHHHHHHCCCCCEEEEEECCCCCCHHHHHH
T ss_conf             99999999999887649998943189998997079836506339899999999997344874699984688852243999


Q ss_pred             HHHHHHCCCCCEEEEECCCCHHHHHCCCCCCCHHHHHHHHHHHHHCCCCCCCEEEECCCCCHHHHHHHHH
Q ss_conf             9998741576069751343777732058888989999999999987985577078668989999999999
Q gi|254780485|r  150 QAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSGIKVCCGGILGLGEMIDDRIDMLL  219 (328)
Q Consensus       150 ~~~~Lk~aG~~~~~~~let~~~~~~~~~~~~~~~~~l~~~~~a~~~G~~~~sg~l~G~gEt~eeri~~l~  219 (328)
                      ..+.+.++|++.+.+---|....|..   ..+|+. +..+  .....+++   +.=|=+-+.+|..+++.
T Consensus       154 ~~~~~e~aG~~~itvHgRT~~q~y~g---~adw~~-i~~v--k~~~~iPv---i~NGDI~~~~da~~~l~  214 (321)
T PRK10415        154 IAQLAEDCGIQALTIHGRTRACLFNG---EAEYDS-IRAV--KQKVSIPV---IANGDITDPLKARAVLD  214 (321)
T ss_pred             HHHHHHHCCCCEEEEEHHHHHHHHCC---CCCHHH-HHHH--HHCCCCCE---EECCCCCCHHHHHHHHH
T ss_conf             99999856988999972213443169---987799-9999--85479978---96589199999999998


No 358
>PRK08350 hypothetical protein; Provisional
Probab=32.67  E-value=33  Score=14.35  Aligned_cols=34  Identities=26%  Similarity=0.315  Sum_probs=15.6

Q ss_pred             CHHHHHHHHHHHHHCCCCCCCEEEECC--CCCHHHHHHHH
Q ss_conf             989999999999987985577078668--98999999999
Q gi|254780485|r  181 TFEDRLQTLENVRKSGIKVCCGGILGL--GEMIDDRIDML  218 (328)
Q Consensus       181 ~~~~~l~~~~~a~~~G~~~~sg~l~G~--gEt~eeri~~l  218 (328)
                      |.-+-+++++.|++.|+.+    ++-|  |||....+.||
T Consensus       266 TlTETleai~lA~~~g~~~----viSHRSGETEDt~IADL  301 (341)
T PRK08350        266 TLTDLYNFVNDVKSEKITP----ILAEAKYEPADETLPHL  301 (341)
T ss_pred             EHHHHHHHHHHHHHCCCEE----EEECCCCCCCCCHHHHH
T ss_conf             2999999999999879948----99857898640169999


No 359
>TIGR00238 TIGR00238 lysine 2,3-aminomutase YodO family protein; InterPro: IPR003739   This family represents essentially the whole of the Escherichia coli YjeK family and of some of its apparent orthologs. YodO in Bacillus subtilis, a family member which is a longer protein by an additional 100 residues, is characterised as a lysine 2,3-aminomutase with iron, sulphide and pyridoxal 5'-phosphate groups . The homologue, MJ0634 from M. jannaschii, is preceded by nearly 200 C-terminal residues. This family shows similarity to molybdenum cofactor biosynthesis protein MoaA and related proteins..
Probab=32.46  E-value=33  Score=14.32  Aligned_cols=192  Identities=17%  Similarity=0.196  Sum_probs=79.3

Q ss_pred             CCCCCCCCCCCCCC---CCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCC--CCHHHHHHHHHHHCCC
Q ss_conf             07868342321243---354777564100068579999999999649838997303688874--4289999988762136
Q gi|254780485|r   61 KTGGCPENCGYCNQ---SVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKE--RDLSIIVDMIKGVKSL  135 (328)
Q Consensus        61 ~TN~C~~~C~fCaf---~~~~~~~~~~~~~~~~Eei~~~a~~~~~~G~~~~~l~~~~~~~~~--~~~~~~~e~i~~i~~~  135 (328)
                      .++.|..+|.||.-   -++........  ...+.............-..-++.+|+.+...  ..+++++.-++.+...
T Consensus       137 ~~~~c~~~c~yc~~~w~~~~~~~~~~~g--~p~~~~~~~~~~~~~~~~~~~~~~~ggdp~~~~d~~~~~~~~~~~~~~~~  214 (357)
T TIGR00238       137 PKGGCAVNCRYCFRNWLVRHFPYKEGPG--NPKKKWEAALDYIAEHPELEEVLFSGGDPLLLKDHELEWLLKELESIPHL  214 (357)
T ss_pred             ECCCCCHHHHHHHHCCHHCCCCCCCCCC--CCHHHHHHHHHHHHHCCCHHHHEEECCCCCCCCHHHHHHHHHHHHHCCCH
T ss_conf             4166402233333200110045100367--73678999999874041023320107876310057899999987533401


Q ss_pred             -CCCEEEEC-----CCCCHHHHHHHHCCCCCEEE-EECCCCHHHHHCCCCCCCHHHHHHHHHHHHHCCCCCCCE-E-EEC
Q ss_conf             -88324102-----56999999987415760697-513437777320588889899999999999879855770-7-866
Q gi|254780485|r  136 -GLETCMTL-----GMLSFEQAQILSKAGLDYYN-HNIDTSERFYPHVTTTHTFEDRLQTLENVRKSGIKVCCG-G-ILG  206 (328)
Q Consensus       136 -~~~i~~~~-----g~~~~~~~~~Lk~aG~~~~~-~~let~~~~~~~~~~~~~~~~~l~~~~~a~~~G~~~~sg-~-l~G  206 (328)
                       .+.++...     .-.+++....+.+.-..... ..+++.         ..-.+...+.++.....|+.+..- + +-|
T Consensus       215 ~~~~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~---------~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~  285 (357)
T TIGR00238       215 EGLRIGTRLPVVIPQRITDELCELLGKFELPLLLVTHINHC---------NEITEEFAEAVEKLRTVGVTLLNQSVLLRG  285 (357)
T ss_pred             HEEEECCCCCEEEHHHHHHHHHHHHHHHHHHHHEEECCCCC---------HHCCHHHHHHHHHHHHCCCCCCCHHHHHHH
T ss_conf             00220232201100466899999875332211000002430---------110378999999887526500001322111


Q ss_pred             CCCCHHHHHHHHHHHHHCCCCCCEEECCCEEECCCCCCCCCCCCCHHHHHHHHHHHHHHCCC
Q ss_conf             89899999999999974088886020541120487412445687989999999999996868
Q gi|254780485|r  207 LGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEHVRIISVARILMPK  268 (328)
Q Consensus       207 ~gEt~eeri~~l~~lr~l~~~~~~v~~~~~~p~~gt~l~~~~~~~~~e~lr~iAi~RL~lP~  268 (328)
                      ..+..+-.......+.+.+.    .|...+.+ .+..-...-..+..+.++.+--.+-..+.
T Consensus       286 ~~~~~~~~~~l~~~l~~~g~----~pyy~~~~-~~~~g~~~~~~~~~~~~~~~~~~~~~~~g  342 (357)
T TIGR00238       286 VNDSAPILAKLSDALFKVGV----LPYYLHLL-DGVEGAGHFLVPDAEALQIVKELAGLTSG  342 (357)
T ss_pred             HCCHHHHHHHHHHHHHHHCC----CHHHHHHH-CHHHHHHHHHHHHHHHHHHHHHHHHHCCC
T ss_conf             01115789998887876301----02322220-00110112220167889999888751353


No 360
>PRK03620 5-dehydro-4-deoxyglucarate dehydratase; Provisional
Probab=32.34  E-value=34  Score=14.31  Aligned_cols=76  Identities=12%  Similarity=-0.019  Sum_probs=32.3

Q ss_pred             CCHHHHHHHHHHHHHCCCEEEEEECCCCCCCCCCHHHHHHHHHHHC---CCCCCEEEECCCCCHHH---HHHHHCCCCCE
Q ss_conf             6857999999999964983899730368887442899999887621---36883241025699999---99874157606
Q gi|254780485|r   88 INVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVK---SLGLETCMTLGMLSFEQ---AQILSKAGLDY  161 (328)
Q Consensus        88 ~~~Eei~~~a~~~~~~G~~~~~l~~~~~~~~~~~~~~~~e~i~~i~---~~~~~i~~~~g~~~~~~---~~~Lk~aG~~~  161 (328)
                      .+.+.+.+.++...+.|+.-+++.++..+-.....+...++++...   .....+.+.+|..+.+.   .+.-+++|+|.
T Consensus        19 iD~~~l~~~v~~li~~Gv~gi~v~GstGE~~~Ls~eEr~~v~~~~v~~~~grvpvi~gvg~~t~~ai~la~~A~~~Gada   98 (296)
T PRK03620         19 FDEAAYREHLEWLAPYGAAALFAAGGTGEFFSLTPDEYSQVVRAAVEACAGRVPVIAGAGGGTAQAIEYAQAAERAGADG   98 (296)
T ss_pred             CCHHHHHHHHHHHHHCCCCEEEECCCCCCHHHCCHHHHHHHHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHHHHCCCCE
T ss_conf             59999999999999779998996842313434899999999999999838973598257753799999999999829998


Q ss_pred             EE
Q ss_conf             97
Q gi|254780485|r  162 YN  163 (328)
Q Consensus       162 ~~  163 (328)
                      +.
T Consensus        99 i~  100 (296)
T PRK03620         99 IL  100 (296)
T ss_pred             EE
T ss_conf             99


No 361
>TIGR02151 IPP_isom_2 isopentenyl-diphosphate delta-isomerase, type 2; InterPro: IPR011179   This group represents the bacterial and archaeal isopentenyl-diphosphate delta-isomerase (IPP isomerase). IPP isomerase catalyses the interconversion of isopentenyl diphosphate (IPP) and dimethylallyl diphosphate (DMAPP), and is a key enzyme in the biosynthesis of isoprenoids via the mevalonate pathway. The bacterial and archaeal IPP isomerase (type 2 enzyme) differs from that found in eukaryotes (type 1 enzyme), and requires NADPH, magnesium, and FMN for activity , .; GO: 0004452 isopentenyl-diphosphate delta-isomerase activity, 0010181 FMN binding, 0008299 isoprenoid biosynthetic process, 0005737 cytoplasm.
Probab=32.18  E-value=34  Score=14.29  Aligned_cols=102  Identities=17%  Similarity=0.193  Sum_probs=49.7

Q ss_pred             CCCH-HHHHHHH-HHHHHCCCCCCCEEE---ECCCCCHHHHHHHHHHHHHCCCCCCEE---ECCCEEECCCCC-------
Q ss_conf             8898-9999999-999987985577078---668989999999999997408888602---054112048741-------
Q gi|254780485|r  179 THTF-EDRLQTL-ENVRKSGIKVCCGGI---LGLGEMIDDRIDMLLTLANLSTPPESI---PINLLIPIPGSK-------  243 (328)
Q Consensus       179 ~~~~-~~~l~~~-~~a~~~G~~~~sg~l---~G~gEt~eeri~~l~~lr~l~~~~~~v---~~~~~~p~~gt~-------  243 (328)
                      ..+| ..|++-+ +.+..+..|+    |   +|.|=+.+    .+..|.++++.+--|   .=--|..+++-+       
T Consensus       169 Dr~F~~G~l~~i~~~~~~~~vPV----IvKEvG~G~S~e----~a~~L~~~Gv~aiDv~G~GGTswa~vE~~Rr~~~~~~  240 (349)
T TIGR02151       169 DRNFSKGWLEKIAEICSAVSVPV----IVKEVGFGISKE----VAKLLADAGVKAIDVSGAGGTSWAAVENYRRAKESNQ  240 (349)
T ss_pred             CHHHHHHHHHHHHHHHHHCCCCE----EEEECCCCCCHH----HHHHHHHCCEEEEEECCCCCCCHHHHHHHHHHCCCCC
T ss_conf             70156538999999996528987----998215799889----9999987890088707876755999998875157523