HHsearch alignment for GI: 254780485 and conserved domain: pfam06968

>pfam06968 BATS Biotin and Thiamin Synthesis associated domain. Biotin synthase (BioB), EC:2.8.1.6, catalyses the last step of the biotin biosynthetic pathway. The reaction consists in the introduction of a sulphur atom into dethiobiotin. BioB functions as a homodimer. Thiamin synthesis if a complex process involving at least six gene products (ThiFSGH, ThiI and ThiJ). Two of the proteins required for the biosynthesis of the thiazole moiety of thiamine (vitamin B(1)) are ThiG and ThiH (this family) and form a heterodimer. Both of these reactions are thought of involve the binding of co-factors, and both function as dimers. This domain therefore may be involved in co-factor binding or dimerization (Finn, RD personal observation).
Probab=99.81  E-value=1.1e-19  Score=151.47  Aligned_cols=93  Identities=41%  Similarity=0.695  Sum_probs=87.7

Q ss_pred             ECCCEEECCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCEEEEHHHHHCHHHHHHHHHHCCCEEEECCEEECCCCCCHH
Q ss_conf             05411204874124456879899999999999968687214231156516568999998099889977866515888989
Q gi|254780485|r  232 PINLLIPIPGSKFEENKKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYN  311 (328)
Q Consensus       232 ~~~~~~p~~gt~l~~~~~~~~~e~lr~iAi~RL~lP~~~i~i~~~~~~~~~~~~~~~L~~GaN~~~~g~~~~t~~g~~~~  311 (328)
T Consensus         1 piN~L~P~~Gtpl~~~~~l~~~e~l~~ia~~Rl~~P~~~irla~gre~~l~d~~~~~~~sgans~~~G~yltt~g~r~~~   80 (93)
T pfam06968         1 PINFLRPIEGTPLEDQPPLSDEEALKTIAAFRLLLPDAGIRLSGGREALLRDLQGLAFMSGANSTFVGGYLTTSGNRSPD   80 (93)
T ss_pred             CCCEECCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHCCCEEEECCCEECCCCCCHH
T ss_conf             95130258999888999999999999999999986995289727962122515999998305304787835428999889


Q ss_pred             HHHHHHHHCCCCC
Q ss_conf             9999999829853
Q gi|254780485|r  312 KDTILFNRLGLIP  324 (328)
Q Consensus       312 ~~~~~i~~~G~~P  324 (328)
T Consensus        81 ~d~~mi~~~G~~p   93 (93)
T pfam06968        81 EDIAMLKDLGLEP   93 (93)
T ss_pred             HHHHHHHHCCCCC
T ss_conf             9999999859999