PSIBLAST alignment of GI: 254780485 and protein with PDB id: 3ciw

>gi|178847575|pdb|3CIW|A Chain A, X-Ray Structure Of The [fefe]-Hydrogenase Maturase Hyde From Thermotoga Maritima Length = 348
>gi|259090312|pdb|3IIX|A Chain A, X-Ray Structure Of The Fefe-Hydrogenase Maturase Hyde From T. Maritima In Complex With Methionine And 5'deoxyadenosine Length = 348
 Score =  179 bits (453), Expect = 6e-43,   Method: Composition-based stats.
 Identities = 65/339 (19%), Positives = 132/339 (38%), Gaps = 31/339 (9%)

Query: 8   PEENPTKKPKVWTSK---EVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGG 64
                 ++ + +T +   E   I +  FN+ LF      R+ +  + + +  ++   +  
Sbjct: 5   EILEKLERRE-FTREVLKEALSINDRGFNEALFKLADEIRRKYVGDEVHIRAIIEF-SNV 62

Query: 65  CPENCGYCNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSI 124
           C +NC YC     NK+       +  +++++ A+ A + GA    + +   E       +
Sbjct: 63  CRKNCLYCGLRRDNKN--LKRYRMTPEEIVERARLAVQFGAKTIVLQSG--EDPYXMPDV 118

Query: 125 IVDMIKGVKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTS-ERFYPHVTTTHTFE 183
           I D++K +K +G+   ++LG    E  +   +AG D Y    +T+    +  +    +FE
Sbjct: 119 ISDIVKEIKKMGVAVTLSLGEWPREYYEKWKEAGADRYLLRHETANPVLHRKLRPDTSFE 178

Query: 184 DRLQTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSK 243
           +RL  L  +++ G +   G ++GL     D +   L         + + I   IP P + 
Sbjct: 179 NRLNXLLTLKELGYETGAGSMVGLPGQTIDDLVDDLLFLK-EHDFDMVGIGPFIPHPDTP 237

Query: 244 FEENKKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLL 303
               KK D    ++++++ RIL+P S +        +    + +    GAN I       
Sbjct: 238 LANEKKGDFTLTLKMVALTRILLPDSNIPATTAMGTIVPGGREITLRCGANVIMP--NWT 295

Query: 304 TAKNPS-----------YNKD-------TILFNRLGLIP 324
            +               + KD         +   LG  P
Sbjct: 296 PSPYRQLYQLYPGKICVFEKDTACIPXVMKMIELLGRKP 334