BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780485|ref|YP_003064898.1| biotin synthase [Candidatus
Liberibacter asiaticus str. psy62]
         (328 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done



>gi|85712880|ref|ZP_01043921.1| Biotin synthase [Idiomarina baltica OS145]
 gi|85693260|gb|EAQ31217.1| Biotin synthase [Idiomarina baltica OS145]
          Length = 350

 Score =  343 bits (879), Expect = 3e-92,   Method: Composition-based stats.
 Identities = 181/314 (57%), Positives = 239/314 (76%)

Query: 12  PTKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGY 71
            T+    WT +EV Q+  MPFNDL+F + TVHR++F+PN +Q+S LL+IKTG CPE+C Y
Sbjct: 6   KTEVRNDWTPEEVSQLLTMPFNDLVFQAQTVHRQHFDPNQVQVSTLLSIKTGACPEDCKY 65

Query: 72  CNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKG 131
           C QS H  + L   +L+ V++VL+EA+ AK+ GA+R+CMGAAWR PK+RD+  +++M+KG
Sbjct: 66  CPQSAHYHTGLDRERLMAVEKVLQEAQLAKDKGASRFCMGAAWRNPKDRDMPYVIEMVKG 125

Query: 132 VKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLEN 191
           VK LGLETCMTLGMLS EQA  L +AGLDYYNHN+DTS  FY  + TT T++DRL TL N
Sbjct: 126 VKELGLETCMTLGMLSPEQAAALQQAGLDYYNHNLDTSPEFYGDIITTRTYQDRLNTLRN 185

Query: 192 VRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVD 251
           VR +G+KVC GGI+G+GE ++DR  +L+ LANL   PES+PIN+L+ + G+ FE    +D
Sbjct: 186 VRDAGMKVCAGGIVGMGESVEDRASLLVQLANLPKHPESVPINMLVKVKGTPFENLDDLD 245

Query: 252 PIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYN 311
           PI+ VR I+VARILMP S +RL+AGR  MSDE+QA+CF +GANSIF G+ LLT  NP  +
Sbjct: 246 PIDFVRTIAVARILMPASHVRLSAGREYMSDEMQAMCFLAGANSIFYGEKLLTTSNPEAD 305

Query: 312 KDTILFNRLGLIPD 325
            D  LFNRLG+ P+
Sbjct: 306 ADLQLFNRLGITPE 319


>gi|254780485|ref|YP_003064898.1| biotin synthase [Candidatus Liberibacter asiaticus str. psy62]
 gi|254040162|gb|ACT56958.1| biotin synthase [Candidatus Liberibacter asiaticus str. psy62]
          Length = 328

 Score =  342 bits (878), Expect = 4e-92,   Method: Composition-based stats.
 Identities = 328/328 (100%), Positives = 328/328 (100%)

Query: 1   MSRSTVVPEENPTKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNI 60
           MSRSTVVPEENPTKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNI
Sbjct: 1   MSRSTVVPEENPTKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNI 60

Query: 61  KTGGCPENCGYCNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKER 120
           KTGGCPENCGYCNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKER
Sbjct: 61  KTGGCPENCGYCNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKER 120

Query: 121 DLSIIVDMIKGVKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTH 180
           DLSIIVDMIKGVKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTH
Sbjct: 121 DLSIIVDMIKGVKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTH 180

Query: 181 TFEDRLQTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIP 240
           TFEDRLQTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIP
Sbjct: 181 TFEDRLQTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIP 240

Query: 241 GSKFEENKKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGD 300
           GSKFEENKKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGD
Sbjct: 241 GSKFEENKKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGD 300

Query: 301 TLLTAKNPSYNKDTILFNRLGLIPDLSA 328
           TLLTAKNPSYNKDTILFNRLGLIPDLSA
Sbjct: 301 TLLTAKNPSYNKDTILFNRLGLIPDLSA 328


>gi|237807869|ref|YP_002892309.1| biotin synthase [Tolumonas auensis DSM 9187]
 gi|237500130|gb|ACQ92723.1| biotin synthase [Tolumonas auensis DSM 9187]
          Length = 355

 Score =  336 bits (862), Expect = 3e-90,   Method: Composition-based stats.
 Identities = 170/316 (53%), Positives = 231/316 (73%)

Query: 13  TKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYC 72
                 WT  EV  ++ +PFNDLLF +  VHR+NF PN +Q+S LL+IKTG CPE+C YC
Sbjct: 3   VSIRHNWTVSEVESLFALPFNDLLFQAQLVHRENFNPNEVQVSTLLSIKTGACPEDCKYC 62

Query: 73  NQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGV 132
            QS    + L+   L+ V++VL+ A+ AKE G++R+CMGAAWR P++RD+  I+ MI+ V
Sbjct: 63  PQSARYNTGLEKETLLEVEKVLQRAQEAKEAGSSRFCMGAAWRNPRDRDMPYIIRMIQEV 122

Query: 133 KSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENV 192
           K LG+ETCMTLGML+ EQAQ L++AGLDYYNHN+DTS  FY  + TT T+++RL TL++V
Sbjct: 123 KGLGMETCMTLGMLTEEQAQQLAEAGLDYYNHNLDTSPEFYNAIITTRTYQERLDTLQHV 182

Query: 193 RKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDP 252
           R +G+K+C GGI+G+GE ++DR  +L+ LANL   PES+PIN+L+ + G+  E    +DP
Sbjct: 183 RDAGMKICSGGIVGMGEQVEDRAGLLVQLANLPVQPESVPINMLVKVKGTPMENQADLDP 242

Query: 253 IEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNK 312
            + +R I+VARILMPKS +RL+AGR  M+D++QALCF +GANSIF G  LLT  N   N+
Sbjct: 243 FDFIRTIAVARILMPKSHVRLSAGREKMNDQMQALCFMAGANSIFYGCKLLTTPNADANE 302

Query: 313 DTILFNRLGLIPDLSA 328
           D  LF RLGL P+  A
Sbjct: 303 DMQLFARLGLKPEARA 318


>gi|42543470|pdb|1R30|A Chain A, The Crystal Structure Of Biotin Synthase, An S-
           Adenosylmethionine-Dependent Radical Enzyme
 gi|42543471|pdb|1R30|B Chain B, The Crystal Structure Of Biotin Synthase, An S-
           Adenosylmethionine-Dependent Radical Enzyme
          Length = 369

 Score =  336 bits (861), Expect = 3e-90,   Method: Composition-based stats.
 Identities = 168/316 (53%), Positives = 228/316 (72%)

Query: 13  TKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYC 72
           +     WT  +V +++  P  DLLF +  VHR++F+P  +Q+S LL+IKTG CPE+C YC
Sbjct: 24  SAHRPRWTLSQVTELFEKPLLDLLFEAQQVHRQHFDPRQVQVSTLLSIKTGACPEDCKYC 83

Query: 73  NQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGV 132
            QS   K+ L+A +L+ V+QVL+ A+ AK  G+TR+CMGAAW+ P ERD+  +  M++GV
Sbjct: 84  PQSSRYKTGLEAERLMEVEQVLESARKAKAAGSTRFCMGAAWKNPHERDMPYLEQMVQGV 143

Query: 133 KSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENV 192
           K++GLE CMTLG LS  QAQ L+ AGLDYYNHN+DTS  FY ++ TT T+++RL TLE V
Sbjct: 144 KAMGLEACMTLGTLSESQAQRLANAGLDYYNHNLDTSPEFYGNIITTRTYQERLDTLEKV 203

Query: 193 RKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDP 252
           R +GIKVC GGI+GLGE + DR  +LL LANL TPPES+PIN+L+ + G+   +N  VD 
Sbjct: 204 RDAGIKVCSGGIVGLGETVKDRAGLLLQLANLPTPPESVPINMLVKVKGTPLADNDDVDA 263

Query: 253 IEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNK 312
            + +R I+VARI+MP S +RL+AGR  M+++ QA+CF +GANSIF G  LLT  NP  +K
Sbjct: 264 FDFIRTIAVARIMMPTSYVRLSAGREQMNEQTQAMCFMAGANSIFYGCKLLTTPNPEEDK 323

Query: 313 DTILFNRLGLIPDLSA 328
           D  LF +LGL P  +A
Sbjct: 324 DLQLFRKLGLNPQQTA 339


>gi|290474081|ref|YP_003466956.1| biotin synthetase [Xenorhabdus bovienii SS-2004]
 gi|289173389|emb|CBJ80166.1| biotin synthetase [Xenorhabdus bovienii SS-2004]
          Length = 346

 Score =  335 bits (859), Expect = 5e-90,   Method: Composition-based stats.
 Identities = 168/313 (53%), Positives = 230/313 (73%)

Query: 15  KPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQ 74
           + + WT K+   +++ PF +LLF +  VHR++F+P  +Q+S LL+IKTG CPE+C YC Q
Sbjct: 3   ERQQWTVKQAQALFDQPFFELLFQAQQVHREHFDPQQVQVSTLLSIKTGACPEDCKYCPQ 62

Query: 75  SVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKS 134
           S   K+ L+  +L+ V+QV++ A+ AK  G+TR+CMGAAW+ P ERD+  +  M+K VK 
Sbjct: 63  SSRYKTGLEKERLMEVEQVIESARKAKNAGSTRFCMGAAWKNPHERDMPYLETMVKEVKE 122

Query: 135 LGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRK 194
           LG+ETCMTLGML+  QAQ L++AGLDYYNHN+DTS  FY +V TT +++DRL TL NVR 
Sbjct: 123 LGMETCMTLGMLNQTQAQRLAEAGLDYYNHNLDTSPEFYGNVITTRSYQDRLNTLGNVRD 182

Query: 195 SGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIE 254
           +GIKVC GGI+GLGE I DR  +L+ LANL  PPES+PIN+L+ + G+  E N  VDP +
Sbjct: 183 AGIKVCSGGIVGLGEQIRDRAALLVQLANLPKPPESVPINMLVKVKGTPLENNDDVDPFD 242

Query: 255 HVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDT 314
            +R I+VARI+MP S +RL+AGR  M+++ QA+CF +GANSIF G  LLT  NP+ +KD 
Sbjct: 243 FIRTIAVARIMMPASHVRLSAGREQMNEQTQAMCFMAGANSIFYGCKLLTTPNPNEDKDL 302

Query: 315 ILFNRLGLIPDLS 327
            LF RLG+ P  +
Sbjct: 303 QLFRRLGINPQQT 315


>gi|301646203|ref|ZP_07246099.1| biotin synthase [Escherichia coli MS 146-1]
 gi|301075540|gb|EFK90346.1| biotin synthase [Escherichia coli MS 146-1]
          Length = 367

 Score =  335 bits (859), Expect = 5e-90,   Method: Composition-based stats.
 Identities = 169/319 (52%), Positives = 229/319 (71%)

Query: 10  ENPTKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENC 69
            +P      WT  +V +++  P  DLLF +  VHR++F+P  +Q+S LL+IKTG CPE+C
Sbjct: 19  RSPMAHRPRWTLSQVTELFEKPLLDLLFEAQQVHRQHFDPRQVQVSTLLSIKTGACPEDC 78

Query: 70  GYCNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMI 129
            YC QS   K+ L+A +L+ V+QVL+ A+ AK  G+TR+CMGAAW+ P ERD+  +  M+
Sbjct: 79  KYCPQSSRYKTGLEAERLMEVEQVLESARKAKAAGSTRFCMGAAWKNPHERDMPYLEQMV 138

Query: 130 KGVKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTL 189
           +GVK++GLE CMTLG LS  QAQ L+ AGLDYYNHN+DTS  FY ++ TT T+++RL TL
Sbjct: 139 QGVKAMGLEACMTLGTLSESQAQRLANAGLDYYNHNLDTSPEFYGNIITTRTYQERLDTL 198

Query: 190 ENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKK 249
           E VR +GIKVC GGI+GLGE + DR  +LL LANL TPPES+PIN+L+ + G+   +N  
Sbjct: 199 EKVRDAGIKVCSGGIVGLGETVKDRAGLLLQLANLPTPPESVPINMLVKVKGTPLADNDD 258

Query: 250 VDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPS 309
           VD  + +R I+VARI+MP S +RL+AGR  M+++ QA+CF +GANSIF G  LLT  NP 
Sbjct: 259 VDAFDFIRTIAVARIMMPTSYVRLSAGREQMNEQTQAMCFMAGANSIFYGCKLLTTPNPE 318

Query: 310 YNKDTILFNRLGLIPDLSA 328
            +KD  LF +LGL P  +A
Sbjct: 319 EDKDLQLFRKLGLNPQQTA 337


>gi|123443121|ref|YP_001007095.1| biotin synthase [Yersinia enterocolitica subsp. enterocolitica
           8081]
 gi|254813113|sp|A1JS69|BIOB_YERE8 RecName: Full=Biotin synthase
 gi|122090082|emb|CAL12945.1| biotin synthase [Yersinia enterocolitica subsp. enterocolitica
           8081]
          Length = 350

 Score =  335 bits (858), Expect = 6e-90,   Method: Composition-based stats.
 Identities = 162/311 (52%), Positives = 222/311 (71%)

Query: 18  VWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQSVH 77
            WT  +   ++  P  DLLF +  +HR++F+P  +Q+S LL+IKTG CPE+C YC QS  
Sbjct: 6   RWTVGQAQALFEKPLLDLLFEAQQIHRQHFDPRQVQVSTLLSIKTGACPEDCKYCPQSSR 65

Query: 78  NKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLGL 137
            K+ L++ +L+ V+QVL+ AK AK  G+TR+CMGAAW+ P ERD+  +  M++GVK++G+
Sbjct: 66  YKTGLESERLMQVEQVLESAKKAKAAGSTRFCMGAAWKNPHERDMPYLEKMVEGVKAMGM 125

Query: 138 ETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSGI 197
           ETCMTLG L  +QA  L+ AGLDYYNHN+DTS  FY  + TT ++++RL TL  VR +GI
Sbjct: 126 ETCMTLGTLDKQQAHRLADAGLDYYNHNLDTSPEFYGSIITTRSYQERLDTLSEVRDAGI 185

Query: 198 KVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEHVR 257
           KVC GGI+GLGE + DR  +L+ LANL  PPES+PIN+L+ + G+  E N  VD  E +R
Sbjct: 186 KVCSGGIVGLGETVRDRAGLLVQLANLPKPPESVPINMLVKVKGTPLENNDDVDAFEFIR 245

Query: 258 IISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTILF 317
            I+VARI+MP S +RL+AGR  M+++ QA+CF +GANSIF G  LLT  NP  +KD  LF
Sbjct: 246 TIAVARIMMPTSYVRLSAGREQMNEQTQAMCFMAGANSIFYGCKLLTTPNPEEDKDLQLF 305

Query: 318 NRLGLIPDLSA 328
            +LGL P  +A
Sbjct: 306 RKLGLNPQQTA 316


>gi|156934737|ref|YP_001438653.1| hypothetical protein ESA_02572 [Cronobacter sakazakii ATCC BAA-894]
 gi|254810683|sp|A7MJ03|BIOB_ENTS8 RecName: Full=Biotin synthase
 gi|156532991|gb|ABU77817.1| hypothetical protein ESA_02572 [Cronobacter sakazakii ATCC BAA-894]
          Length = 346

 Score =  335 bits (858), Expect = 8e-90,   Method: Composition-based stats.
 Identities = 169/311 (54%), Positives = 230/311 (73%)

Query: 18  VWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQSVH 77
            WT  +V +++  P  DLLF +  VHR++F+P  +Q+S LL+IKTG CPE+C YC QS  
Sbjct: 6   RWTLSQVTELFEKPLLDLLFEAQQVHRQHFDPRQVQVSTLLSIKTGACPEDCKYCPQSAR 65

Query: 78  NKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLGL 137
            K+ L+A +L+ V+QVL  A+ AK  G+TR+CMGAAW+ P +RD+  +  M++GVK+LGL
Sbjct: 66  YKTGLEAERLMEVEQVLDSARKAKAAGSTRFCMGAAWKNPNDRDMPYLEQMVQGVKALGL 125

Query: 138 ETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSGI 197
           ETCMTLG LS +QAQ L +AGLDYYNHN+DTS  FY ++ TT T+++RL TLE VR++GI
Sbjct: 126 ETCMTLGTLSDDQAQRLGEAGLDYYNHNLDTSPEFYGNIITTRTYQERLDTLEKVREAGI 185

Query: 198 KVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEHVR 257
           KVC GGI+GLGE + DR  +LL LANL TPPES+PIN+L+ + G+   +N+ VD  + +R
Sbjct: 186 KVCSGGIVGLGETVTDRAGLLLQLANLPTPPESVPINMLVKVKGTPLADNEDVDAFDFIR 245

Query: 258 IISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTILF 317
            I+VARI+MP S +RL+AGR  M+++ QA+CF +GANSIF G  LLT  NP  +KD  LF
Sbjct: 246 TIAVARIMMPTSYVRLSAGREQMNEQTQAMCFMAGANSIFYGCKLLTTPNPEEDKDLQLF 305

Query: 318 NRLGLIPDLSA 328
            +LGL P  +A
Sbjct: 306 RKLGLNPQQTA 316


>gi|22126908|ref|NP_670331.1| biotin synthase [Yersinia pestis KIM 10]
 gi|45440844|ref|NP_992383.1| biotin synthase [Yersinia pestis biovar Microtus str. 91001]
 gi|51595526|ref|YP_069717.1| biotin synthase [Yersinia pseudotuberculosis IP 32953]
 gi|108807054|ref|YP_650970.1| biotin synthase [Yersinia pestis Antiqua]
 gi|108813010|ref|YP_648777.1| biotin synthase [Yersinia pestis Nepal516]
 gi|145599815|ref|YP_001163891.1| biotin synthase [Yersinia pestis Pestoides F]
 gi|149366853|ref|ZP_01888887.1| biotin synthase [Yersinia pestis CA88-4125]
 gi|162418526|ref|YP_001605944.1| biotin synthase [Yersinia pestis Angola]
 gi|165924397|ref|ZP_02220229.1| biotin synthase [Yersinia pestis biovar Orientalis str. F1991016]
 gi|165938412|ref|ZP_02226970.1| biotin synthase [Yersinia pestis biovar Orientalis str. IP275]
 gi|166011565|ref|ZP_02232463.1| biotin synthase [Yersinia pestis biovar Antiqua str. E1979001]
 gi|166211529|ref|ZP_02237564.1| biotin synthase [Yersinia pestis biovar Antiqua str. B42003004]
 gi|167400144|ref|ZP_02305657.1| biotin synthase [Yersinia pestis biovar Antiqua str. UG05-0454]
 gi|167419543|ref|ZP_02311296.1| biotin synthase [Yersinia pestis biovar Orientalis str. MG05-1020]
 gi|167424323|ref|ZP_02316076.1| biotin synthase [Yersinia pestis biovar Mediaevalis str. K1973002]
 gi|170025153|ref|YP_001721658.1| biotin synthase [Yersinia pseudotuberculosis YPIII]
 gi|186894581|ref|YP_001871693.1| biotin synthase [Yersinia pseudotuberculosis PB1/+]
 gi|218928315|ref|YP_002346190.1| biotin synthase [Yersinia pestis CO92]
 gi|229841090|ref|ZP_04461249.1| biotin synthase [Yersinia pestis biovar Orientalis str. PEXU2]
 gi|229843194|ref|ZP_04463340.1| biotin synthase [Yersinia pestis biovar Orientalis str. India 195]
 gi|229894028|ref|ZP_04509214.1| biotin synthase [Yersinia pestis Pestoides A]
 gi|229903448|ref|ZP_04518561.1| biotin synthase [Yersinia pestis Nepal516]
 gi|270487225|ref|ZP_06204299.1| biotin synthase [Yersinia pestis KIM D27]
 gi|294503153|ref|YP_003567215.1| biotin synthase [Yersinia pestis Z176003]
 gi|81640049|sp|Q66D67|BIOB_YERPS RecName: Full=Biotin synthase
 gi|123073231|sp|Q1CFQ3|BIOB_YERPN RecName: Full=Biotin synthase
 gi|123245884|sp|Q1C947|BIOB_YERPA RecName: Full=Biotin synthase
 gi|123777518|sp|Q7CH65|BIOB_YERPE RecName: Full=Biotin synthase
 gi|254813115|sp|B2K8T0|BIOB_YERPB RecName: Full=Biotin synthase
 gi|254813116|sp|A9R3C8|BIOB_YERPG RecName: Full=Biotin synthase
 gi|254813117|sp|A4TNQ6|BIOB_YERPP RecName: Full=Biotin synthase
 gi|254813118|sp|B1JSS4|BIOB_YERPY RecName: Full=Biotin synthase
 gi|21959945|gb|AAM86582.1|AE013904_6 biotin synthetase [Yersinia pestis KIM 10]
 gi|45435702|gb|AAS61260.1| biotin synthase [Yersinia pestis biovar Microtus str. 91001]
 gi|51588808|emb|CAH20422.1| biotin synthase [Yersinia pseudotuberculosis IP 32953]
 gi|108776658|gb|ABG19177.1| biotin synthase [Yersinia pestis Nepal516]
 gi|108778967|gb|ABG13025.1| biotin synthase [Yersinia pestis Antiqua]
 gi|115346926|emb|CAL19815.1| biotin synthase [Yersinia pestis CO92]
 gi|145211511|gb|ABP40918.1| biotin synthase [Yersinia pestis Pestoides F]
 gi|149291227|gb|EDM41302.1| biotin synthase [Yersinia pestis CA88-4125]
 gi|162351341|gb|ABX85289.1| biotin synthase [Yersinia pestis Angola]
 gi|165913790|gb|EDR32409.1| biotin synthase [Yersinia pestis biovar Orientalis str. IP275]
 gi|165923457|gb|EDR40589.1| biotin synthase [Yersinia pestis biovar Orientalis str. F1991016]
 gi|165989513|gb|EDR41814.1| biotin synthase [Yersinia pestis biovar Antiqua str. E1979001]
 gi|166207300|gb|EDR51780.1| biotin synthase [Yersinia pestis biovar Antiqua str. B42003004]
 gi|166962284|gb|EDR58305.1| biotin synthase [Yersinia pestis biovar Orientalis str. MG05-1020]
 gi|167050093|gb|EDR61501.1| biotin synthase [Yersinia pestis biovar Antiqua str. UG05-0454]
 gi|167057172|gb|EDR66935.1| biotin synthase [Yersinia pestis biovar Mediaevalis str. K1973002]
 gi|169751687|gb|ACA69205.1| biotin synthase [Yersinia pseudotuberculosis YPIII]
 gi|186697607|gb|ACC88236.1| biotin synthase [Yersinia pseudotuberculosis PB1/+]
 gi|229679218|gb|EEO75321.1| biotin synthase [Yersinia pestis Nepal516]
 gi|229689541|gb|EEO81602.1| biotin synthase [Yersinia pestis biovar Orientalis str. India 195]
 gi|229697456|gb|EEO87503.1| biotin synthase [Yersinia pestis biovar Orientalis str. PEXU2]
 gi|229703913|gb|EEO90926.1| biotin synthase [Yersinia pestis Pestoides A]
 gi|262361190|gb|ACY57911.1| biotin synthase [Yersinia pestis D106004]
 gi|262365253|gb|ACY61810.1| biotin synthase [Yersinia pestis D182038]
 gi|270335729|gb|EFA46506.1| biotin synthase [Yersinia pestis KIM D27]
 gi|294353612|gb|ADE63953.1| biotin synthase [Yersinia pestis Z176003]
 gi|320014290|gb|ADV97861.1| biotin synthase [Yersinia pestis biovar Medievalis str. Harbin 35]
          Length = 345

 Score =  335 bits (858), Expect = 8e-90,   Method: Composition-based stats.
 Identities = 164/312 (52%), Positives = 225/312 (72%)

Query: 17  KVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQSV 76
             WT  +   +++ P  +LLF +  VHR++F+P  +Q+S LL+IKTG CPE+C YC QS 
Sbjct: 5   HHWTVGQALALFDKPLLELLFEAQQVHRQHFDPRQVQVSTLLSIKTGACPEDCKYCPQSS 64

Query: 77  HNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLG 136
             K+ L++ +L+ V+QVL+ AK AK  G+TR+CMGAAW+ P ERD+  +  M++GVK+LG
Sbjct: 65  RYKTGLESERLMQVEQVLESAKKAKAAGSTRFCMGAAWKNPHERDMPYLAKMVEGVKALG 124

Query: 137 LETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSG 196
           +ETCMTLG LS +QA  L+ AGLDYYNHN+DTS  FY  + TT ++++RL TL  VR +G
Sbjct: 125 METCMTLGSLSKQQAHRLADAGLDYYNHNLDTSPEFYGSIITTRSYQERLDTLNEVRDAG 184

Query: 197 IKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEHV 256
           IKVC GGI+GLGE + DR  +L+ LANL  PPES+PIN+L+ + G+  E N +VD  E +
Sbjct: 185 IKVCSGGIVGLGETVRDRAGLLVQLANLPKPPESVPINMLVKVKGTPLENNAEVDAFEFI 244

Query: 257 RIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTIL 316
           R I+VARI+MP S +RL+AGR  M+++ QA+CF +GANSIF G  LLT  NP  +KD  L
Sbjct: 245 RTIAVARIMMPSSYVRLSAGREQMNEQTQAMCFMAGANSIFYGCKLLTTPNPDEDKDLQL 304

Query: 317 FNRLGLIPDLSA 328
           F +LGL P  +A
Sbjct: 305 FRKLGLNPQQTA 316


>gi|332160994|ref|YP_004297571.1| biotin synthase [Yersinia enterocolitica subsp. palearctica
           105.5R(r)]
 gi|318604865|emb|CBY26363.1| biotin synthase [Yersinia enterocolitica subsp. palearctica Y11]
 gi|325665224|gb|ADZ41868.1| biotin synthase [Yersinia enterocolitica subsp. palearctica
           105.5R(r)]
 gi|330863971|emb|CBX74053.1| biotin synthase [Yersinia enterocolitica W22703]
          Length = 350

 Score =  334 bits (856), Expect = 1e-89,   Method: Composition-based stats.
 Identities = 162/311 (52%), Positives = 222/311 (71%)

Query: 18  VWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQSVH 77
            WT  +   ++  P  DLLF +  +HR++F+P  +Q+S LL+IKTG CPE+C YC QS  
Sbjct: 6   RWTVGQAQALFEKPLLDLLFEAQQIHRQHFDPRQVQVSTLLSIKTGACPEDCKYCPQSSR 65

Query: 78  NKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLGL 137
            K+ L++ +L+ V+QVL+ AK AK  G+TR+CMGAAW+ P ERD+  +  M++GVK++G+
Sbjct: 66  YKTGLESERLMQVEQVLESAKKAKAAGSTRFCMGAAWKNPHERDMPYLEKMVEGVKAMGM 125

Query: 138 ETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSGI 197
           ETCMTLG L  +QA  L+ AGLDYYNHN+DTS  FY  + TT ++++RL TL  VR +GI
Sbjct: 126 ETCMTLGTLDKQQAHRLADAGLDYYNHNLDTSPEFYGSIITTRSYQERLDTLSEVRDAGI 185

Query: 198 KVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEHVR 257
           KVC GGI+GLGE + DR  +L+ LANL  PPES+PIN+L+ + G+  E N  VD  E +R
Sbjct: 186 KVCSGGIVGLGETVRDRAGLLVQLANLPKPPESVPINMLVKVKGTPLENNDDVDAFEFIR 245

Query: 258 IISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTILF 317
            I+VARI+MP S +RL+AGR  M+++ QA+CF +GANSIF G  LLT  NP  +KD  LF
Sbjct: 246 TIAVARIMMPTSYVRLSAGREQMNEQTQAMCFMAGANSIFYGCKLLTTPNPEEDKDLQLF 305

Query: 318 NRLGLIPDLSA 328
            +LGL P  +A
Sbjct: 306 RKLGLNPQQTA 316


>gi|94501350|ref|ZP_01307870.1| biotin synthase [Oceanobacter sp. RED65]
 gi|94426463|gb|EAT11451.1| biotin synthase [Oceanobacter sp. RED65]
          Length = 352

 Score =  334 bits (856), Expect = 1e-89,   Method: Composition-based stats.
 Identities = 172/314 (54%), Positives = 236/314 (75%)

Query: 14  KKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCN 73
           +    W  +EV  ++++PFNDLLF + ++HR  F+PN +Q+S LL+IKTG CPE+C YC 
Sbjct: 8   QIRHDWNEQEVQALFDLPFNDLLFRAQSIHRTYFDPNEVQVSTLLSIKTGACPEDCKYCP 67

Query: 74  QSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVK 133
           QS H  + L+  +L+ V+ VL +AK AK  G+TR+CMGAAW+ P +RD+  +++M+KGVK
Sbjct: 68  QSAHYNTGLEKQRLMEVEAVLNKAKEAKAKGSTRFCMGAAWKNPNKRDMPYVLEMVKGVK 127

Query: 134 SLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVR 193
           ++GLETCMTLGML+ EQA  L++AGLDYYNHN+DTS  +Y  + TT T+ DRL TL++VR
Sbjct: 128 AMGLETCMTLGMLNEEQAGELAEAGLDYYNHNLDTSPDYYDQIITTRTYSDRLDTLQHVR 187

Query: 194 KSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPI 253
            SG+K+C GGI+G+GE   DRI +L  LANL   PES+PIN+L+ + G+  E+ + +DPI
Sbjct: 188 DSGMKICSGGIIGMGERKKDRIGLLAQLANLPVHPESVPINMLVKVKGTPLEDVEDLDPI 247

Query: 254 EHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKD 313
           + VR I+VARILMPKS +RL+AGR  MSDE+QA+CF +GANSIF G+ LLT  NP  +KD
Sbjct: 248 DFVRCIAVARILMPKSHVRLSAGREDMSDEMQAMCFMAGANSIFYGECLLTTPNPEAHKD 307

Query: 314 TILFNRLGLIPDLS 327
             LF RLGL P+ +
Sbjct: 308 MQLFKRLGLRPEQA 321


>gi|331005759|ref|ZP_08329118.1| Biotin synthase [gamma proteobacterium IMCC1989]
 gi|330420396|gb|EGG94703.1| Biotin synthase [gamma proteobacterium IMCC1989]
          Length = 380

 Score =  334 bits (855), Expect = 2e-89,   Method: Composition-based stats.
 Identities = 169/310 (54%), Positives = 231/310 (74%)

Query: 16  PKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQS 75
              W   EV  ++ +PFNDLLF + TVHR++F PN +Q+S L +IKTG CPE+C YC QS
Sbjct: 20  RHDWMRDEVSALFALPFNDLLFQAQTVHRQHFNPNQVQVSTLCSIKTGACPEDCKYCPQS 79

Query: 76  VHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSL 135
               + L+  KL+ VD V++EAK AK +GATR+CMGAAWR PK +DL  +V+M+KGVK+L
Sbjct: 80  ARYDTGLEKEKLMQVDAVIEEAKAAKSSGATRFCMGAAWRSPKNKDLPYVVEMVKGVKAL 139

Query: 136 GLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKS 195
           GLETCMTLGML  +Q+  L+ AGLDYYNHN+DTS+ +Y  + TT T++DRL TL+NVR +
Sbjct: 140 GLETCMTLGMLDDKQSSELAAAGLDYYNHNLDTSKEYYGDIITTRTYDDRLNTLQNVRDA 199

Query: 196 GIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEH 255
           G+KVC GGI+G+GE   DR+ +L+ LAN+   PES+PIN+L+ + G+ FE    +D  + 
Sbjct: 200 GMKVCSGGIVGMGEGEQDRVGLLIQLANMPAHPESVPINMLVRVEGTPFEALDDLDSFDF 259

Query: 256 VRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTI 315
           +R I+VARI+MPKS +RL+AGR  M++++QA+ FF+GANSIF G+ LLT  NP  +KD  
Sbjct: 260 IRTIAVARIIMPKSHVRLSAGREEMNEQMQAMAFFAGANSIFYGEKLLTTANPEADKDKQ 319

Query: 316 LFNRLGLIPD 325
           LF RLG+ P+
Sbjct: 320 LFKRLGIEPE 329


>gi|317491229|ref|ZP_07949665.1| biotin synthase [Enterobacteriaceae bacterium 9_2_54FAA]
 gi|316920776|gb|EFV42099.1| biotin synthase [Enterobacteriaceae bacterium 9_2_54FAA]
          Length = 345

 Score =  333 bits (854), Expect = 2e-89,   Method: Composition-based stats.
 Identities = 160/312 (51%), Positives = 223/312 (71%)

Query: 16  PKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQS 75
            + WT ++   ++  PF +L+F +  VHR++F+P  +Q+S LL+IKTG CPE+C YC QS
Sbjct: 4   RQHWTLEQAQALFAKPFLELMFEAQQVHRQHFDPRQVQVSTLLSIKTGACPEDCKYCPQS 63

Query: 76  VHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSL 135
              K+ L++ KL+ V QVL  A+ AK  G+TR+CMGAAW+ P +RD+  +  M++GVK +
Sbjct: 64  SRYKTGLESEKLMEVQQVLDSARQAKAAGSTRFCMGAAWKNPHDRDMPYLEQMVQGVKEM 123

Query: 136 GLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKS 195
           G+ETCMTLG LS +QA  L+ AGLDYYNHN+DTS  FY  + TT ++++RL TLE VR++
Sbjct: 124 GMETCMTLGTLSDQQANRLADAGLDYYNHNLDTSPEFYGSIITTRSYQERLDTLEKVREA 183

Query: 196 GIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEH 255
           GIKVC GGI+GLGE + DR  +L  LANL   PES+PIN+L+ + G+   +N  VD  + 
Sbjct: 184 GIKVCSGGIVGLGETVRDRAGLLTQLANLPKAPESVPINMLVKVQGTPLADNDDVDAFDF 243

Query: 256 VRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTI 315
           +R I+VARI+MP S +RL+AGR  M+++ QA+CF +GANSIF G  LLT  NP  +KD  
Sbjct: 244 IRTIAVARIMMPTSYVRLSAGREQMNEQTQAMCFMAGANSIFYGCKLLTTPNPGEDKDVQ 303

Query: 316 LFNRLGLIPDLS 327
           LF +LGL P L+
Sbjct: 304 LFRKLGLNPQLT 315


>gi|82543222|ref|YP_407169.1| biotin synthesis [Shigella boydii Sb227]
 gi|187732174|ref|YP_001881039.1| biotin synthase [Shigella boydii CDC 3083-94]
 gi|123742021|sp|Q324B7|BIOB_SHIBS RecName: Full=Biotin synthase
 gi|254811583|sp|B2TVF5|BIOB_SHIB3 RecName: Full=Biotin synthase
 gi|81244633|gb|ABB65341.1| biotin synthesis [Shigella boydii Sb227]
 gi|187429166|gb|ACD08440.1| biotin synthase [Shigella boydii CDC 3083-94]
 gi|320183264|gb|EFW58119.1| Biotin synthase [Shigella flexneri CDC 796-83]
 gi|332097396|gb|EGJ02376.1| biotin synthase [Shigella boydii 3594-74]
          Length = 346

 Score =  333 bits (854), Expect = 2e-89,   Method: Composition-based stats.
 Identities = 169/315 (53%), Positives = 226/315 (71%)

Query: 14  KKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCN 73
                WT  +V +++  P  DLLF +  VHR++F+P  +Q+S LL+IKTG CPE+C YC 
Sbjct: 2   AHRPRWTLSQVAELFEKPLLDLLFEAQQVHRQHFDPRQVQVSTLLSIKTGACPEDCKYCP 61

Query: 74  QSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVK 133
           QS   K+ L+A +L+ V+QVL+ A+ AK  G+TR+CMGAAW+ P ERD+  +  M++GVK
Sbjct: 62  QSSRYKTGLEAERLMEVEQVLESARKAKAAGSTRFCMGAAWKNPNERDMPYLEQMVQGVK 121

Query: 134 SLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVR 193
            LGLE CMTLG LS  QAQ L+ AGLDYYNHN+DTS  FY ++ TT T+++RL TLE VR
Sbjct: 122 DLGLEACMTLGTLSESQAQRLANAGLDYYNHNLDTSPEFYGNIITTRTYQERLDTLEKVR 181

Query: 194 KSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPI 253
            +GIKVC GGI+GLGE + DR  +LL LANL TPPES+PIN+L+ + G+   +N  VD  
Sbjct: 182 DAGIKVCSGGIVGLGETVKDRAGLLLQLANLPTPPESVPINMLVKVKGTPLADNDDVDAF 241

Query: 254 EHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKD 313
           + +R I+VARI+MP S +RL+AGR  M+++ QA+CF +GANSIF G  LLT  NP  +KD
Sbjct: 242 DFIRTIAVARIMMPTSYVRLSAGREQMNEQTQAMCFMAGANSIFYGCKLLTTPNPEEDKD 301

Query: 314 TILFNRLGLIPDLSA 328
             LF +LGL P  +A
Sbjct: 302 LQLFRKLGLNPQQTA 316


>gi|153948619|ref|YP_001401807.1| biotin synthase [Yersinia pseudotuberculosis IP 31758]
 gi|254813114|sp|A7FKM9|BIOB_YERP3 RecName: Full=Biotin synthase
 gi|152960114|gb|ABS47575.1| biotin synthase [Yersinia pseudotuberculosis IP 31758]
          Length = 345

 Score =  333 bits (854), Expect = 2e-89,   Method: Composition-based stats.
 Identities = 164/312 (52%), Positives = 225/312 (72%)

Query: 17  KVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQSV 76
             WT  +   +++ P  +LLF +  VHR++F+P  +Q+S LL+IKTG CPE+C YC QS 
Sbjct: 5   HHWTVGQALALFDKPLLELLFEAQQVHRQHFDPRQVQVSTLLSIKTGACPEDCKYCPQSS 64

Query: 77  HNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLG 136
             K+ L++ +L+ V+QVL+ AK AK  G+TR+CMGAAW+ P ERD+  +V M++GVK+LG
Sbjct: 65  RYKTGLESERLMQVEQVLESAKKAKAAGSTRFCMGAAWKNPHERDMPYLVKMVEGVKALG 124

Query: 137 LETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSG 196
           +ETCMTLG LS +QA  L+ AGLDYYNHN+DTS  FY  + TT ++++RL TL  VR +G
Sbjct: 125 METCMTLGSLSKQQAHRLADAGLDYYNHNLDTSPEFYGSIITTRSYQERLDTLNEVRDAG 184

Query: 197 IKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEHV 256
           IKVC GGI+GLGE + DR  +L+ LANL  PPES+PIN+L+ + G+  E N +VD  E +
Sbjct: 185 IKVCSGGIVGLGETVRDRAGLLVQLANLPKPPESVPINMLVKVKGTPLENNAEVDAFEFI 244

Query: 257 RIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTIL 316
           R I+VARI+MP S +RL+AGR  M+++ QA+CF +GANSIF G  LLT  NP  + D  L
Sbjct: 245 RTIAVARIMMPSSYVRLSAGREQMNEQTQAMCFMAGANSIFYGCKLLTTPNPDEDNDLQL 304

Query: 317 FNRLGLIPDLSA 328
           F +LGL P  +A
Sbjct: 305 FRKLGLNPQQTA 316


>gi|49086966|gb|AAT51401.1| PA0500 [synthetic construct]
          Length = 353

 Score =  333 bits (854), Expect = 2e-89,   Method: Composition-based stats.
 Identities = 169/313 (53%), Positives = 227/313 (72%)

Query: 13  TKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYC 72
                 W+  EV  ++  PFNDLLF + TVHR +F+PN +Q+S LL+IKTG CPE+C YC
Sbjct: 7   VATRHDWSLAEVRALFEQPFNDLLFQAQTVHRAHFDPNRVQVSTLLSIKTGACPEDCKYC 66

Query: 73  NQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGV 132
            QS H  + L   KL+ V +VL+ A  AK  G+TR+CMGAAW+ P  +D+  +++M+KGV
Sbjct: 67  PQSGHYNTGLDKEKLMEVQKVLEAAAEAKAIGSTRFCMGAAWKHPSAKDMPYVLEMVKGV 126

Query: 133 KSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENV 192
           K LGLETCMTLG L+ EQ Q L+ AGLDYYNHN+DTS  FY ++ TT T+ +RLQTL  V
Sbjct: 127 KKLGLETCMTLGRLTQEQTQALADAGLDYYNHNLDTSPEFYGNIITTRTYSERLQTLAYV 186

Query: 193 RKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDP 252
           R++G+K+C GGILG+GE +DDR  +L+ LANL   PES+PIN+L+ + G+   E K VDP
Sbjct: 187 REAGMKICSGGILGMGESVDDRAGLLIQLANLPEHPESVPINMLVKVKGTPLAEEKDVDP 246

Query: 253 IEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNK 312
            + +R ++VARI+MPKS +RL+AGR  M++++QAL F +GANSIF G+ LLT KNP   K
Sbjct: 247 FDFIRTLAVARIMMPKSHVRLSAGREQMNEQMQALAFMAGANSIFYGEKLLTTKNPQAEK 306

Query: 313 DTILFNRLGLIPD 325
           D  LF RLG+ P+
Sbjct: 307 DMQLFARLGIKPE 319


>gi|323958314|gb|EGB54022.1| biotin synthase [Escherichia coli H263]
          Length = 336

 Score =  333 bits (854), Expect = 2e-89,   Method: Composition-based stats.
 Identities = 168/315 (53%), Positives = 228/315 (72%)

Query: 14  KKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCN 73
                WT  +V +++  P  DLLF +  VHR++F+P  +Q+S LL+IKTG CPE+C YC 
Sbjct: 2   AHRPRWTLSQVTELFEKPLLDLLFEAQQVHRQHFDPRQVQVSTLLSIKTGACPEDCKYCP 61

Query: 74  QSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVK 133
           QS   K+ L+A +L+ V+QVL+ A+ AK  G+TR+CMGAAW+ P ERD+  +  M++GVK
Sbjct: 62  QSSRYKTGLEAERLMEVEQVLESARKAKAAGSTRFCMGAAWKNPHERDMPYLEQMVQGVK 121

Query: 134 SLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVR 193
           ++GLE CMTLG LS  QAQ L+ AGLDYYNHN+DTS  FY ++ TT T+++RL TLE VR
Sbjct: 122 AMGLEACMTLGTLSESQAQRLANAGLDYYNHNLDTSPEFYGNIITTRTYQERLDTLEKVR 181

Query: 194 KSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPI 253
           ++GIKVC GGI+GLGE + DR  +LL LANL TPPES+PIN+L+ + G+   +N  VD  
Sbjct: 182 EAGIKVCSGGIVGLGETVKDRAGLLLQLANLPTPPESVPINMLVKVKGTPLADNDDVDAF 241

Query: 254 EHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKD 313
           + +R I+VARI+MP S +RL+AGR  M+++ QA+CF +GANSIF G  LLT  NP  +KD
Sbjct: 242 DFIRTIAVARIMMPTSYVRLSAGREQMNEQTQAMCFMAGANSIFYGCKLLTTPNPEEDKD 301

Query: 314 TILFNRLGLIPDLSA 328
             LF +LGL P  +A
Sbjct: 302 LQLFRKLGLNPQQTA 316


>gi|333006893|gb|EGK26389.1| biotin synthase [Shigella flexneri VA-6]
 gi|333009761|gb|EGK29210.1| biotin synthase [Shigella flexneri K-272]
 gi|333020426|gb|EGK39689.1| biotin synthase [Shigella flexneri K-227]
          Length = 346

 Score =  333 bits (854), Expect = 2e-89,   Method: Composition-based stats.
 Identities = 168/315 (53%), Positives = 227/315 (72%)

Query: 14  KKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCN 73
                WT  +V +++  P  DLLF +  VHR++F+P  +Q+S LL+IKTG CPE+C YC 
Sbjct: 2   AHRPRWTLSQVTELFEKPLLDLLFEAQQVHRQHFDPRQVQVSTLLSIKTGACPEDCKYCP 61

Query: 74  QSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVK 133
           QS   K+ L+A +L+ V+QVL+ A+ AK  G+TR+CMGAAW+ P ERD+  +  M++GVK
Sbjct: 62  QSSRYKTGLEAERLMEVEQVLESARKAKAAGSTRFCMGAAWKNPHERDMPYLEQMVQGVK 121

Query: 134 SLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVR 193
           ++GLE CMTLG LS  QAQ L+ AGLDYYNHN+DTS  FY ++ TT T+++RL TLE VR
Sbjct: 122 AMGLEACMTLGTLSESQAQRLANAGLDYYNHNLDTSPEFYGNIITTRTYQERLDTLEKVR 181

Query: 194 KSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPI 253
            +GIKVC GGI+GLGE + DR  +LL LANL TPPES+PIN+L+ + G+   +N  VD  
Sbjct: 182 DAGIKVCSGGIVGLGETVKDRAGLLLQLANLPTPPESVPINMLVKVKGTPLADNDDVDAF 241

Query: 254 EHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKD 313
           + +R I+VARI+MP S +RL+AGR  M+++ QA+CF +GANSIF G  LLT  NP  +KD
Sbjct: 242 DFIRTIAVARIMMPTSYVRLSAGREQMNEQTQAMCFMAGANSIFYGCKLLTTPNPEEDKD 301

Query: 314 TILFNRLGLIPDLSA 328
             LF +LGL P  +A
Sbjct: 302 LQLFRKLGLNPQQTA 316


>gi|170769064|ref|ZP_02903517.1| biotin synthase [Escherichia albertii TW07627]
 gi|170122136|gb|EDS91067.1| biotin synthase [Escherichia albertii TW07627]
          Length = 346

 Score =  333 bits (853), Expect = 2e-89,   Method: Composition-based stats.
 Identities = 168/315 (53%), Positives = 228/315 (72%)

Query: 14  KKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCN 73
                WT  +V +++  P  DLLF +  VHR++F+P  +Q+S LL+IKTG CPE+C YC 
Sbjct: 2   AHRPRWTLSQVTELFEKPLLDLLFEAQQVHRQHFDPRQVQVSTLLSIKTGACPEDCKYCP 61

Query: 74  QSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVK 133
           QS   K+ L+A +L+ V+QVL+ A+ AK  G+TR+CMGAAW+ P ERD+  +  M++GVK
Sbjct: 62  QSSRYKTGLEAERLMEVEQVLESARKAKAAGSTRFCMGAAWKNPHERDMPYLEQMVQGVK 121

Query: 134 SLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVR 193
           ++GLE CMTLG LS  QAQ L+ AGLDYYNHN+DTS  FY ++ TT T+++RL TLE VR
Sbjct: 122 AMGLEACMTLGTLSESQAQRLANAGLDYYNHNLDTSPEFYGNIITTRTYQERLDTLEKVR 181

Query: 194 KSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPI 253
           ++GIKVC GGI+GLGE + DR  +LL LANL TPPES+PIN+L+ + G+   +N  VD  
Sbjct: 182 EAGIKVCSGGIVGLGETVKDRAGLLLQLANLPTPPESVPINMLVKVKGTPLADNDDVDAF 241

Query: 254 EHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKD 313
           + +R I+VARI+MP S +RL+AGR  M+++ QA+CF +GANSIF G  LLT  NP  +KD
Sbjct: 242 DFIRTIAVARIMMPTSYVRLSAGREQMNEQTQAMCFMAGANSIFYGCKLLTTPNPEEDKD 301

Query: 314 TILFNRLGLIPDLSA 328
             LF +LGL P  +A
Sbjct: 302 LQLFRKLGLNPQQTA 316


>gi|110640979|ref|YP_668707.1| biotin synthase [Escherichia coli 536]
 gi|191174197|ref|ZP_03035709.1| biotin synthase [Escherichia coli F11]
 gi|123049361|sp|Q0TJS3|BIOB_ECOL5 RecName: Full=Biotin synthase
 gi|110342571|gb|ABG68808.1| biotin synthase [Escherichia coli 536]
 gi|190905542|gb|EDV65169.1| biotin synthase [Escherichia coli F11]
          Length = 346

 Score =  333 bits (853), Expect = 3e-89,   Method: Composition-based stats.
 Identities = 168/315 (53%), Positives = 229/315 (72%)

Query: 14  KKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCN 73
                WT  +V +++  P  DLLF +  VHR++F+P  +Q+S LL+IKTG CPE+C YC 
Sbjct: 2   AHRPRWTLSQVTELFEKPLLDLLFEAQQVHRQHFDPRQVQVSTLLSIKTGACPEDCKYCP 61

Query: 74  QSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVK 133
           QS   K+ L+A +L+ V+QVL+ A+ AK  G+TR+CMGAAW+ P+ERD+  +  M++GVK
Sbjct: 62  QSSRYKTGLEAERLMEVEQVLESARKAKAAGSTRFCMGAAWKNPRERDMPYLEQMVQGVK 121

Query: 134 SLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVR 193
           ++GLE CMTLG LS  QAQ L+ AGLDYYNHN+DTS  FY ++ TT T+++RL TLE VR
Sbjct: 122 AMGLEACMTLGTLSESQAQRLANAGLDYYNHNLDTSPEFYGNIITTRTYQERLDTLEKVR 181

Query: 194 KSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPI 253
           ++GIKVC GGI+GLGE + DR  +LL LANL TPPES+PIN+L+ + G+   +N  VD  
Sbjct: 182 EAGIKVCSGGIVGLGETVKDRAGLLLQLANLPTPPESVPINMLVKVKGTPLADNDDVDAF 241

Query: 254 EHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKD 313
           + +R I+VARI+MP S +RL+AGR  M+++ QA+CF +GANSIF G  LLT  NP  +KD
Sbjct: 242 DFIRTIAVARIMMPTSYVRLSAGREQMNEQTQAMCFMAGANSIFYGCKLLTTPNPEEDKD 301

Query: 314 TILFNRLGLIPDLSA 328
             LF +LGL P  +A
Sbjct: 302 LQLFRKLGLNPQQTA 316


>gi|26246745|ref|NP_752785.1| biotin synthase [Escherichia coli CFT073]
 gi|91209804|ref|YP_539790.1| biotin synthase [Escherichia coli UTI89]
 gi|117622958|ref|YP_851871.1| biotin synthase [Escherichia coli APEC O1]
 gi|218557680|ref|YP_002390593.1| biotin synthase [Escherichia coli S88]
 gi|218688560|ref|YP_002396772.1| biotin synthase [Escherichia coli ED1a]
 gi|227884263|ref|ZP_04002068.1| biotin synthase [Escherichia coli 83972]
 gi|237707269|ref|ZP_04537750.1| biotin synthase [Escherichia sp. 3_2_53FAA]
 gi|306812824|ref|ZP_07447017.1| biotin synthase [Escherichia coli NC101]
 gi|331682282|ref|ZP_08382901.1| biotin synthase [Escherichia coli H299]
 gi|81590263|sp|Q8FJQ3|BIOB_ECOL6 RecName: Full=Biotin synthase
 gi|123084502|sp|Q1REF5|BIOB_ECOUT RecName: Full=Biotin synthase
 gi|254810673|sp|B7MQM8|BIOB_ECO81 RecName: Full=Biotin synthase
 gi|254810677|sp|A1A917|BIOB_ECOK1 RecName: Full=Biotin synthase
 gi|254810698|sp|B7MGN3|BIOB_ECO45 RecName: Full=Biotin synthase
 gi|26107144|gb|AAN79328.1|AE016757_232 Biotin synthase [Escherichia coli CFT073]
 gi|91071378|gb|ABE06259.1| biotin synthase [Escherichia coli UTI89]
 gi|115512082|gb|ABJ00157.1| biotin synthase [Escherichia coli APEC O1]
 gi|218364449|emb|CAR02131.1| biotin synthase [Escherichia coli S88]
 gi|218426124|emb|CAR06944.1| biotin synthase [Escherichia coli ED1a]
 gi|222032505|emb|CAP75244.1| biotin synthase [Escherichia coli LF82]
 gi|226898479|gb|EEH84738.1| biotin synthase [Escherichia sp. 3_2_53FAA]
 gi|227839015|gb|EEJ49481.1| biotin synthase [Escherichia coli 83972]
 gi|294489635|gb|ADE88391.1| biotin synthase [Escherichia coli IHE3034]
 gi|305853587|gb|EFM54026.1| biotin synthase [Escherichia coli NC101]
 gi|307552619|gb|ADN45394.1| biotin synthase [Escherichia coli ABU 83972]
 gi|307627816|gb|ADN72120.1| biotin synthase [Escherichia coli UM146]
 gi|312945293|gb|ADR26120.1| biotin synthase [Escherichia coli O83:H1 str. NRG 857C]
 gi|320196730|gb|EFW71353.1| Biotin synthase [Escherichia coli WV_060327]
 gi|323190901|gb|EFZ76168.1| biotin synthase [Escherichia coli RN587/1]
 gi|323953562|gb|EGB49428.1| biotin synthase [Escherichia coli H252]
 gi|331079913|gb|EGI51092.1| biotin synthase [Escherichia coli H299]
          Length = 346

 Score =  333 bits (853), Expect = 3e-89,   Method: Composition-based stats.
 Identities = 168/315 (53%), Positives = 228/315 (72%)

Query: 14  KKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCN 73
                WT  +V +++  P  DLLF +  VHR++F+P  +Q+S LL+IKTG CPE+C YC 
Sbjct: 2   AHRPRWTLSQVTELFEKPLLDLLFEAQQVHRQHFDPRQVQVSTLLSIKTGACPEDCKYCP 61

Query: 74  QSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVK 133
           QS   K+ L+A +L+ V+QVL+ A+ AK  G+TR+CMGAAW+ P ERD+  +  M++GVK
Sbjct: 62  QSSRYKTGLEAERLMEVEQVLESARKAKAAGSTRFCMGAAWKNPHERDMPYLEQMVQGVK 121

Query: 134 SLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVR 193
           ++GLE CMTLG LS  QAQ L+ AGLDYYNHN+DTS  FY ++ TT T+++RL TLE VR
Sbjct: 122 AMGLEACMTLGTLSESQAQRLANAGLDYYNHNLDTSPEFYGNIITTRTYQERLDTLEKVR 181

Query: 194 KSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPI 253
           ++GIKVC GGI+GLGE + DR  +LL LANL TPPES+PIN+L+ + G+   +N  VD  
Sbjct: 182 EAGIKVCSGGIVGLGETVKDRAGLLLQLANLPTPPESVPINMLVKVKGTPLADNDDVDAF 241

Query: 254 EHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKD 313
           + +R I+VARI+MP S +RL+AGR  M+++ QA+CF +GANSIF G  LLT  NP  +KD
Sbjct: 242 DFIRTIAVARIMMPTSYVRLSAGREQMNEQTQAMCFMAGANSIFYGCKLLTTPNPEEDKD 301

Query: 314 TILFNRLGLIPDLSA 328
             LF +LGL P  +A
Sbjct: 302 LQLFRKLGLNPQQTA 316


>gi|12620127|gb|AAG60579.1|AF250776_3 biotin synthase BioB [uncultured bacterium pCosHE2]
          Length = 346

 Score =  333 bits (853), Expect = 3e-89,   Method: Composition-based stats.
 Identities = 169/315 (53%), Positives = 226/315 (71%)

Query: 14  KKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCN 73
                WT  +V +++  P  DLLF +  VHR++F+P  +Q+S LL+IKTG CPE+C YC 
Sbjct: 2   AHRPRWTLSQVTELFEKPLLDLLFEAQQVHRQHFDPRQVQVSTLLSIKTGACPEDCKYCP 61

Query: 74  QSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVK 133
           QS   K+ L+A +L+ V+QVL+ A+ AK  G+TR+CMGAAW+ P ERD+  +  M++GVK
Sbjct: 62  QSSRYKTGLEAERLMEVEQVLESARKAKAAGSTRFCMGAAWKNPNERDMPYLEQMVQGVK 121

Query: 134 SLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVR 193
            LGLE CMTLG LS  QAQ L+ AGLDYYNHN+DTS  FY ++ TT T+++RL TLE VR
Sbjct: 122 DLGLEACMTLGTLSESQAQRLANAGLDYYNHNLDTSPEFYGNIITTRTYQERLDTLEKVR 181

Query: 194 KSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPI 253
            +GIKVC GGI+GLGE + DR  +LL LANL TPPES+PIN+L+ + G+   +N  VD  
Sbjct: 182 DAGIKVCSGGIVGLGETVKDRAGLLLQLANLPTPPESVPINMLVKVKGTPLADNDDVDAF 241

Query: 254 EHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKD 313
           + +R I+VARI+MP S +RL+AGR  M+++ QA+CF +GANSIF G  LLT  NP  +KD
Sbjct: 242 DFIRTIAVARIMMPTSYVRLSAGREQMNEQTQAMCFMAGANSIFYGCKLLTTPNPEEDKD 301

Query: 314 TILFNRLGLIPDLSA 328
             LF +LGL P  +A
Sbjct: 302 LQLFRKLGLNPQQTA 316


>gi|15800526|ref|NP_286538.1| biotin synthase [Escherichia coli O157:H7 EDL933]
 gi|12513761|gb|AAG55146.1|AE005258_10 biotin synthesis, sulfur insertion [Escherichia coli O157:H7 str.
           EDL933]
          Length = 346

 Score =  333 bits (853), Expect = 3e-89,   Method: Composition-based stats.
 Identities = 168/315 (53%), Positives = 227/315 (72%)

Query: 14  KKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCN 73
                WT  +V +++  P  DLLF +  VHR++F+P  +Q+S LL+IKTG CPE+C YC 
Sbjct: 2   AHRPRWTLSQVTELFEKPLLDLLFEAQQVHRQHFDPRQVQVSTLLSIKTGACPEDCKYCP 61

Query: 74  QSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVK 133
           QS   K+ L+A +L+ V+QVL+ A+ AK  G+TR+CMGAAW+ P ERD+S +  M++GVK
Sbjct: 62  QSSRYKTGLEAERLMEVEQVLESARKAKAAGSTRFCMGAAWKNPHERDMSYLEQMVQGVK 121

Query: 134 SLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVR 193
           ++GL  CMTLG LS  QAQ L+ AGLDYYNHN+DTS  FY ++ TT T+++RL TLE VR
Sbjct: 122 AMGLXACMTLGTLSESQAQRLANAGLDYYNHNLDTSPEFYGNIITTRTYQERLDTLEKVR 181

Query: 194 KSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPI 253
            +GIKVC GGI+GLGE + DR  +LL LANL TPPES+PIN+L+ + G+   +N  VD  
Sbjct: 182 DAGIKVCSGGIVGLGETVKDRAGLLLQLANLPTPPESVPINMLVKVKGTPLADNDDVDAF 241

Query: 254 EHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKD 313
           + +R I+VARI+MP S +RL+AGR  M+++ QA+CF +GANSIF G  LLT  NP  +KD
Sbjct: 242 DFIRTIAVARIMMPTSYVRLSAGREQMNEQTQAMCFMAGANSIFYGCKLLTTPNPEEDKD 301

Query: 314 TILFNRLGLIPDLSA 328
             LF +LGL P  +A
Sbjct: 302 LQLFRKLGLNPQQTA 316


>gi|218549662|ref|YP_002383453.1| biotin synthase [Escherichia fergusonii ATCC 35469]
 gi|254810685|sp|B7LJY8|BIOB_ESCF3 RecName: Full=Biotin synthase
 gi|218357203|emb|CAQ89838.1| biotin synthase [Escherichia fergusonii ATCC 35469]
 gi|325498054|gb|EGC95913.1| biotin synthase [Escherichia fergusonii ECD227]
          Length = 346

 Score =  333 bits (853), Expect = 3e-89,   Method: Composition-based stats.
 Identities = 168/311 (54%), Positives = 227/311 (72%)

Query: 18  VWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQSVH 77
            WT  +V +++  P  DLLF +  VHR++F+P  +Q+S LL+IKTG CPE+C YC QS  
Sbjct: 6   RWTLSQVTELFEKPLLDLLFEAQQVHRQHFDPRQVQVSTLLSIKTGACPEDCKYCPQSSR 65

Query: 78  NKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLGL 137
            K+ L+A +L+ V+QVL+ A+ AK  G+TR+CMGAAW+ P ERD+  +  M++GVK++GL
Sbjct: 66  YKTGLEAERLMEVEQVLESARKAKAAGSTRFCMGAAWKNPHERDMPYLEQMVQGVKAMGL 125

Query: 138 ETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSGI 197
           E CMTLG LS  QAQ L+ AGLDYYNHN+DTS  FY ++ TT T+++RL TLE VR +GI
Sbjct: 126 EACMTLGTLSESQAQRLADAGLDYYNHNLDTSPEFYGNIITTRTYQERLDTLEKVRDAGI 185

Query: 198 KVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEHVR 257
           KVC GGI+GLGE + DR  +LL LANL TPPES+PIN+L+ + G+   +N  VD  + +R
Sbjct: 186 KVCSGGIVGLGETVKDRAGLLLQLANLPTPPESVPINMLVKVKGTPLADNDDVDAFDFIR 245

Query: 258 IISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTILF 317
            I+VARI+MP S +RL+AGR  M+++ QA+CF +GANSIF G  LLT  NP  +KD  LF
Sbjct: 246 TIAVARIMMPTSYVRLSAGREQMNEQTQAMCFMAGANSIFYGCKLLTTPNPEEDKDLQLF 305

Query: 318 NRLGLIPDLSA 328
            +LGL P  +A
Sbjct: 306 RKLGLNPQQTA 316


>gi|254763256|sp|P36569|BIOB_SERMA RecName: Full=Biotin synthase
          Length = 345

 Score =  333 bits (853), Expect = 3e-89,   Method: Composition-based stats.
 Identities = 162/310 (52%), Positives = 228/310 (73%)

Query: 19  WTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQSVHN 78
           WT  +   +++ P  +LLF + TVHR++F+P  +Q+S LL+IKTG CPE+C YC QS   
Sbjct: 7   WTVGQAQALFDKPLLELLFEAQTVHRQHFDPRQVQVSTLLSIKTGACPEDCKYCPQSPRY 66

Query: 79  KSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLGLE 138
           K+ L++ +L+ V+QVL+ A+ AK NG+TR+CMGAAW+ P ERD+  +  M++GVK++G+E
Sbjct: 67  KTGLESERLMQVEQVLESARKAKANGSTRFCMGAAWKNPHERDMPYLQQMVQGVKAMGME 126

Query: 139 TCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSGIK 198
           TCMTLG L   QA+ L++AGLDYYNHN+DTS  FY  + TT ++++RL TL+ VR +GIK
Sbjct: 127 TCMTLGTLDGTQAERLAEAGLDYYNHNLDTSPEFYGSIITTRSYQERLDTLDKVRDAGIK 186

Query: 199 VCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEHVRI 258
           VC GGI+GLGE + DR  +L+ LANL  PPES+PIN+L+ + G+   +N  VDP + +R 
Sbjct: 187 VCSGGIVGLGETVRDRAGLLVQLANLPKPPESVPINMLVKVKGTPLADNDDVDPFDFIRT 246

Query: 259 ISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTILFN 318
           I+VARI+MP S +RL+AGR  M+++ QA+CF +GANSIF G  LLT  NP  +KD  LF 
Sbjct: 247 IAVARIMMPSSYVRLSAGREQMNEQTQAMCFMAGANSIFYGCKLLTTPNPEEDKDLQLFR 306

Query: 319 RLGLIPDLSA 328
           +LGL P  +A
Sbjct: 307 KLGLNPQQTA 316


>gi|330505321|ref|YP_004382190.1| biotin synthase [Pseudomonas mendocina NK-01]
 gi|328919607|gb|AEB60438.1| biotin synthase [Pseudomonas mendocina NK-01]
          Length = 352

 Score =  333 bits (853), Expect = 3e-89,   Method: Composition-based stats.
 Identities = 167/310 (53%), Positives = 227/310 (73%)

Query: 16  PKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQS 75
              W+  EV  ++  PFNDLLF + +VHR++F+PN +Q+S LL+IKTG CPE+C YC QS
Sbjct: 10  RHDWSLAEVRALFEQPFNDLLFQAQSVHRQHFDPNRVQVSTLLSIKTGACPEDCKYCPQS 69

Query: 76  VHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSL 135
            H  + L   KL+ V +VL+ A  AK  G+TR+CMGAAW+ P  +D+  +++M+KGVK L
Sbjct: 70  GHYNTGLDKEKLMEVQKVLEAAAEAKAIGSTRFCMGAAWKHPSAKDMPYVLEMVKGVKKL 129

Query: 136 GLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKS 195
           GLETCMTLG L  EQ Q L+ AGLDYYNHN+DTS  FY ++ TT T+ +RLQTL  VR++
Sbjct: 130 GLETCMTLGRLDQEQTQALADAGLDYYNHNLDTSPEFYGNIITTRTYGERLQTLAYVREA 189

Query: 196 GIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEH 255
           G+K+C GGILG+GE +DDR  +L+ LANL   PES+PIN+L+ + G+   E K VDP + 
Sbjct: 190 GMKICSGGILGMGESVDDRAGLLIQLANLPEHPESVPINMLVKVKGTPLAEEKDVDPFDF 249

Query: 256 VRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTI 315
           +R ++VARI+MPKS +RL+AGR  M++++QAL F +GANSIF G+ LLT  NP  +KD  
Sbjct: 250 IRTLAVARIMMPKSHVRLSAGREQMNEQMQALAFMAGANSIFYGEKLLTTANPQADKDMA 309

Query: 316 LFNRLGLIPD 325
           LF RLG+ P+
Sbjct: 310 LFKRLGIKPE 319


>gi|320175196|gb|EFW50305.1| Biotin synthase [Shigella dysenteriae CDC 74-1112]
          Length = 346

 Score =  333 bits (853), Expect = 3e-89,   Method: Composition-based stats.
 Identities = 169/311 (54%), Positives = 226/311 (72%)

Query: 18  VWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQSVH 77
            WT  +V +++  P  DLLF +  VHR++F+P  +Q+S LL+IKTG CPE+C YC QS  
Sbjct: 6   RWTLSQVAELFEKPLLDLLFEAQQVHRQHFDPRQVQVSTLLSIKTGACPEDCKYCPQSSR 65

Query: 78  NKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLGL 137
            K+ L+A +L+ V+QVL+ A+ AK  G+TR+CMGAAW+ P ERD+  +  M++GVK LGL
Sbjct: 66  YKTGLEAERLMEVEQVLESARKAKAAGSTRFCMGAAWKNPNERDMPYLEQMVQGVKDLGL 125

Query: 138 ETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSGI 197
           E CMTLG LS  QAQ L+ AGLDYYNHN+DTS  FY ++ TT T+++RL TLE VR +GI
Sbjct: 126 EACMTLGTLSESQAQRLANAGLDYYNHNLDTSPEFYGNIITTRTYQERLDTLEKVRDAGI 185

Query: 198 KVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEHVR 257
           KVC GGI+GLGE + DR  +LL LANL TPPES+PIN+L+ + G+   +N  VD  + +R
Sbjct: 186 KVCSGGIVGLGETVKDRAGLLLQLANLPTPPESVPINMLVKVKGTPLADNDDVDAFDFIR 245

Query: 258 IISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTILF 317
            I+VARI+MP S +RL+AGR  M+++ QA+CF +GANSIF G  LLT  NP  +KD  LF
Sbjct: 246 TIAVARIMMPTSYVRLSAGREQMNEQTQAMCFMAGANSIFYGCKLLTTPNPEEDKDLQLF 305

Query: 318 NRLGLIPDLSA 328
            +LGL P  +A
Sbjct: 306 RKLGLNPQQTA 316


>gi|15595697|ref|NP_249191.1| biotin synthase [Pseudomonas aeruginosa PAO1]
 gi|107099486|ref|ZP_01363404.1| hypothetical protein PaerPA_01000498 [Pseudomonas aeruginosa PACS2]
 gi|218889240|ref|YP_002438104.1| biotin synthase [Pseudomonas aeruginosa LESB58]
 gi|254243593|ref|ZP_04936915.1| biotin synthase [Pseudomonas aeruginosa 2192]
 gi|81622565|sp|Q9I618|BIOB_PSEAE RecName: Full=Biotin synthase
 gi|254810789|sp|B7V485|BIOB_PSEA8 RecName: Full=Biotin synthase
 gi|9946364|gb|AAG03889.1|AE004487_3 biotin synthase [Pseudomonas aeruginosa PAO1]
 gi|126196971|gb|EAZ61034.1| biotin synthase [Pseudomonas aeruginosa 2192]
 gi|218769463|emb|CAW25223.1| biotin synthase [Pseudomonas aeruginosa LESB58]
          Length = 352

 Score =  332 bits (852), Expect = 3e-89,   Method: Composition-based stats.
 Identities = 169/313 (53%), Positives = 227/313 (72%)

Query: 13  TKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYC 72
                 W+  EV  ++  PFNDLLF + TVHR +F+PN +Q+S LL+IKTG CPE+C YC
Sbjct: 7   VATRHDWSLAEVRALFEQPFNDLLFQAQTVHRAHFDPNRVQVSTLLSIKTGACPEDCKYC 66

Query: 73  NQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGV 132
            QS H  + L   KL+ V +VL+ A  AK  G+TR+CMGAAW+ P  +D+  +++M+KGV
Sbjct: 67  PQSGHYNTGLDKEKLMEVQKVLEAAAEAKAIGSTRFCMGAAWKHPSAKDMPYVLEMVKGV 126

Query: 133 KSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENV 192
           K LGLETCMTLG L+ EQ Q L+ AGLDYYNHN+DTS  FY ++ TT T+ +RLQTL  V
Sbjct: 127 KKLGLETCMTLGRLTQEQTQALADAGLDYYNHNLDTSPEFYGNIITTRTYSERLQTLAYV 186

Query: 193 RKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDP 252
           R++G+K+C GGILG+GE +DDR  +L+ LANL   PES+PIN+L+ + G+   E K VDP
Sbjct: 187 REAGMKICSGGILGMGESVDDRAGLLIQLANLPEHPESVPINMLVKVKGTPLAEEKDVDP 246

Query: 253 IEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNK 312
            + +R ++VARI+MPKS +RL+AGR  M++++QAL F +GANSIF G+ LLT KNP   K
Sbjct: 247 FDFIRTLAVARIMMPKSHVRLSAGREQMNEQMQALAFMAGANSIFYGEKLLTTKNPQAEK 306

Query: 313 DTILFNRLGLIPD 325
           D  LF RLG+ P+
Sbjct: 307 DMQLFARLGIKPE 319


>gi|16128743|ref|NP_415296.1| biotin synthase [Escherichia coli str. K-12 substr. MG1655]
 gi|74311319|ref|YP_309738.1| biotin synthesis [Shigella sonnei Ss046]
 gi|89107626|ref|AP_001406.1| biotin synthase [Escherichia coli str. K-12 substr. W3110]
 gi|157157967|ref|YP_001461963.1| biotin synthase [Escherichia coli E24377A]
 gi|157160250|ref|YP_001457568.1| biotin synthase [Escherichia coli HS]
 gi|170020869|ref|YP_001725823.1| biotin synthase [Escherichia coli ATCC 8739]
 gi|170080434|ref|YP_001729754.1| biotin synthase [Escherichia coli str. K-12 substr. DH10B]
 gi|170680651|ref|YP_001742878.1| biotin synthase [Escherichia coli SMS-3-5]
 gi|188494744|ref|ZP_03002014.1| biotin synthase [Escherichia coli 53638]
 gi|191168444|ref|ZP_03030233.1| biotin synthase [Escherichia coli B7A]
 gi|193066576|ref|ZP_03047616.1| biotin synthase [Escherichia coli E22]
 gi|194429981|ref|ZP_03062489.1| biotin synthase [Escherichia coli B171]
 gi|194439770|ref|ZP_03071838.1| biotin synthase [Escherichia coli 101-1]
 gi|215485863|ref|YP_002328294.1| biotin synthase [Escherichia coli O127:H6 str. E2348/69]
 gi|218553358|ref|YP_002386271.1| biotin synthase [Escherichia coli IAI1]
 gi|218694248|ref|YP_002401915.1| biotin synthase [Escherichia coli 55989]
 gi|218699147|ref|YP_002406776.1| biotin synthase [Escherichia coli IAI39]
 gi|218704152|ref|YP_002411671.1| biotin synthase [Escherichia coli UMN026]
 gi|238900033|ref|YP_002925829.1| biotin synthase [Escherichia coli BW2952]
 gi|253774222|ref|YP_003037053.1| biotin synthase [Escherichia coli 'BL21-Gold(DE3)pLysS AG']
 gi|254160852|ref|YP_003043960.1| biotin synthase [Escherichia coli B str. REL606]
 gi|256021156|ref|ZP_05435021.1| biotin synthase [Shigella sp. D9]
 gi|256023630|ref|ZP_05437495.1| biotin synthase [Escherichia sp. 4_1_40B]
 gi|260843017|ref|YP_003220795.1| biotin synthase BioB [Escherichia coli O103:H2 str. 12009]
 gi|260854066|ref|YP_003227957.1| biotin synthase BioB [Escherichia coli O26:H11 str. 11368]
 gi|260866942|ref|YP_003233344.1| biotin synthase BioB [Escherichia coli O111:H- str. 11128]
 gi|291281772|ref|YP_003498590.1| Biotin synthase [Escherichia coli O55:H7 str. CB9615]
 gi|293404075|ref|ZP_06648069.1| biotin synthase [Escherichia coli FVEC1412]
 gi|293409153|ref|ZP_06652729.1| biotin synthase [Escherichia coli B354]
 gi|293414055|ref|ZP_06656704.1| biotin synthase [Escherichia coli B185]
 gi|293433036|ref|ZP_06661464.1| biotin synthase [Escherichia coli B088]
 gi|298379856|ref|ZP_06989461.1| biotin synthase [Escherichia coli FVEC1302]
 gi|300920022|ref|ZP_07136481.1| biotin synthase [Escherichia coli MS 115-1]
 gi|301024498|ref|ZP_07188174.1| biotin synthase [Escherichia coli MS 196-1]
 gi|307137398|ref|ZP_07496754.1| biotin synthase [Escherichia coli H736]
 gi|307313815|ref|ZP_07593432.1| biotin synthase [Escherichia coli W]
 gi|312967819|ref|ZP_07782032.1| biotin synthase [Escherichia coli 2362-75]
 gi|312970849|ref|ZP_07785028.1| biotin synthase [Escherichia coli 1827-70]
 gi|331641288|ref|ZP_08342423.1| biotin synthase [Escherichia coli H736]
 gi|331645992|ref|ZP_08347095.1| biotin synthase [Escherichia coli M605]
 gi|331651778|ref|ZP_08352797.1| biotin synthase [Escherichia coli M718]
 gi|331662130|ref|ZP_08363053.1| biotin synthase [Escherichia coli TA143]
 gi|331667137|ref|ZP_08368002.1| biotin synthase [Escherichia coli TA271]
 gi|331672288|ref|ZP_08373079.1| biotin synthase [Escherichia coli TA280]
 gi|331676509|ref|ZP_08377205.1| biotin synthase [Escherichia coli H591]
 gi|332282384|ref|ZP_08394797.1| biotin synthase [Shigella sp. D9]
 gi|2506981|sp|P12996|BIOB_ECOLI RecName: Full=Biotin synthase
 gi|123759644|sp|Q3Z409|BIOB_SHISS RecName: Full=Biotin synthase
 gi|254810672|sp|B7NNK5|BIOB_ECO7I RecName: Full=Biotin synthase
 gi|254810674|sp|B7M747|BIOB_ECO8A RecName: Full=Biotin synthase
 gi|254810675|sp|B1X7A5|BIOB_ECODH RecName: Full=Biotin synthase
 gi|254810676|sp|A7ZY31|BIOB_ECOHS RecName: Full=Biotin synthase
 gi|254810678|sp|B1IXJ3|BIOB_ECOLC RecName: Full=Biotin synthase
 gi|254810679|sp|B7NA74|BIOB_ECOLU RecName: Full=Biotin synthase
 gi|254810681|sp|B1LM66|BIOB_ECOSM RecName: Full=Biotin synthase
 gi|254810696|sp|A7ZJI4|BIOB_ECO24 RecName: Full=Biotin synthase
 gi|254810697|sp|B7ULX2|BIOB_ECO27 RecName: Full=Biotin synthase
 gi|254810699|sp|B7LC57|BIOB_ECO55 RecName: Full=Biotin synthase
 gi|1786992|gb|AAC73862.1| biotin synthase [Escherichia coli str. K-12 substr. MG1655]
 gi|73854796|gb|AAZ87503.1| biotin synthesis [Shigella sonnei Ss046]
 gi|85674758|dbj|BAE76362.1| biotin synthase [Escherichia coli str. K12 substr. W3110]
 gi|157065930|gb|ABV05185.1| biotin synthase [Escherichia coli HS]
 gi|157079997|gb|ABV19705.1| biotin synthase [Escherichia coli E24377A]
 gi|169755797|gb|ACA78496.1| biotin synthase [Escherichia coli ATCC 8739]
 gi|169888269|gb|ACB01976.1| biotin synthase [Escherichia coli str. K-12 substr. DH10B]
 gi|170518369|gb|ACB16547.1| biotin synthase [Escherichia coli SMS-3-5]
 gi|188489943|gb|EDU65046.1| biotin synthase [Escherichia coli 53638]
 gi|190901532|gb|EDV61292.1| biotin synthase [Escherichia coli B7A]
 gi|192925794|gb|EDV80448.1| biotin synthase [Escherichia coli E22]
 gi|194411959|gb|EDX28273.1| biotin synthase [Escherichia coli B171]
 gi|194421322|gb|EDX37341.1| biotin synthase [Escherichia coli 101-1]
 gi|195182795|dbj|BAG66375.1| biotin synthetase [Escherichia coli O111:H-]
 gi|209776118|gb|ACI86371.1| biotin synthetase [Escherichia coli]
 gi|209776124|gb|ACI86374.1| biotin synthetase [Escherichia coli]
 gi|215263935|emb|CAS08275.1| biotin synthase [Escherichia coli O127:H6 str. E2348/69]
 gi|218350980|emb|CAU96684.1| biotin synthase [Escherichia coli 55989]
 gi|218360126|emb|CAQ97675.1| biotin synthase [Escherichia coli IAI1]
 gi|218369133|emb|CAR16888.1| biotin synthase [Escherichia coli IAI39]
 gi|218431249|emb|CAR12126.1| biotin synthase [Escherichia coli UMN026]
 gi|238860093|gb|ACR62091.1| biotin synthase [Escherichia coli BW2952]
 gi|242376567|emb|CAQ31276.1| biotin synthase monomer, subunit of biotin synthase [Escherichia
           coli BL21(DE3)]
 gi|253325266|gb|ACT29868.1| biotin synthase [Escherichia coli 'BL21-Gold(DE3)pLysS AG']
 gi|253972753|gb|ACT38424.1| biotin synthase [Escherichia coli B str. REL606]
 gi|253976973|gb|ACT42643.1| biotin synthase [Escherichia coli BL21(DE3)]
 gi|257752715|dbj|BAI24217.1| biotin synthase BioB [Escherichia coli O26:H11 str. 11368]
 gi|257758164|dbj|BAI29661.1| biotin synthase BioB [Escherichia coli O103:H2 str. 12009]
 gi|257763298|dbj|BAI34793.1| biotin synthase BioB [Escherichia coli O111:H- str. 11128]
 gi|260450078|gb|ACX40500.1| biotin synthase [Escherichia coli DH1]
 gi|281177911|dbj|BAI54241.1| biotin synthetase BioB [Escherichia coli SE15]
 gi|284920624|emb|CBG33686.1| biotin synthetase [Escherichia coli 042]
 gi|290761645|gb|ADD55606.1| Biotin synthase [Escherichia coli O55:H7 str. CB9615]
 gi|291323855|gb|EFE63277.1| biotin synthase [Escherichia coli B088]
 gi|291428661|gb|EFF01686.1| biotin synthase [Escherichia coli FVEC1412]
 gi|291434113|gb|EFF07086.1| biotin synthase [Escherichia coli B185]
 gi|291469621|gb|EFF12105.1| biotin synthase [Escherichia coli B354]
 gi|298279554|gb|EFI21062.1| biotin synthase [Escherichia coli FVEC1302]
 gi|299880351|gb|EFI88562.1| biotin synthase [Escherichia coli MS 196-1]
 gi|300412969|gb|EFJ96279.1| biotin synthase [Escherichia coli MS 115-1]
 gi|306906455|gb|EFN36969.1| biotin synthase [Escherichia coli W]
 gi|309701051|emb|CBJ00349.1| biotin synthetase [Escherichia coli ETEC H10407]
 gi|310336610|gb|EFQ01777.1| biotin synthase [Escherichia coli 1827-70]
 gi|312287545|gb|EFR15452.1| biotin synthase [Escherichia coli 2362-75]
 gi|315060011|gb|ADT74338.1| biotin synthase [Escherichia coli W]
 gi|315135425|dbj|BAJ42584.1| biotin synthase [Escherichia coli DH1]
 gi|320198964|gb|EFW73561.1| Biotin synthase [Escherichia coli EC4100B]
 gi|320642763|gb|EFX11964.1| biotin synthase [Escherichia coli O157:H- str. 493-89]
 gi|320648219|gb|EFX16874.1| biotin synthase [Escherichia coli O157:H- str. H 2687]
 gi|320654056|gb|EFX22124.1| biotin synthase [Escherichia coli O55:H7 str. 3256-97 TW 07815]
 gi|320659679|gb|EFX27235.1| biotin synthase [Escherichia coli O55:H7 str. USDA 5905]
 gi|320664149|gb|EFX31300.1| biotin synthase [Escherichia coli O157:H7 str. LSU-61]
 gi|323155704|gb|EFZ41875.1| biotin synthase [Escherichia coli EPECa14]
 gi|323159704|gb|EFZ45682.1| biotin synthase [Escherichia coli E128010]
 gi|323165692|gb|EFZ51478.1| biotin synthase [Shigella sonnei 53G]
 gi|323172109|gb|EFZ57748.1| biotin synthase [Escherichia coli LT-68]
 gi|323175607|gb|EFZ61202.1| biotin synthase [Escherichia coli 1180]
 gi|323185070|gb|EFZ70436.1| biotin synthase [Escherichia coli 1357]
 gi|323379430|gb|ADX51698.1| biotin synthase [Escherichia coli KO11]
 gi|323938263|gb|EGB34522.1| biotin synthase [Escherichia coli E1520]
 gi|323942648|gb|EGB38813.1| biotin synthase [Escherichia coli E482]
 gi|323947068|gb|EGB43081.1| biotin synthase [Escherichia coli H120]
 gi|323963022|gb|EGB58593.1| biotin synthase [Escherichia coli H489]
 gi|323971939|gb|EGB67160.1| biotin synthase [Escherichia coli TA007]
 gi|323976843|gb|EGB71931.1| biotin synthase [Escherichia coli TW10509]
 gi|324116198|gb|EGC10120.1| biotin synthase [Escherichia coli E1167]
 gi|330910520|gb|EGH39030.1| biotin synthase [Escherichia coli AA86]
 gi|331038086|gb|EGI10306.1| biotin synthase [Escherichia coli H736]
 gi|331044744|gb|EGI16871.1| biotin synthase [Escherichia coli M605]
 gi|331050056|gb|EGI22114.1| biotin synthase [Escherichia coli M718]
 gi|331060552|gb|EGI32516.1| biotin synthase [Escherichia coli TA143]
 gi|331065493|gb|EGI37386.1| biotin synthase [Escherichia coli TA271]
 gi|331070483|gb|EGI41847.1| biotin synthase [Escherichia coli TA280]
 gi|331075198|gb|EGI46496.1| biotin synthase [Escherichia coli H591]
 gi|332104736|gb|EGJ08082.1| biotin synthase [Shigella sp. D9]
 gi|332342107|gb|AEE55441.1| biotin synthase BioB [Escherichia coli UMNK88]
          Length = 346

 Score =  332 bits (852), Expect = 3e-89,   Method: Composition-based stats.
 Identities = 168/315 (53%), Positives = 227/315 (72%)

Query: 14  KKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCN 73
                WT  +V +++  P  DLLF +  VHR++F+P  +Q+S LL+IKTG CPE+C YC 
Sbjct: 2   AHRPRWTLSQVTELFEKPLLDLLFEAQQVHRQHFDPRQVQVSTLLSIKTGACPEDCKYCP 61

Query: 74  QSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVK 133
           QS   K+ L+A +L+ V+QVL+ A+ AK  G+TR+CMGAAW+ P ERD+  +  M++GVK
Sbjct: 62  QSSRYKTGLEAERLMEVEQVLESARKAKAAGSTRFCMGAAWKNPHERDMPYLEQMVQGVK 121

Query: 134 SLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVR 193
           ++GLE CMTLG LS  QAQ L+ AGLDYYNHN+DTS  FY ++ TT T+++RL TLE VR
Sbjct: 122 AMGLEACMTLGTLSESQAQRLANAGLDYYNHNLDTSPEFYGNIITTRTYQERLDTLEKVR 181

Query: 194 KSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPI 253
            +GIKVC GGI+GLGE + DR  +LL LANL TPPES+PIN+L+ + G+   +N  VD  
Sbjct: 182 DAGIKVCSGGIVGLGETVKDRAGLLLQLANLPTPPESVPINMLVKVKGTPLADNDDVDAF 241

Query: 254 EHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKD 313
           + +R I+VARI+MP S +RL+AGR  M+++ QA+CF +GANSIF G  LLT  NP  +KD
Sbjct: 242 DFIRTIAVARIMMPTSYVRLSAGREQMNEQTQAMCFMAGANSIFYGCKLLTTPNPEEDKD 301

Query: 314 TILFNRLGLIPDLSA 328
             LF +LGL P  +A
Sbjct: 302 LQLFRKLGLNPQQTA 316


>gi|146309102|ref|YP_001189567.1| biotin synthase [Pseudomonas mendocina ymp]
 gi|254810781|sp|A4XZR9|BIOB_PSEMY RecName: Full=Biotin synthase
 gi|145577303|gb|ABP86835.1| biotin synthase [Pseudomonas mendocina ymp]
          Length = 352

 Score =  332 bits (852), Expect = 3e-89,   Method: Composition-based stats.
 Identities = 167/310 (53%), Positives = 229/310 (73%)

Query: 16  PKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQS 75
              WT  EV  ++  PFNDLLF + +VHR++F+PN +Q+S LL+IKTG CPE+C YC QS
Sbjct: 10  RHDWTLAEVRALFEQPFNDLLFQAQSVHRQHFDPNRVQVSTLLSIKTGACPEDCKYCPQS 69

Query: 76  VHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSL 135
            H  + L   KL+ V++VL+ A  AK  G+TR+CMGAAW+ P  +D+  ++ M++GVK L
Sbjct: 70  GHYNTGLDKEKLMEVEKVLQAAAEAKAIGSTRFCMGAAWKHPSAKDMPYVLKMVEGVKKL 129

Query: 136 GLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKS 195
           GLETCMTLG L+ EQ Q L++AGLDYYNHN+DTS  FY ++ TT T+ +RLQTL  VR++
Sbjct: 130 GLETCMTLGKLTQEQTQALAEAGLDYYNHNLDTSPEFYGNIITTRTYSERLQTLAYVREA 189

Query: 196 GIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEH 255
           G+K+C GGILG+GE +DDR  +L+ LANL   PES+PIN+L+ + G+   E K VDP + 
Sbjct: 190 GMKICSGGILGMGESVDDRAGLLIQLANLPEHPESVPINMLVKVKGTPLAEEKDVDPFDF 249

Query: 256 VRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTI 315
           +R ++VARI+MPKS +RL+AGR  M++++QAL F +GANSIF G+ LLT  NP  +KD  
Sbjct: 250 IRTLAVARIMMPKSHVRLSAGREQMNEQMQALAFMAGANSIFYGEKLLTTANPQADKDMA 309

Query: 316 LFNRLGLIPD 325
           LF RLG+ P+
Sbjct: 310 LFKRLGIKPE 319


>gi|15830107|ref|NP_308880.1| biotin synthase [Escherichia coli O157:H7 str. Sakai]
 gi|168750320|ref|ZP_02775342.1| biotin synthase [Escherichia coli O157:H7 str. EC4113]
 gi|168757116|ref|ZP_02782123.1| biotin synthase [Escherichia coli O157:H7 str. EC4401]
 gi|168763417|ref|ZP_02788424.1| biotin synthase [Escherichia coli O157:H7 str. EC4501]
 gi|168776427|ref|ZP_02801434.1| biotin synthase [Escherichia coli O157:H7 str. EC4196]
 gi|168779316|ref|ZP_02804323.1| biotin synthase [Escherichia coli O157:H7 str. EC4076]
 gi|168786986|ref|ZP_02811993.1| biotin synthase [Escherichia coli O157:H7 str. EC869]
 gi|195936813|ref|ZP_03082195.1| biotin synthase [Escherichia coli O157:H7 str. EC4024]
 gi|208808075|ref|ZP_03250412.1| biotin synthase [Escherichia coli O157:H7 str. EC4206]
 gi|208815801|ref|ZP_03256980.1| biotin synthase [Escherichia coli O157:H7 str. EC4045]
 gi|208822295|ref|ZP_03262614.1| biotin synthase [Escherichia coli O157:H7 str. EC4042]
 gi|209401003|ref|YP_002269444.1| biotin synthase [Escherichia coli O157:H7 str. EC4115]
 gi|217326384|ref|ZP_03442468.1| biotin synthase [Escherichia coli O157:H7 str. TW14588]
 gi|254791969|ref|YP_003076806.1| biotin synthase [Escherichia coli O157:H7 str. TW14359]
 gi|261225422|ref|ZP_05939703.1| biotin synthase [Escherichia coli O157:H7 str. FRIK2000]
 gi|261258609|ref|ZP_05951142.1| biotin synthase [Escherichia coli O157:H7 str. FRIK966]
 gi|254810671|sp|B5YRL4|BIOB_ECO5E RecName: Full=Biotin synthase
 gi|254810700|sp|Q8X825|BIOB_ECO57 RecName: Full=Biotin synthase
 gi|13360312|dbj|BAB34276.1| biotin synthetase [Escherichia coli O157:H7 str. Sakai]
 gi|187768146|gb|EDU31990.1| biotin synthase [Escherichia coli O157:H7 str. EC4196]
 gi|188015512|gb|EDU53634.1| biotin synthase [Escherichia coli O157:H7 str. EC4113]
 gi|189002816|gb|EDU71802.1| biotin synthase [Escherichia coli O157:H7 str. EC4076]
 gi|189355846|gb|EDU74265.1| biotin synthase [Escherichia coli O157:H7 str. EC4401]
 gi|189366479|gb|EDU84895.1| biotin synthase [Escherichia coli O157:H7 str. EC4501]
 gi|189373194|gb|EDU91610.1| biotin synthase [Escherichia coli O157:H7 str. EC869]
 gi|208727876|gb|EDZ77477.1| biotin synthase [Escherichia coli O157:H7 str. EC4206]
 gi|208732449|gb|EDZ81137.1| biotin synthase [Escherichia coli O157:H7 str. EC4045]
 gi|208737780|gb|EDZ85463.1| biotin synthase [Escherichia coli O157:H7 str. EC4042]
 gi|209162403|gb|ACI39836.1| biotin synthase [Escherichia coli O157:H7 str. EC4115]
 gi|209776120|gb|ACI86372.1| biotin synthetase [Escherichia coli]
 gi|209776122|gb|ACI86373.1| biotin synthetase [Escherichia coli]
 gi|209776126|gb|ACI86375.1| biotin synthetase [Escherichia coli]
 gi|217322605|gb|EEC31029.1| biotin synthase [Escherichia coli O157:H7 str. TW14588]
 gi|254591369|gb|ACT70730.1| biotin synthase [Escherichia coli O157:H7 str. TW14359]
 gi|320192751|gb|EFW67392.1| Biotin synthase [Escherichia coli O157:H7 str. EC1212]
 gi|320637636|gb|EFX07428.1| biotin synthase [Escherichia coli O157:H7 str. G5101]
 gi|326338339|gb|EGD62168.1| Biotin synthase [Escherichia coli O157:H7 str. 1125]
 gi|326338708|gb|EGD62530.1| Biotin synthase [Escherichia coli O157:H7 str. 1044]
          Length = 346

 Score =  332 bits (852), Expect = 3e-89,   Method: Composition-based stats.
 Identities = 169/315 (53%), Positives = 228/315 (72%)

Query: 14  KKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCN 73
                WT  +V +++  P  DLLF +  VHR++F+P  +Q+S LL+IKTG CPE+C YC 
Sbjct: 2   AHRPRWTLSQVTELFEKPLLDLLFEAQQVHRQHFDPRQVQVSTLLSIKTGACPEDCKYCP 61

Query: 74  QSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVK 133
           QS   K+ L+A +L+ V+QVL+ A+ AK  G+TR+CMGAAW+ P ERD+S +  M++GVK
Sbjct: 62  QSSRYKTGLEAERLMEVEQVLESARKAKAAGSTRFCMGAAWKNPHERDMSYLEQMVQGVK 121

Query: 134 SLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVR 193
           ++GLE CMTLG LS  QAQ L+ AGLDYYNHN+DTS  FY ++ TT T+++RL TLE VR
Sbjct: 122 AMGLEACMTLGTLSESQAQRLANAGLDYYNHNLDTSPEFYGNIITTRTYQERLDTLEKVR 181

Query: 194 KSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPI 253
            +GIKVC GGI+GLGE + DR  +LL LANL TPPES+PIN+L+ + G+   +N  VD  
Sbjct: 182 DAGIKVCSGGIVGLGETVKDRAGLLLQLANLPTPPESVPINMLVKVKGTPLADNDDVDAF 241

Query: 254 EHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKD 313
           + +R I+VARI+MP S +RL+AGR  M+++ QA+CF +GANSIF G  LLT  NP  +KD
Sbjct: 242 DFIRTIAVARIMMPTSYVRLSAGREQMNEQTQAMCFMAGANSIFYGCKLLTTPNPEEDKD 301

Query: 314 TILFNRLGLIPDLSA 328
             LF +LGL P  +A
Sbjct: 302 LQLFRKLGLNPQQTA 316


>gi|331656792|ref|ZP_08357754.1| biotin synthase [Escherichia coli TA206]
 gi|331055040|gb|EGI27049.1| biotin synthase [Escherichia coli TA206]
          Length = 346

 Score =  332 bits (852), Expect = 4e-89,   Method: Composition-based stats.
 Identities = 168/311 (54%), Positives = 227/311 (72%)

Query: 18  VWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQSVH 77
            WT  +V +++  P  DLLF +  VHR++F+P  +Q+S LL+IKTG CPE+C YC QS  
Sbjct: 6   RWTLSQVTELFEKPLLDLLFEAQQVHRQHFDPRQVQVSTLLSIKTGACPEDCKYCPQSSR 65

Query: 78  NKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLGL 137
            K+ L+A +L+ V+QVL+ A+ AK  G+TR+CMGAAW+ P ERD+  +  M++GVK++GL
Sbjct: 66  YKTGLEAERLMEVEQVLESARKAKAAGSTRFCMGAAWKNPHERDMPYLEQMVQGVKAMGL 125

Query: 138 ETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSGI 197
           E CMTLG LS  QAQ L+ AGLDYYNHN+DTS  FY ++ TT T+++RL TLE VR +GI
Sbjct: 126 EACMTLGTLSESQAQRLANAGLDYYNHNLDTSPEFYGNIITTRTYQERLDTLEKVRDAGI 185

Query: 198 KVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEHVR 257
           KVC GGI+GLGE + DR  +LL LANL TPPES+PIN+L+ + G+   +N  VD  + +R
Sbjct: 186 KVCSGGIVGLGETVKDRAGLLLQLANLPTPPESVPINMLVKVKGTPLADNDDVDAFDFIR 245

Query: 258 IISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTILF 317
            I+VARI+MP S +RL+AGR  M+++ QA+CF +GANSIF G  LLT  NP  +KD  LF
Sbjct: 246 TIAVARIMMPTSYVRLSAGREQMNEQTQAMCFMAGANSIFYGCKLLTTPNPEEDKDLQLF 305

Query: 318 NRLGLIPDLSA 328
            +LGL P  +A
Sbjct: 306 RKLGLNPQQTA 316


>gi|254237275|ref|ZP_04930598.1| biotin synthase [Pseudomonas aeruginosa C3719]
 gi|126169206|gb|EAZ54717.1| biotin synthase [Pseudomonas aeruginosa C3719]
          Length = 352

 Score =  332 bits (851), Expect = 4e-89,   Method: Composition-based stats.
 Identities = 169/313 (53%), Positives = 227/313 (72%)

Query: 13  TKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYC 72
                 W+  EV  ++  PFNDLLF + TVHR +F+PN +Q+S LL+IKTG CPE+C YC
Sbjct: 7   VATRHDWSLAEVRALFEQPFNDLLFQAQTVHRAHFDPNRVQVSTLLSIKTGACPEDCKYC 66

Query: 73  NQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGV 132
            QS H  + L   KL+ V +VL+ A  AK  G+TR+CMGAAW+ P  +D+  +++M+KGV
Sbjct: 67  PQSGHYNTGLDKEKLLEVQKVLEAAAEAKAIGSTRFCMGAAWKHPSAKDMPYVLEMVKGV 126

Query: 133 KSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENV 192
           K LGLETCMTLG L+ EQ Q L+ AGLDYYNHN+DTS  FY ++ TT T+ +RLQTL  V
Sbjct: 127 KKLGLETCMTLGRLTQEQTQALADAGLDYYNHNLDTSPEFYGNIITTRTYSERLQTLAYV 186

Query: 193 RKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDP 252
           R++G+K+C GGILG+GE +DDR  +L+ LANL   PES+PIN+L+ + G+   E K VDP
Sbjct: 187 REAGMKICSGGILGMGESVDDRAGLLIQLANLPEHPESVPINMLVKVKGTPLAEEKDVDP 246

Query: 253 IEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNK 312
            + +R ++VARI+MPKS +RL+AGR  M++++QAL F +GANSIF G+ LLT KNP   K
Sbjct: 247 FDFIRTLAVARIMMPKSHVRLSAGREQMNEQMQALAFMAGANSIFYGEKLLTTKNPQAEK 306

Query: 313 DTILFNRLGLIPD 325
           D  LF RLG+ P+
Sbjct: 307 DMQLFARLGIKPE 319


>gi|197284500|ref|YP_002150372.1| biotin synthase [Proteus mirabilis HI4320]
 gi|227356679|ref|ZP_03841065.1| biotin synthase [Proteus mirabilis ATCC 29906]
 gi|254810779|sp|B4ESU3|BIOB_PROMH RecName: Full=Biotin synthase
 gi|194681987|emb|CAR41439.1| biotin synthase [Proteus mirabilis HI4320]
 gi|227163187|gb|EEI48118.1| biotin synthase [Proteus mirabilis ATCC 29906]
          Length = 345

 Score =  332 bits (851), Expect = 4e-89,   Method: Composition-based stats.
 Identities = 172/309 (55%), Positives = 227/309 (73%)

Query: 17  KVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQSV 76
           K WT KE   +++MPF DL+F +  VHR++F+P+ IQ+S LL+IKTG CPE+C YC QS 
Sbjct: 5   KRWTLKEARALFDMPFLDLVFQAQQVHRQHFDPSQIQVSTLLSIKTGACPEDCKYCAQSA 64

Query: 77  HNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLG 136
             K+ L+  +L+ V QV++ AK AK  G+TR+CMGAAWR P ERD+  +  M+K VK+LG
Sbjct: 65  RYKTGLEKERLMEVQQVIESAKKAKAAGSTRFCMGAAWRNPHERDMPYLEQMVKEVKALG 124

Query: 137 LETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSG 196
           +ETCMTLG L   QA  L++AGLD+YNHN+DTS  FY  + TT T++DRL TL+ VR +G
Sbjct: 125 METCMTLGKLDDSQASRLAQAGLDFYNHNLDTSPEFYGSIITTRTYQDRLDTLDKVRNAG 184

Query: 197 IKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEHV 256
           IKVC GGILGLGE + DR  ML+ LANL  PPES+PIN+L  I G+   +N+ VDP + +
Sbjct: 185 IKVCSGGILGLGEEVKDRAAMLVQLANLPQPPESVPINMLAKIKGTPLADNEDVDPFDFI 244

Query: 257 RIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTIL 316
           R I+VARI+MP+S +RL+AGR  MS++ QA CF +GANSIF G  LLT  NP+ +KD  L
Sbjct: 245 RTIAVARIMMPRSYVRLSAGREQMSEQTQAFCFMAGANSIFYGCKLLTTTNPTEDKDHQL 304

Query: 317 FNRLGLIPD 325
           F +LGL P+
Sbjct: 305 FRKLGLNPE 313


>gi|402532|dbj|BAA04285.1| biotin synthetase [Serratia marcescens]
          Length = 346

 Score =  332 bits (851), Expect = 4e-89,   Method: Composition-based stats.
 Identities = 162/310 (52%), Positives = 228/310 (73%)

Query: 19  WTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQSVHN 78
           WT  +   +++ P  +LLF + TVHR++F+P  +Q+S LL+IKTG CPE+C YC QS   
Sbjct: 8   WTVGQAQALFDKPLLELLFEAQTVHRQHFDPRQVQVSTLLSIKTGACPEDCKYCPQSPRY 67

Query: 79  KSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLGLE 138
           K+ L++ +L+ V+QVL+ A+ AK NG+TR+CMGAAW+ P ERD+  +  M++GVK++G+E
Sbjct: 68  KTGLESERLMQVEQVLESARKAKANGSTRFCMGAAWKNPHERDMPYLQQMVQGVKAMGME 127

Query: 139 TCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSGIK 198
           TCMTLG L   QA+ L++AGLDYYNHN+DTS  FY  + TT ++++RL TL+ VR +GIK
Sbjct: 128 TCMTLGTLDGTQAERLAEAGLDYYNHNLDTSPEFYGSIITTRSYQERLDTLDKVRDAGIK 187

Query: 199 VCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEHVRI 258
           VC GGI+GLGE + DR  +L+ LANL  PPES+PIN+L+ + G+   +N  VDP + +R 
Sbjct: 188 VCSGGIVGLGETVRDRAGLLVQLANLPKPPESVPINMLVKVKGTPLADNDDVDPFDFIRT 247

Query: 259 ISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTILFN 318
           I+VARI+MP S +RL+AGR  M+++ QA+CF +GANSIF G  LLT  NP  +KD  LF 
Sbjct: 248 IAVARIMMPSSYVRLSAGREQMNEQTQAMCFMAGANSIFYGCKLLTTPNPEEDKDLQLFR 307

Query: 319 RLGLIPDLSA 328
           +LGL P  +A
Sbjct: 308 KLGLNPQQTA 317


>gi|209918019|ref|YP_002292103.1| biotin synthase BioB [Escherichia coli SE11]
 gi|254810680|sp|B6I7S9|BIOB_ECOSE RecName: Full=Biotin synthase
 gi|209911278|dbj|BAG76352.1| biotin synthase BioB [Escherichia coli SE11]
          Length = 346

 Score =  332 bits (851), Expect = 4e-89,   Method: Composition-based stats.
 Identities = 168/315 (53%), Positives = 227/315 (72%)

Query: 14  KKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCN 73
                WT  +V +++  P  DLLF +  VHR++F+P  +Q+S LL+IKTG CPE+C YC 
Sbjct: 2   AHRPRWTLSQVTELFEKPLLDLLFEAQQVHRQHFDPRQVQVSTLLSIKTGACPEDCKYCP 61

Query: 74  QSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVK 133
           QS   K+ L+A +L+ V+QVL+ A+ AK  G+TR+CMGAAW+ P ERD+  +  M++GVK
Sbjct: 62  QSSRYKTGLEAERLMEVEQVLESARKAKAAGSTRFCMGAAWKNPHERDMPYLEQMVQGVK 121

Query: 134 SLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVR 193
           ++GLE CMTLG LS  QAQ L+ AGLDYYNHN+DTS  FY ++ TT T+++RL TLE VR
Sbjct: 122 AMGLEACMTLGTLSESQAQRLANAGLDYYNHNLDTSPEFYGNIITTRTYQERLDTLEKVR 181

Query: 194 KSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPI 253
            +GIKVC GGI+GLGE + DR  +LL LANL TPPES+PIN+L+ + G+   +N  VD  
Sbjct: 182 DAGIKVCSGGIVGLGETVKDRAGLLLQLANLPTPPESVPINMLVKVEGTPLADNDDVDAF 241

Query: 254 EHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKD 313
           + +R I+VARI+MP S +RL+AGR  M+++ QA+CF +GANSIF G  LLT  NP  +KD
Sbjct: 242 DFIRTIAVARIMMPTSYVRLSAGREQMNEQTQAMCFMAGANSIFYGCKLLTTPNPEEDKD 301

Query: 314 TILFNRLGLIPDLSA 328
             LF +LGL P  +A
Sbjct: 302 LQLFRKLGLNPQQTA 316


>gi|260597164|ref|YP_003209735.1| biotin synthase [Cronobacter turicensis z3032]
 gi|260216341|emb|CBA29351.1| Biotin synthase [Cronobacter turicensis z3032]
          Length = 346

 Score =  332 bits (851), Expect = 5e-89,   Method: Composition-based stats.
 Identities = 168/311 (54%), Positives = 228/311 (73%)

Query: 18  VWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQSVH 77
            WT  +V +++  P  DLLF +   HR++F+P  +Q+S LL+IKTG CPE+C YC QS  
Sbjct: 6   RWTLSQVTELFEKPLLDLLFEAQQAHRQHFDPRQVQVSTLLSIKTGACPEDCKYCPQSAR 65

Query: 78  NKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLGL 137
            K+ L+A +L+ VDQVL  A+ AK  G+TR+CMGAAW+ P +RD+  +  M++GVK+LGL
Sbjct: 66  YKTGLEAERLMEVDQVLDSARKAKAAGSTRFCMGAAWKNPNDRDMPYLEQMVQGVKALGL 125

Query: 138 ETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSGI 197
           ETCMTLG LS +QAQ L +AGLDYYNHN+DTS  FY ++ TT T+++RL TLE VR++GI
Sbjct: 126 ETCMTLGTLSDDQAQRLGEAGLDYYNHNLDTSPEFYGNIITTRTYQERLDTLEKVREAGI 185

Query: 198 KVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEHVR 257
           KVC GGI+GLGE + DR  +LL LANL TPPES+PIN+L+ + G+   +N  VD  + +R
Sbjct: 186 KVCSGGIVGLGETVTDRAGLLLQLANLPTPPESVPINMLVKVKGTPLADNDDVDAFDFIR 245

Query: 258 IISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTILF 317
            I+VARI+MP S +RL+AGR  M+++ QA+CF +GANSIF G  LLT  NP  +KD  LF
Sbjct: 246 TIAVARIMMPTSYVRLSAGREQMNEQTQAMCFMAGANSIFYGCKLLTTPNPEEDKDLQLF 305

Query: 318 NRLGLIPDLSA 328
            +LG+ P  +A
Sbjct: 306 RKLGINPQQTA 316


>gi|304310060|ref|YP_003809658.1| Biotin synthase [gamma proteobacterium HdN1]
 gi|301795793|emb|CBL43992.1| Biotin synthase [gamma proteobacterium HdN1]
          Length = 353

 Score =  332 bits (851), Expect = 5e-89,   Method: Composition-based stats.
 Identities = 167/309 (54%), Positives = 232/309 (75%)

Query: 16  PKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQS 75
              WT  E+  +Y +PFNDLLF +HTVHR+  +PN +Q+S LL+IKTG CPE+C YC+QS
Sbjct: 4   RHDWTVNEIEALYALPFNDLLFRAHTVHRQYHDPNAVQVSTLLSIKTGACPEDCKYCSQS 63

Query: 76  VHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSL 135
            H  + L+  KL+ +++V+ +AK+A+  GA+R+CMGAAWR P+E+D+  +++M++ VK+L
Sbjct: 64  GHYNTGLEKEKLLEIEKVVDQAKSAQAGGASRFCMGAAWRSPREKDMPYVLEMVRQVKAL 123

Query: 136 GLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKS 195
           GLETCMTLGMLS +QA  L++AGLDYYNHN+DTS   Y  + TT T++DRL TL +VR +
Sbjct: 124 GLETCMTLGMLSHDQAFALAEAGLDYYNHNLDTSPEHYKSIITTRTYQDRLDTLAHVRDA 183

Query: 196 GIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEH 255
           G+KVCCGGILGLGE   DR  +L+ LANL   P+S+PIN+L+ + G+     + +DP E 
Sbjct: 184 GMKVCCGGILGLGEARKDRAGLLMALANLQVHPDSVPINMLVKVAGTPLSGVEDLDPFEF 243

Query: 256 VRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTI 315
           VR I+VARILMP+S +RL+AGR  M++++QA+CFF+GANSIF GD LLT  N   + D  
Sbjct: 244 VRTIAVARILMPQSFVRLSAGREKMNEQMQAMCFFAGANSIFYGDKLLTTSNAETSADQQ 303

Query: 316 LFNRLGLIP 324
           LF +LG+ P
Sbjct: 304 LFEKLGIHP 312


>gi|317047391|ref|YP_004115039.1| biotin synthase [Pantoea sp. At-9b]
 gi|316949008|gb|ADU68483.1| biotin synthase [Pantoea sp. At-9b]
          Length = 343

 Score =  332 bits (850), Expect = 5e-89,   Method: Composition-based stats.
 Identities = 159/312 (50%), Positives = 229/312 (73%)

Query: 17  KVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQSV 76
             WT  +   +++ PF +L+F +  VHR++F+P  +Q+S LL+IKTG CPE+C YC QS 
Sbjct: 3   HRWTLAQAQALFDKPFLELMFEAQQVHRQHFDPRQVQVSTLLSIKTGACPEDCKYCPQSA 62

Query: 77  HNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLG 136
             K+ L++ +L+ V+ VL+ A+ AK  G++R+CMGAAW+ P +RD+  +  M++GVK++G
Sbjct: 63  RYKTGLESERLMEVEAVLESARKAKAAGSSRFCMGAAWKNPHDRDMPYLEQMVQGVKAMG 122

Query: 137 LETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSG 196
           +ETCMTLG L+  QAQ L+ AGLD+YNHN+DTS  FY  + TT ++++RL TL+ VR +G
Sbjct: 123 METCMTLGTLNDTQAQRLAHAGLDFYNHNLDTSPEFYGSIITTRSYQERLDTLDKVRGAG 182

Query: 197 IKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEHV 256
           IKVC GGI+GLGE + DR  +L+ LANL TPPES+PIN+L+ + G+   +N  V+P + +
Sbjct: 183 IKVCSGGIVGLGETVKDRAGLLVQLANLPTPPESVPINMLVKVKGTPLADNDDVEPFDFI 242

Query: 257 RIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTIL 316
           R I+VARI+MP S +RL+AGR  MS++ QA+CF +GANSIF G  LLT  NP  +KD IL
Sbjct: 243 RTIAVARIMMPSSHVRLSAGREQMSEQTQAMCFMAGANSIFYGCKLLTTPNPEEDKDLIL 302

Query: 317 FNRLGLIPDLSA 328
           F +LGL P+ +A
Sbjct: 303 FRKLGLNPEHTA 314


>gi|82776155|ref|YP_402502.1| biotin synthesis [Shigella dysenteriae Sd197]
 gi|309786577|ref|ZP_07681200.1| biotin synthase [Shigella dysenteriae 1617]
 gi|123742164|sp|Q32I44|BIOB_SHIDS RecName: Full=Biotin synthase
 gi|81240303|gb|ABB61013.1| biotin synthesis [Shigella dysenteriae Sd197]
 gi|308925640|gb|EFP71124.1| biotin synthase [Shigella dysenteriae 1617]
          Length = 346

 Score =  332 bits (850), Expect = 5e-89,   Method: Composition-based stats.
 Identities = 168/315 (53%), Positives = 227/315 (72%)

Query: 14  KKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCN 73
                WT  +V +++  P  DLLF +  VHR++F+P  +Q+S LL+IKTG CPE+C YC 
Sbjct: 2   AHRPRWTLSQVTELFEKPLLDLLFEAQQVHRQHFDPRQVQVSTLLSIKTGACPEDCKYCP 61

Query: 74  QSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVK 133
           QS   K+ L+A +L+ V+QVL+ A+ AK  G+TR+CMGAAW+ P ERD+  +  M++GVK
Sbjct: 62  QSSRYKTGLEAERLMEVEQVLESARKAKAAGSTRFCMGAAWKNPHERDMPYLEQMVQGVK 121

Query: 134 SLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVR 193
           ++GLE CMTLG LS  QAQ L+ AGLDYYNHN+DTS  FY ++ TT T+++RL TLE VR
Sbjct: 122 AMGLEACMTLGTLSESQAQRLANAGLDYYNHNLDTSPEFYGNIITTRTYQERLDTLEKVR 181

Query: 194 KSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPI 253
            +GIKVC GGI+GLGE + DR  +LL LANL TPPES+PIN+L+ + G+   +N  VD  
Sbjct: 182 DAGIKVCSGGIVGLGETVKDRAGLLLQLANLPTPPESVPINMLVKVKGTPLADNDDVDAF 241

Query: 254 EHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKD 313
           + +R I+VARI+MP S +RL+AGR  M+++ QA+CF +GANSIF G  LLT  NP  +KD
Sbjct: 242 DFIRTIAVARIMMPTSYVRLSAGREQMNEQTQAMCFVAGANSIFYGCKLLTTPNPEEDKD 301

Query: 314 TILFNRLGLIPDLSA 328
             LF +LGL P  +A
Sbjct: 302 LQLFRKLGLNPQQTA 316


>gi|323967371|gb|EGB62792.1| biotin synthase [Escherichia coli M863]
 gi|324114339|gb|EGC08308.1| biotin synthase [Escherichia fergusonii B253]
 gi|327253557|gb|EGE65186.1| biotin synthase [Escherichia coli STEC_7v]
          Length = 346

 Score =  332 bits (850), Expect = 6e-89,   Method: Composition-based stats.
 Identities = 168/311 (54%), Positives = 227/311 (72%)

Query: 18  VWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQSVH 77
            WT  +V +++  P  DLLF +  VHR++F+P  +Q+S LL+IKTG CPE+C YC QS  
Sbjct: 6   RWTLSQVTELFEKPLLDLLFEAQQVHRQHFDPRQVQVSTLLSIKTGACPEDCKYCPQSSR 65

Query: 78  NKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLGL 137
            K+ L+A +L+ V+QVL+ A+ AK  G+TR+CMGAAW+ P ERD+  +  M++GVK++GL
Sbjct: 66  YKTGLEAERLMEVEQVLESARKAKAAGSTRFCMGAAWKNPHERDMPYLEQMVQGVKAMGL 125

Query: 138 ETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSGI 197
           E CMTLG LS  QAQ L+ AGLDYYNHN+DTS  FY ++ TT T+++RL TLE VR +GI
Sbjct: 126 EACMTLGTLSESQAQRLANAGLDYYNHNLDTSPEFYGNIITTRTYQERLDTLEKVRDAGI 185

Query: 198 KVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEHVR 257
           KVC GGI+GLGE + DR  +LL LANL TPPES+PIN+L+ + G+   +N  VD  + +R
Sbjct: 186 KVCSGGIVGLGETVKDRAGLLLQLANLPTPPESVPINMLVKVKGTPLADNDDVDAFDFIR 245

Query: 258 IISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTILF 317
            I+VARI+MP S +RL+AGR  M+++ QA+CF +GANSIF G  LLT  NP  +KD  LF
Sbjct: 246 TIAVARIMMPTSYVRLSAGREQMNEQTQAMCFMAGANSIFYGCKLLTTPNPEEDKDLQLF 305

Query: 318 NRLGLIPDLSA 328
            +LGL P  +A
Sbjct: 306 RKLGLNPQQTA 316


>gi|24112143|ref|NP_706653.1| biotin synthesis, sulfur insertion? [Shigella flexneri 2a str. 301]
 gi|30062260|ref|NP_836431.1| biotin synthesis, sulfur insertion? [Shigella flexneri 2a str.
           2457T]
 gi|110804775|ref|YP_688296.1| biotin synthesis sulfur insertion protein [Shigella flexneri 5 str.
           8401]
 gi|81724701|sp|Q83S46|BIOB_SHIFL RecName: Full=Biotin synthase
 gi|123048333|sp|Q0T6I5|BIOB_SHIF8 RecName: Full=Biotin synthase
 gi|24050978|gb|AAN42360.1| biotin synthesis, sulfur insertion [Shigella flexneri 2a str. 301]
 gi|30040505|gb|AAP16237.1| biotin synthesis [Shigella flexneri 2a str. 2457T]
 gi|110614323|gb|ABF02990.1| biotin synthesis [Shigella flexneri 5 str. 8401]
 gi|281600099|gb|ADA73083.1| Biotin synthesis, sulfur insertion [Shigella flexneri 2002017]
 gi|313650327|gb|EFS14739.1| biotin synthase [Shigella flexneri 2a str. 2457T]
 gi|332759674|gb|EGJ89977.1| biotin synthase [Shigella flexneri 4343-70]
 gi|332760483|gb|EGJ90772.1| biotin synthase [Shigella flexneri 2747-71]
 gi|332763265|gb|EGJ93507.1| biotin synthase [Shigella flexneri K-671]
 gi|332767937|gb|EGJ98123.1| biotin synthase [Shigella flexneri 2930-71]
 gi|333007144|gb|EGK26636.1| biotin synthase [Shigella flexneri K-218]
 gi|333021178|gb|EGK40434.1| biotin synthase [Shigella flexneri K-304]
          Length = 346

 Score =  332 bits (850), Expect = 6e-89,   Method: Composition-based stats.
 Identities = 169/315 (53%), Positives = 227/315 (72%)

Query: 14  KKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCN 73
                WT  +V +++  P  DLLF +  VHR++FEP  +Q+S LL+IKTG CPE+C YC 
Sbjct: 2   AHRPRWTLSQVTELFEKPLLDLLFEAQQVHRQHFEPRQVQVSTLLSIKTGACPEDCKYCP 61

Query: 74  QSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVK 133
           QS   K+ L+A +L+ V+QVL+ A+ AK  G+TR+CMGAAW+ P ERD+  +  M++GVK
Sbjct: 62  QSSRYKTGLEAERLMEVEQVLESARKAKAAGSTRFCMGAAWKNPHERDMPYLEQMVQGVK 121

Query: 134 SLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVR 193
           ++GLE CMTLG LS  QAQ L+ AGLDYYNHN+DTS  FY ++ TT T+++RL TLE VR
Sbjct: 122 AMGLEACMTLGTLSESQAQRLANAGLDYYNHNLDTSPEFYGNIITTRTYQERLDTLEKVR 181

Query: 194 KSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPI 253
            +GIKVC GGI+GLGE + DR  +LL LANL TPPES+PIN+L+ + G+   +N  VD  
Sbjct: 182 DAGIKVCSGGIVGLGETVKDRAGLLLQLANLPTPPESVPINMLVKVKGTPLADNDDVDAF 241

Query: 254 EHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKD 313
           + +R I+VARI+MP S +RL+AGR  M+++ QA+CF +GANSIF G  LLT  NP  +KD
Sbjct: 242 DFIRTIAVARIMMPTSYVRLSAGREQMNEQTQAMCFMAGANSIFYGCKLLTTPNPEEDKD 301

Query: 314 TILFNRLGLIPDLSA 328
             LF +LGL P  +A
Sbjct: 302 LQLFRKLGLNPQQTA 316


>gi|168800740|ref|ZP_02825747.1| biotin synthase [Escherichia coli O157:H7 str. EC508]
 gi|189376997|gb|EDU95413.1| biotin synthase [Escherichia coli O157:H7 str. EC508]
          Length = 346

 Score =  331 bits (849), Expect = 7e-89,   Method: Composition-based stats.
 Identities = 168/315 (53%), Positives = 227/315 (72%)

Query: 14  KKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCN 73
                WT  +V +++  P  DLLF +  VHR++F+P  +Q+S LL+IKTG CPE+C YC 
Sbjct: 2   AHRPRWTLSQVTELFEKPLLDLLFEAQQVHRQHFDPRQVQVSTLLSIKTGACPEDCKYCP 61

Query: 74  QSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVK 133
           QS   K+ L+A +L+ V+QVL+ A+ AK  G+TR+CMGAAW+ P ERD+S +  M++GVK
Sbjct: 62  QSSRYKTGLEAERLMEVEQVLESARKAKAAGSTRFCMGAAWKNPHERDMSYLEQMVQGVK 121

Query: 134 SLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVR 193
           ++GLE CMTLG LS  QAQ L+ AGLDYYNHN+DTS  FY ++ TT T+++RL TLE VR
Sbjct: 122 AMGLEACMTLGTLSESQAQRLANAGLDYYNHNLDTSPEFYGNIITTRTYQERLDTLEKVR 181

Query: 194 KSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPI 253
            +GIKVC GGI+GLGE + DR  +LL LANL TPPES+PIN+L+ + G+   +N  VD  
Sbjct: 182 DAGIKVCSGGIVGLGETVKDRAGLLLQLANLPTPPESVPINMLVKVKGTPLADNDDVDAF 241

Query: 254 EHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKD 313
           + +R I+V RI+MP S +RL+AGR  M+++ QA+CF +GANSIF G  LLT  NP  +KD
Sbjct: 242 DFIRTIAVVRIMMPTSYVRLSAGREQMNEQTQAMCFMAGANSIFYGCKLLTTPNPEEDKD 301

Query: 314 TILFNRLGLIPDLSA 328
             LF +LGL P  +A
Sbjct: 302 LQLFRKLGLNPQQTA 316


>gi|145425|gb|AAA23515.1| biotin synthetase [Escherichia coli]
          Length = 346

 Score =  331 bits (849), Expect = 8e-89,   Method: Composition-based stats.
 Identities = 167/315 (53%), Positives = 227/315 (72%)

Query: 14  KKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCN 73
                WT  +V +++  P  DLLF +  VHR++F+P  +Q+S LL+IKTG CPE+C YC 
Sbjct: 2   AHRPRWTLSQVTELFEKPLLDLLFEAQQVHRQHFDPRQVQVSTLLSIKTGACPEDCKYCP 61

Query: 74  QSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVK 133
           Q+   K+ L+A +L+ V+QVL+ A+ AK  G+TR+CMGAAW+ P ERD+  +  M++GVK
Sbjct: 62  QTSRYKTGLEAERLMEVEQVLESARKAKAAGSTRFCMGAAWKNPHERDMPYLEQMVQGVK 121

Query: 134 SLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVR 193
           ++GLE CMTLG LS  QAQ L+ AGLDYYNHN+DTS  FY ++ TT T+++RL TLE VR
Sbjct: 122 AMGLEACMTLGTLSESQAQRLANAGLDYYNHNLDTSPEFYGNIITTRTYQERLDTLEKVR 181

Query: 194 KSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPI 253
            +GIKVC GGI+GLGE + DR  +LL LANL TPPES+PIN+L+ + G+   +N  VD  
Sbjct: 182 DAGIKVCSGGIVGLGETVKDRAGLLLQLANLPTPPESVPINMLVKVKGTPLADNDDVDAF 241

Query: 254 EHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKD 313
           + +R I+VARI+MP S +RL+AGR  M+++ QA+CF +GANSIF G  LLT  NP  +KD
Sbjct: 242 DFIRTIAVARIMMPTSYVRLSAGREQMNEQTQAMCFMAGANSIFYGCKLLTTPNPEEDKD 301

Query: 314 TILFNRLGLIPDLSA 328
             LF +LGL P  +A
Sbjct: 302 LQLFRKLGLNPQQTA 316


>gi|116054226|ref|YP_788670.1| biotin synthase [Pseudomonas aeruginosa UCBPP-PA14]
 gi|313111871|ref|ZP_07797662.1| biotin synthase [Pseudomonas aeruginosa 39016]
 gi|122261632|sp|Q02TR6|BIOB_PSEAB RecName: Full=Biotin synthase
 gi|115589447|gb|ABJ15462.1| biotin synthase [Pseudomonas aeruginosa UCBPP-PA14]
 gi|310884164|gb|EFQ42758.1| biotin synthase [Pseudomonas aeruginosa 39016]
          Length = 352

 Score =  331 bits (849), Expect = 8e-89,   Method: Composition-based stats.
 Identities = 169/313 (53%), Positives = 226/313 (72%)

Query: 13  TKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYC 72
                 W+  EV  ++  PFNDLLF + TVHR  F+PN +Q+S LL+IKTG CPE+C YC
Sbjct: 7   VATRHDWSLAEVRALFEQPFNDLLFQAQTVHRAYFDPNRVQVSTLLSIKTGACPEDCKYC 66

Query: 73  NQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGV 132
            QS H  + L   KL+ V +VL+ A  AK  G+TR+CMGAAW+ P  +D+  +++M+KGV
Sbjct: 67  PQSGHYNTGLDKEKLMEVQKVLEAAAEAKAIGSTRFCMGAAWKHPSAKDMPYVLEMVKGV 126

Query: 133 KSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENV 192
           K LGLETCMTLG L+ EQ Q L+ AGLDYYNHN+DTS  FY ++ TT T+ +RLQTL  V
Sbjct: 127 KKLGLETCMTLGRLTQEQTQALADAGLDYYNHNLDTSPEFYGNIITTRTYSERLQTLAYV 186

Query: 193 RKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDP 252
           R++G+K+C GGILG+GE +DDR  +L+ LANL   PES+PIN+L+ + G+   E K VDP
Sbjct: 187 REAGMKICSGGILGMGESVDDRAGLLIQLANLPEHPESVPINMLVKVKGTPLAEEKDVDP 246

Query: 253 IEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNK 312
            + +R ++VARI+MPKS +RL+AGR  M++++QAL F +GANSIF G+ LLT KNP   K
Sbjct: 247 FDFIRTLAVARIMMPKSHVRLSAGREQMNEQMQALAFMAGANSIFYGEKLLTTKNPQAEK 306

Query: 313 DTILFNRLGLIPD 325
           D  LF RLG+ P+
Sbjct: 307 DMQLFARLGIKPE 319


>gi|291616767|ref|YP_003519509.1| BioB [Pantoea ananatis LMG 20103]
 gi|291151797|gb|ADD76381.1| BioB [Pantoea ananatis LMG 20103]
 gi|327393193|dbj|BAK10615.1| biotin synthase BioB [Pantoea ananatis AJ13355]
          Length = 343

 Score =  331 bits (848), Expect = 9e-89,   Method: Composition-based stats.
 Identities = 158/311 (50%), Positives = 230/311 (73%)

Query: 17  KVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQSV 76
           + WT  +   +++ PF +L+F +  VHR++F+P  +Q+S LL+IKTG CPE+C YC QS 
Sbjct: 3   QRWTLAQAQALFDRPFLELMFEAQQVHRQHFDPRQVQVSTLLSIKTGACPEDCKYCPQSA 62

Query: 77  HNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLG 136
             K+ L++ +L+ VD+VL+ A+ AK  G++R+CMGAAW+ P +RD+  +  M++GVK++G
Sbjct: 63  RYKTGLESERLMEVDEVLRSAQKAKAAGSSRFCMGAAWKNPSDRDMPYLEKMVEGVKAMG 122

Query: 137 LETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSG 196
           +ETCMTLG LS  QAQ L  AGLD+YNHN+DTS  FY ++ TT ++++RL TL  VR +G
Sbjct: 123 METCMTLGTLSDSQAQRLGSAGLDFYNHNLDTSPEFYGNIITTRSYQERLDTLGKVRDAG 182

Query: 197 IKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEHV 256
           IKVC GGI+GLGE ++DR  +L+ LANL TPPES+PIN+L+ + G+   +N  V+P + +
Sbjct: 183 IKVCSGGIVGLGETVNDRAGLLVQLANLPTPPESVPINMLVKVKGTPLADNDDVEPFDFI 242

Query: 257 RIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTIL 316
           R I+VARI+MP S +RL+AGR  M+++ QA+CF +GANSIF G  LLT  NP  +KD +L
Sbjct: 243 RTIAVARIMMPTSHVRLSAGREQMNEQTQAMCFMAGANSIFYGCKLLTTPNPEEDKDMLL 302

Query: 317 FNRLGLIPDLS 327
           F +LGL P+ +
Sbjct: 303 FRKLGLNPEHT 313


>gi|238893820|ref|YP_002918554.1| biotin synthetase [Klebsiella pneumoniae NTUH-K2044]
 gi|254810876|sp|A6T6L5|BIOB_KLEP7 RecName: Full=Biotin synthase
 gi|238546136|dbj|BAH62487.1| biotin synthetase [Klebsiella pneumoniae subsp. pneumoniae
           NTUH-K2044]
          Length = 346

 Score =  331 bits (848), Expect = 1e-88,   Method: Composition-based stats.
 Identities = 165/311 (53%), Positives = 230/311 (73%)

Query: 18  VWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQSVH 77
            WT  +V +++N P  DLLF +  +HR++F+P  +Q+S LL+IKTG CPE+C YC QS  
Sbjct: 6   RWTMSQVTELFNKPLIDLLFEAQQIHRQHFDPRQVQVSTLLSIKTGACPEDCKYCPQSAR 65

Query: 78  NKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLGL 137
            K+ L+A +L+ V+QVL+ A+ AK  G+TR+CMGAAW+ P +RD+  +  M+KGVK+LGL
Sbjct: 66  YKTGLEAERLMEVEQVLESARQAKNAGSTRFCMGAAWKNPNDRDMPYLEQMVKGVKALGL 125

Query: 138 ETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSGI 197
           E+CMTLG L+  QAQ L++AGLDYYNHN+DTS  FY ++ TT T+++RL TL+ VR +GI
Sbjct: 126 ESCMTLGTLTDSQAQRLAEAGLDYYNHNLDTSPEFYGNIITTRTYQERLDTLDKVRDAGI 185

Query: 198 KVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEHVR 257
           KVC GGI+GLGE + DR  +LL LANL TPPES+PIN+L+ + G+   +N  VD  + +R
Sbjct: 186 KVCSGGIVGLGESVKDRAGLLLQLANLPTPPESVPINMLVKVKGTPLADNDDVDAFDFIR 245

Query: 258 IISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTILF 317
            I++ARI+MP S +RL+AGR  M+++ QA+CF +GANSIF G  LLT  NP  +KD  LF
Sbjct: 246 TIAIARIMMPTSYVRLSAGREQMNEQTQAMCFMAGANSIFYGCKLLTTPNPEEDKDLQLF 305

Query: 318 NRLGLIPDLSA 328
            +LG+ P  +A
Sbjct: 306 RKLGINPQQTA 316


>gi|330722065|gb|EGG99982.1| Biotin synthase [gamma proteobacterium IMCC2047]
          Length = 354

 Score =  331 bits (848), Expect = 1e-88,   Method: Composition-based stats.
 Identities = 164/311 (52%), Positives = 233/311 (74%)

Query: 16  PKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQS 75
              WT  EV  ++N+PFNDL+F + TVHR++F PN +Q+S LL+IKTG CPE+C YC+QS
Sbjct: 10  RHDWTPDEVAALFNLPFNDLMFQAQTVHRQHFNPNEVQMSTLLSIKTGACPEDCKYCSQS 69

Query: 76  VHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSL 135
            H  + L+  KL+ + +V+++AK AKE G++R+CMGAAWR P ++++  +VDMIK VK L
Sbjct: 70  GHYNTGLEKEKLMEIQRVIEDAKAAKEQGSSRFCMGAAWRSPSKKEMPYVVDMIKQVKGL 129

Query: 136 GLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKS 195
           G+ETCMTLGML+ +QA+ L+ AGLDYYNHN+DTS  +Y  + TT +F+DRL TL+NVR S
Sbjct: 130 GMETCMTLGMLNGDQAKELADAGLDYYNHNLDTSPEYYEDIITTRSFQDRLDTLQNVRDS 189

Query: 196 GIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEH 255
           G+KVC GGI+G+GE   DR+ +L+ LAN+   PES+PIN+L+ I G+   + + +D  + 
Sbjct: 190 GMKVCSGGIVGMGESERDRVGLLVELANMPQHPESVPINMLVKIEGTPMGDVEDLDDFDF 249

Query: 256 VRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTI 315
           +R I+VARI+MP+S +RL+AGR  M++++QA+CF +GANSIF G  LLT  NP  N D  
Sbjct: 250 IRTIAVARIMMPESHVRLSAGREEMNEQMQAMCFLAGANSIFYGCKLLTTANPEENSDRQ 309

Query: 316 LFNRLGLIPDL 326
           LF +LG+ P+ 
Sbjct: 310 LFKKLGIRPEQ 320


>gi|120555667|ref|YP_960018.1| biotin synthase [Marinobacter aquaeolei VT8]
 gi|254810730|sp|A1U4B2|BIOB_MARAV RecName: Full=Biotin synthase
 gi|120325516|gb|ABM19831.1| biotin synthase [Marinobacter aquaeolei VT8]
          Length = 352

 Score =  331 bits (848), Expect = 1e-88,   Method: Composition-based stats.
 Identities = 169/315 (53%), Positives = 244/315 (77%)

Query: 12  PTKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGY 71
            T     WT +E  +++N+PFNDLLF + ++HR++F+PN +Q+S LL+IKTG CPE+C Y
Sbjct: 3   ATATRHDWTLQEARELFNLPFNDLLFRAQSIHREHFDPNEVQVSTLLSIKTGACPEDCKY 62

Query: 72  CNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKG 131
           C QS H  + L+  KL+ +++V+ EA+ A+E GA+R+CMGAAWR P ++D+  ++DM++ 
Sbjct: 63  CPQSGHYNTGLEKEKLLEIEKVVAEARVAREKGASRFCMGAAWRSPSKKDMPYVLDMVRQ 122

Query: 132 VKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLEN 191
           VKSLGLETCMTLGML  E+A+ L+ AGLDYYNHN+DTSE++Y H+ TT T++DRL TL+N
Sbjct: 123 VKSLGLETCMTLGMLKEEEAKELADAGLDYYNHNLDTSEKYYNHIITTRTYQDRLDTLDN 182

Query: 192 VRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVD 251
           VRK+G+KVCCGGI+G+GE  DDR+ +L+ LANL   PES+P+N+L+ + G+  E+ + +D
Sbjct: 183 VRKAGMKVCCGGIMGMGEDEDDRVGLLVQLANLPQHPESVPVNMLVKVKGTPLEDVEDLD 242

Query: 252 PIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYN 311
           P + +RII+VARI+MP S +RL+AGR  M++++QALCF +GANSIF G+ LLT  NP  +
Sbjct: 243 PFDFIRIIAVARIMMPASHVRLSAGREQMNEQMQALCFMAGANSIFYGEKLLTTSNPEAD 302

Query: 312 KDTILFNRLGLIPDL 326
            D  LF +LG+ P+ 
Sbjct: 303 ADMQLFRKLGIRPEQ 317


>gi|56460432|ref|YP_155713.1| biotin synthase [Idiomarina loihiensis L2TR]
 gi|81600192|sp|Q5QZ16|BIOB_IDILO RecName: Full=Biotin synthase
 gi|56179442|gb|AAV82164.1| Biotin synthase [Idiomarina loihiensis L2TR]
          Length = 345

 Score =  330 bits (847), Expect = 1e-88,   Method: Composition-based stats.
 Identities = 175/313 (55%), Positives = 233/313 (74%)

Query: 14  KKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCN 73
           +    WT +EV  +  MP NDL+F + TVHR++F PN +Q+S LL+IKTG CPE+C YC 
Sbjct: 3   QIRNDWTIEEVQNLLQMPLNDLVFEAQTVHRQHFNPNEVQVSTLLSIKTGACPEDCKYCP 62

Query: 74  QSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVK 133
           QS H  + L   +L+ V+ VL EA+ AKE GA+R+CMGAAWR PK+RD+  +++MIKGVK
Sbjct: 63  QSAHYHTGLDRERLMAVESVLAEAQAAKEKGASRFCMGAAWRNPKDRDMPYVIEMIKGVK 122

Query: 134 SLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVR 193
           +LGLE+CMTLGMLS EQA++L +AGLDYYNHN+DTS  FY  + TT T++DRL TL NVR
Sbjct: 123 ALGLESCMTLGMLSNEQAKMLQQAGLDYYNHNLDTSPEFYGDIITTRTYQDRLNTLNNVR 182

Query: 194 KSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPI 253
            +G+KVC GGI+G+GE + DR  +L+ LANL   PES+PIN+L+ + G+ F + + +D  
Sbjct: 183 DAGMKVCAGGIVGMGESVTDRASLLVQLANLPKHPESVPINMLVKVEGTPFAKLEDLDNF 242

Query: 254 EHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKD 313
           E VR ++VARILMP S +RL+AGR  M+DE+QALCF +GANSIF G+ LLT  NP  + D
Sbjct: 243 EFVRTVAVARILMPASHVRLSAGREDMNDEMQALCFLAGANSIFYGEKLLTTANPEADAD 302

Query: 314 TILFNRLGLIPDL 326
             LF RLG+ P+ 
Sbjct: 303 LRLFERLGIKPEQ 315


>gi|152987226|ref|YP_001345995.1| biotin synthase [Pseudomonas aeruginosa PA7]
 gi|254810788|sp|A6UYW0|BIOB_PSEA7 RecName: Full=Biotin synthase
 gi|150962384|gb|ABR84409.1| biotin synthase [Pseudomonas aeruginosa PA7]
          Length = 352

 Score =  330 bits (847), Expect = 1e-88,   Method: Composition-based stats.
 Identities = 169/314 (53%), Positives = 226/314 (71%)

Query: 12  PTKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGY 71
                  W+  EV  ++  PFNDLLF + TVHR  F+PN +Q+S LL+IKTG CPE+C Y
Sbjct: 6   AVATRHDWSLAEVRALFEQPFNDLLFQAQTVHRAYFDPNRVQVSTLLSIKTGACPEDCKY 65

Query: 72  CNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKG 131
           C QS H  + L   KL+ V +VL+ A  AK  G+TR+CMGAAW+ P  +D+  +++M+KG
Sbjct: 66  CPQSGHYNTGLDKEKLMEVQKVLEAAAEAKAIGSTRFCMGAAWKHPSAKDMPYVLEMVKG 125

Query: 132 VKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLEN 191
           VK LGLETCMTLG L+ EQ Q L+ AGLDYYNHN+DTS  FY ++ TT T+ +RLQTL  
Sbjct: 126 VKRLGLETCMTLGRLTQEQTQALADAGLDYYNHNLDTSPEFYGNIITTRTYGERLQTLAY 185

Query: 192 VRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVD 251
           VR++G+K+C GGILG+GE +DDR  +L+ LANL   PES+PIN+L+ + G+   E K VD
Sbjct: 186 VREAGMKICSGGILGMGESVDDRAGLLIQLANLPEHPESVPINMLVKVKGTPLAEEKDVD 245

Query: 252 PIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYN 311
           P + +R ++VARI+MPKS +RL+AGR  M++++QAL F +GANSIF G+ LLT KNP   
Sbjct: 246 PFDFIRTLAVARIMMPKSHVRLSAGREQMNEQMQALAFMAGANSIFYGEKLLTTKNPQAE 305

Query: 312 KDTILFNRLGLIPD 325
           KD  LF RLG+ P+
Sbjct: 306 KDMQLFARLGIKPE 319


>gi|194434986|ref|ZP_03067228.1| biotin synthase [Shigella dysenteriae 1012]
 gi|194416768|gb|EDX32895.1| biotin synthase [Shigella dysenteriae 1012]
 gi|320178485|gb|EFW53450.1| Biotin synthase [Shigella boydii ATCC 9905]
 gi|332089015|gb|EGI94127.1| biotin synthase [Shigella boydii 5216-82]
 gi|332091163|gb|EGI96253.1| biotin synthase [Shigella dysenteriae 155-74]
          Length = 346

 Score =  330 bits (847), Expect = 1e-88,   Method: Composition-based stats.
 Identities = 167/315 (53%), Positives = 226/315 (71%)

Query: 14  KKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCN 73
                WT  +V +++  P  DLLF +  VHR++F+P  +Q+S LL+IKTG CPE+C YC 
Sbjct: 2   AHRPRWTLSQVTELFEKPLLDLLFEAQQVHRQHFDPRQVQVSTLLSIKTGACPEDCKYCP 61

Query: 74  QSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVK 133
           QS   K+ L+A +L+ V+QVL+ A+ AK  G+TR+CMGAAW+ P ERD+  +  M++GVK
Sbjct: 62  QSSRYKTGLEAERLMEVEQVLESARKAKAAGSTRFCMGAAWKNPHERDMPYLEQMVQGVK 121

Query: 134 SLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVR 193
           ++GLE CMTLG LS  QAQ L+ AGLDYYNHN+DTS  FY ++ TT T+++RL TLE VR
Sbjct: 122 AMGLEACMTLGTLSESQAQRLADAGLDYYNHNLDTSPEFYGNIITTRTYQERLDTLEKVR 181

Query: 194 KSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPI 253
            +GIKVC GGI+GLGE + DR  +LL LANL TPPES+PIN+L+ + G+   +N  VD  
Sbjct: 182 DAGIKVCSGGIVGLGETVKDRAGLLLQLANLPTPPESVPINMLVKVKGTPLADNDDVDAF 241

Query: 254 EHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKD 313
           + +R I+VARI+MP S +RL+AGR  M+++ QA+CF +GANSIF G  LL   NP  +KD
Sbjct: 242 DFIRTIAVARIMMPTSYVRLSAGREQMNEQTQAMCFMAGANSIFYGCKLLITPNPEEDKD 301

Query: 314 TILFNRLGLIPDLSA 328
             LF +LGL P  +A
Sbjct: 302 LQLFRKLGLNPQQTA 316


>gi|206579832|ref|YP_002239592.1| biotin synthase [Klebsiella pneumoniae 342]
 gi|254810722|sp|B5XZ75|BIOB_KLEP3 RecName: Full=Biotin synthase
 gi|206568890|gb|ACI10666.1| biotin synthase [Klebsiella pneumoniae 342]
          Length = 346

 Score =  330 bits (846), Expect = 2e-88,   Method: Composition-based stats.
 Identities = 164/315 (52%), Positives = 228/315 (72%)

Query: 14  KKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCN 73
                WT  +V +++N P  DLLF +  +HR++F+P  +Q+S LL+IKTG CPE+C YC 
Sbjct: 2   AHRARWTMSQVTELFNKPLIDLLFEAQQIHRQHFDPRQVQVSTLLSIKTGACPEDCKYCP 61

Query: 74  QSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVK 133
           QS   K+ L+  +L+ V+QVL+ A+ AK  G+TR+CMGAAW+ P +RD+  +  M+KGVK
Sbjct: 62  QSARYKTGLETERLMEVEQVLESARQAKNAGSTRFCMGAAWKNPNDRDMPYLEQMVKGVK 121

Query: 134 SLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVR 193
           +LGLE+CMTLG L+  QAQ L+ AGLDYYNHN+DTS  FY ++ TT T+++RL TL+ VR
Sbjct: 122 ALGLESCMTLGTLTDSQAQRLAGAGLDYYNHNLDTSPEFYGNIITTRTYQERLDTLDKVR 181

Query: 194 KSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPI 253
            +GIKVC GGI+GLGE + DR  +LL LANL TPPES+PIN+L+ + G+   +N  VD  
Sbjct: 182 DAGIKVCSGGIVGLGETVKDRAGLLLQLANLPTPPESVPINMLVKVKGTPLADNDDVDAF 241

Query: 254 EHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKD 313
           + +R I++ARI+MP S +RL+AGR  M+++ QA+CF +GANSIF G  LLT  NP  +KD
Sbjct: 242 DFIRTIAIARIMMPTSYVRLSAGREQMNEQTQAMCFMAGANSIFYGCKLLTTPNPEEDKD 301

Query: 314 TILFNRLGLIPDLSA 328
             LF +LG+ P  +A
Sbjct: 302 LQLFRKLGINPQQTA 316


>gi|170723997|ref|YP_001751685.1| biotin synthase [Pseudomonas putida W619]
 gi|254810784|sp|B1JE55|BIOB_PSEPW RecName: Full=Biotin synthase
 gi|169762000|gb|ACA75316.1| biotin synthase [Pseudomonas putida W619]
          Length = 352

 Score =  330 bits (846), Expect = 2e-88,   Method: Composition-based stats.
 Identities = 166/313 (53%), Positives = 230/313 (73%)

Query: 13  TKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYC 72
                 W+  EV  ++ +PFNDLLF + TVHR +F+PN +Q+S LL+IKTG CPE+C YC
Sbjct: 7   ATTRHDWSLAEVKALFQLPFNDLLFQAQTVHRAHFDPNRVQVSTLLSIKTGACPEDCKYC 66

Query: 73  NQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGV 132
            QS H  + L+  KL+ V +VL+EA  AK  G+TR+CMGAAW+ P  +D+  +++M+KGV
Sbjct: 67  PQSGHYNTGLEKQKLMEVQKVLEEAARAKAIGSTRFCMGAAWKHPSAKDMPYVLEMVKGV 126

Query: 133 KSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENV 192
           K++GLETCMTLG L  +Q Q L++AGLDYYNHN+DTS  FY  + TT T+ +RLQTL  V
Sbjct: 127 KAMGLETCMTLGKLDQDQTQALAQAGLDYYNHNLDTSPEFYGSIITTRTYSERLQTLAYV 186

Query: 193 RKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDP 252
           R +G+K+C GGILG+GE +DDR  +L+ LANL   PES+PIN+L+ + G+   E + VDP
Sbjct: 187 RDAGMKICSGGILGMGESLDDRAGLLIQLANLPEHPESVPINMLVKVAGTPLAEEEDVDP 246

Query: 253 IEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNK 312
            + +R+++VAR+LMPKS +RL+AGR  M++++QAL F +GANSIF G+ LLT  NP  +K
Sbjct: 247 FDFIRMLAVARLLMPKSHVRLSAGREQMNEQMQALAFMAGANSIFYGEKLLTTANPQADK 306

Query: 313 DTILFNRLGLIPD 325
           D  LF RLG+ P+
Sbjct: 307 DMQLFARLGIKPE 319


>gi|300722416|ref|YP_003711704.1| biotin synthetase [Xenorhabdus nematophila ATCC 19061]
 gi|297628921|emb|CBJ89504.1| biotin synthetase [Xenorhabdus nematophila ATCC 19061]
          Length = 346

 Score =  330 bits (846), Expect = 2e-88,   Method: Composition-based stats.
 Identities = 164/313 (52%), Positives = 233/313 (74%)

Query: 15  KPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQ 74
           + + WT K+   +++ PF +LLF +  +HR++F+P  +Q+S LL+IKTG CPE+C YC Q
Sbjct: 3   ERQQWTIKQTQALFDKPFFELLFQAQQIHREHFDPQQVQVSTLLSIKTGACPEDCKYCPQ 62

Query: 75  SVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKS 134
           S   K+ L+  +L+ V++V++ A  AK+ G+TR+CMGAAW+ P ERD+  +  M+  VK+
Sbjct: 63  SSRYKTGLEKERLMEVEKVIESAHKAKKAGSTRFCMGAAWKNPHERDMPYLEKMVTEVKA 122

Query: 135 LGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRK 194
           LG+ETCMTLGML+  QAQ L++AGLDYYNHN+DTS  FY ++ TT +++DRL TL+ VR+
Sbjct: 123 LGMETCMTLGMLNQSQAQRLAEAGLDYYNHNLDTSPEFYGNIITTRSYQDRLDTLDKVRE 182

Query: 195 SGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIE 254
           +GIKVC GGI+GLGE I DR  +L+ LANL  PPES+PIN+L+ + G+  E+N+ VDP +
Sbjct: 183 AGIKVCSGGIVGLGEQIRDRAALLVQLANLPKPPESVPINMLVKVKGTPLEDNQDVDPFD 242

Query: 255 HVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDT 314
            +R I+VARI+MPKS +RL+AGR  M+++ QA+CF +GANSIF G  LLT  NP  +KD 
Sbjct: 243 FIRTIAVARIMMPKSHVRLSAGREQMNEQTQAMCFMAGANSIFYGCKLLTTPNPDEDKDL 302

Query: 315 ILFNRLGLIPDLS 327
            LF RLG+ P  +
Sbjct: 303 QLFRRLGINPQQT 315


>gi|308186109|ref|YP_003930240.1| biotin synthase [Pantoea vagans C9-1]
 gi|308056619|gb|ADO08791.1| biotin synthase [Pantoea vagans C9-1]
          Length = 343

 Score =  330 bits (846), Expect = 2e-88,   Method: Composition-based stats.
 Identities = 161/311 (51%), Positives = 230/311 (73%)

Query: 17  KVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQSV 76
           + WT  +   +++ PF +L+F +  VHR++F+P  +Q+S LL+IKTG CPE+C YC QS 
Sbjct: 3   QRWTIAQAQALFDQPFLELMFKAQQVHRQHFDPRQVQVSTLLSIKTGACPEDCKYCPQSA 62

Query: 77  HNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLG 136
             K+ L++ +L+ V++VL  A+ AK  G+TR+CMGAAW+ P ERD+  +  M++GVK++G
Sbjct: 63  RYKTGLESERLMEVEEVLTSARQAKAAGSTRFCMGAAWKNPHERDMPYLEKMVEGVKAMG 122

Query: 137 LETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSG 196
           +ETCMTLG LS +QAQ L+ AGLDYYNHN+DTS  FY  + TT ++++RL TL  VR +G
Sbjct: 123 METCMTLGTLSDQQAQRLAGAGLDYYNHNLDTSPEFYGSIITTRSYQERLDTLGTVRDAG 182

Query: 197 IKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEHV 256
           IKVC GGI+GLGE ++DR  +L+ LANL TPPES+PIN+L+ + G+   +N  V+P + +
Sbjct: 183 IKVCSGGIVGLGETVNDRAGLLVQLANLPTPPESVPINMLVKVKGTPLADNDDVEPFDFI 242

Query: 257 RIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTIL 316
           R I+VARI+MP S +RL+AGR  MS++ QA+CF +GANSIF G  LLT  NP  +KD +L
Sbjct: 243 RTIAVARIMMPTSHVRLSAGREQMSEQTQAMCFMAGANSIFYGCKLLTTPNPEEDKDRVL 302

Query: 317 FNRLGLIPDLS 327
           F +LGL P+ +
Sbjct: 303 FRKLGLNPEHT 313


>gi|304395745|ref|ZP_07377628.1| biotin synthase [Pantoea sp. aB]
 gi|304357039|gb|EFM21403.1| biotin synthase [Pantoea sp. aB]
          Length = 343

 Score =  330 bits (845), Expect = 2e-88,   Method: Composition-based stats.
 Identities = 161/311 (51%), Positives = 230/311 (73%)

Query: 17  KVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQSV 76
           + WT  +   +++ PF +L+F +  VHR++F+P  +Q+S LL+IKTG CPE+C YC QS 
Sbjct: 3   QRWTIAQAQALFDQPFLELMFQAQQVHRQHFDPRQVQVSTLLSIKTGACPEDCKYCPQSA 62

Query: 77  HNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLG 136
             K+ L++ +L+ V++VL  A+ AK  G+TR+CMGAAW+ P ERD+  +  M++GVK++G
Sbjct: 63  RYKTGLESERLMEVEEVLTSARQAKAAGSTRFCMGAAWKNPHERDMPYLEKMVEGVKAMG 122

Query: 137 LETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSG 196
           +ETCMTLG LS +QAQ L+ AGLDYYNHN+DTS  FY  + TT ++++RL TL  VR +G
Sbjct: 123 METCMTLGTLSDDQAQRLAGAGLDYYNHNLDTSPEFYGSIITTRSYQERLDTLGKVRDAG 182

Query: 197 IKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEHV 256
           IKVC GGI+GLGE ++DR  +L+ LANL TPPES+PIN+L+ + G+   +N  V+P + +
Sbjct: 183 IKVCSGGIVGLGETVNDRAGLLVQLANLPTPPESVPINMLVKVKGTPLADNDDVEPFDFI 242

Query: 257 RIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTIL 316
           R I+VARI+MP S +RL+AGR  MS++ QA+CF +GANSIF G  LLT  NP  +KD +L
Sbjct: 243 RTIAVARIMMPTSHVRLSAGREQMSEQTQAMCFMAGANSIFYGCKLLTTPNPEEDKDRVL 302

Query: 317 FNRLGLIPDLS 327
           F +LGL P+ +
Sbjct: 303 FRKLGLNPEHT 313


>gi|146284178|ref|YP_001174331.1| biotin synthase [Pseudomonas stutzeri A1501]
 gi|254810785|sp|A4VR88|BIOB_PSEU5 RecName: Full=Biotin synthase
 gi|145572383|gb|ABP81489.1| biotin synthase [Pseudomonas stutzeri A1501]
          Length = 351

 Score =  329 bits (844), Expect = 3e-88,   Method: Composition-based stats.
 Identities = 164/314 (52%), Positives = 230/314 (73%)

Query: 12  PTKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGY 71
            +     W+  EV  ++  PFNDLLF + TVHR++F+PN +Q+S LL+IKTG CPE+C Y
Sbjct: 6   ASVTRHDWSLAEVKALFEQPFNDLLFQAQTVHRQHFDPNRVQVSTLLSIKTGACPEDCKY 65

Query: 72  CNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKG 131
           C QS H  + L   KL+ V +VL+ A  AK  G+TR+CMGAAW+ P  +D+  ++ M++G
Sbjct: 66  CPQSGHYNTGLDKEKLMEVQKVLEAAAEAKAIGSTRFCMGAAWKHPSAKDMPYVLKMVEG 125

Query: 132 VKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLEN 191
           VK++GLETCMTLG L  EQ + L+ AGLDYYNHN+DTS  FY ++ TT T+ +RL+TL  
Sbjct: 126 VKAMGLETCMTLGKLDQEQTRALAAAGLDYYNHNLDTSPEFYGNIITTRTYAERLETLSY 185

Query: 192 VRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVD 251
           VR++G+K+C GGILG+GE +DDR  +L+ LANL   PES+PIN+L+ + G+   E + VD
Sbjct: 186 VREAGMKICSGGILGMGESLDDRAGLLIQLANLPEHPESVPINMLVKVKGTPLAEEQDVD 245

Query: 252 PIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYN 311
           P + +R+++VARI+MPKS +RL+AGR  M++++QAL FF+GANSIF G+ LLT  NP  +
Sbjct: 246 PFDFIRMLAVARIMMPKSHVRLSAGREQMNEQMQALAFFAGANSIFYGEKLLTTANPQAD 305

Query: 312 KDTILFNRLGLIPD 325
           KD  LF RLG+ P+
Sbjct: 306 KDMQLFARLGIKPE 319


>gi|310767060|gb|ADP12010.1| biotin synthetase [Erwinia sp. Ejp617]
          Length = 343

 Score =  329 bits (844), Expect = 3e-88,   Method: Composition-based stats.
 Identities = 163/310 (52%), Positives = 224/310 (72%)

Query: 18  VWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQSVH 77
            WT  +   ++  PF +L+F +   HR++F+P  +Q+S LL+IKTG CPE+C YC QS  
Sbjct: 4   RWTLSQAQALFEKPFLELMFEAQLTHRQHFDPRQVQVSTLLSIKTGACPEDCKYCPQSAR 63

Query: 78  NKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLGL 137
            K+ L+A +L+ V++VL  A+ AK  G+ R+CMGAAW+ P ERD+  +  M++GVK++G+
Sbjct: 64  YKTGLEAERLMEVEEVLSSARKAKAAGSGRFCMGAAWKNPHERDMPYLEKMVQGVKAMGM 123

Query: 138 ETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSGI 197
           ETCMTLG LS +QAQ L+ AGLD+YNHN+DTS  FY  + TT +++DRL TL  VR +GI
Sbjct: 124 ETCMTLGSLSQQQAQRLADAGLDFYNHNLDTSPEFYRSIITTRSYQDRLDTLGQVRNAGI 183

Query: 198 KVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEHVR 257
           KVC GGI+GLGE + DR  +L+ LANL  PPES+PIN+L+ + G+   +N  VDP + VR
Sbjct: 184 KVCSGGIVGLGETVQDRAGLLVQLANLPEPPESVPINMLVKVKGTPLADNDDVDPFDFVR 243

Query: 258 IISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTILF 317
            I+VARI+MP+S +RL+AGR  MS++ QALCF +GANSIF G  LLT  NP  +KD +LF
Sbjct: 244 TIAVARIMMPRSHVRLSAGREQMSEQTQALCFMAGANSIFYGCKLLTTPNPEEDKDLLLF 303

Query: 318 NRLGLIPDLS 327
            +LGL P  S
Sbjct: 304 RKLGLNPQHS 313


>gi|288936435|ref|YP_003440494.1| biotin synthase [Klebsiella variicola At-22]
 gi|290510508|ref|ZP_06549878.1| biotin synthase [Klebsiella sp. 1_1_55]
 gi|288891144|gb|ADC59462.1| biotin synthase [Klebsiella variicola At-22]
 gi|289777224|gb|EFD85222.1| biotin synthase [Klebsiella sp. 1_1_55]
          Length = 346

 Score =  329 bits (844), Expect = 3e-88,   Method: Composition-based stats.
 Identities = 164/311 (52%), Positives = 229/311 (73%)

Query: 18  VWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQSVH 77
            WT  +V +++N P  DLLF +  +HR++F+P  +Q+S LL+IKTG CPE+C YC QS  
Sbjct: 6   RWTMSQVTELFNKPLIDLLFEAQQIHRQHFDPRQVQVSTLLSIKTGACPEDCKYCPQSAR 65

Query: 78  NKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLGL 137
            K+ L++ +L+ V+QVL+ A+ AK  G+TR+CMGAAW+ P +RD+  +  M+KGVK+LGL
Sbjct: 66  YKTGLESERLMEVEQVLESARQAKNAGSTRFCMGAAWKNPNDRDMPYLEQMVKGVKALGL 125

Query: 138 ETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSGI 197
           E+CMTLG L+  QAQ L+ AGLDYYNHN+DTS  FY ++ TT T+++RL TL+ VR +GI
Sbjct: 126 ESCMTLGTLTDSQAQRLAGAGLDYYNHNLDTSPEFYGNIITTRTYQERLDTLDKVRDAGI 185

Query: 198 KVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEHVR 257
           KVC GGI+GLGE + DR  +LL LANL TPPES+PIN+L+ + G+   +N  VD  + +R
Sbjct: 186 KVCSGGIVGLGETVKDRAGLLLQLANLPTPPESVPINMLVKVKGTPLADNDDVDAFDFIR 245

Query: 258 IISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTILF 317
            I++ARI+MP S +RL+AGR  M+++ QA+CF +GANSIF G  LLT  NP  +KD  LF
Sbjct: 246 TIAIARIMMPTSYVRLSAGREQMNEQTQAMCFMAGANSIFYGCKLLTTPNPEEDKDLQLF 305

Query: 318 NRLGLIPDLSA 328
            +LG+ P  +A
Sbjct: 306 RKLGINPQQTA 316


>gi|329295968|ref|ZP_08253304.1| biotin synthase [Plautia stali symbiont]
          Length = 343

 Score =  329 bits (844), Expect = 3e-88,   Method: Composition-based stats.
 Identities = 160/311 (51%), Positives = 228/311 (73%)

Query: 18  VWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQSVH 77
            WT  +   +++ PF +L+F +  VHR++F+P  +Q+S LL+IKTG CPE+C YC QS  
Sbjct: 4   RWTLAQAQALFDKPFLELMFEAQQVHRQHFDPRQVQVSTLLSIKTGACPEDCKYCPQSAR 63

Query: 78  NKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLGL 137
            K+ L+  +L+ V+ VL+ A+ AK  G++R+CMGAAW+ P ERD+  +  M++GVK++G+
Sbjct: 64  YKTGLETERLMEVEAVLESARKAKAAGSSRFCMGAAWKNPHERDMPYLEQMVQGVKAMGM 123

Query: 138 ETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSGI 197
           ETCMTLG L  +QAQ L+ AGLD+YNHN+DTS  FY  + TT T+++RL TL+ VR +GI
Sbjct: 124 ETCMTLGTLDHDQAQRLASAGLDFYNHNLDTSPEFYGSIITTRTYQERLDTLDKVRNAGI 183

Query: 198 KVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEHVR 257
           KVC GGI+GLGE ++DR  +L+ LANL T PES+PIN+L+ + G+   +N  V+P + +R
Sbjct: 184 KVCSGGIVGLGETVNDRAGLLVQLANLPTLPESVPINMLVKVKGTPLADNDDVEPFDFIR 243

Query: 258 IISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTILF 317
            I+VARI+MP S +RL+AGR  MS++ QA+CF +GANSIF G  LLT  NP  +KD ILF
Sbjct: 244 TIAVARIMMPTSHVRLSAGREQMSEQTQAMCFMAGANSIFYGCKLLTTPNPEEDKDLILF 303

Query: 318 NRLGLIPDLSA 328
            +LGL P+ +A
Sbjct: 304 RKLGLNPEHTA 314


>gi|259909042|ref|YP_002649398.1| Biotin synthase [Erwinia pyrifoliae Ep1/96]
 gi|224964664|emb|CAX56178.1| Biotin synthase [Erwinia pyrifoliae Ep1/96]
          Length = 343

 Score =  329 bits (843), Expect = 4e-88,   Method: Composition-based stats.
 Identities = 162/310 (52%), Positives = 224/310 (72%)

Query: 18  VWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQSVH 77
            WT  +   ++  PF +L+F +   HR++F+P  +Q+S LL+IKTG CPE+C YC QS  
Sbjct: 4   RWTLSQAQALFEKPFLELMFEAQLTHRQHFDPRQVQVSTLLSIKTGACPEDCKYCPQSAR 63

Query: 78  NKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLGL 137
            K+ L++ +L+ V++VL  A+ AK  G+ R+CMGAAW+ P ERD+  +  M++GVK++G+
Sbjct: 64  YKTGLESERLMEVEEVLSSARKAKAAGSGRFCMGAAWKNPHERDMPYLEKMVQGVKAMGM 123

Query: 138 ETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSGI 197
           ETCMTLG LS +QAQ L+ AGLD+YNHN+DTS  FY  + TT +++DRL TL  VR +GI
Sbjct: 124 ETCMTLGSLSQQQAQRLADAGLDFYNHNLDTSPEFYRSIITTRSYQDRLDTLGQVRNAGI 183

Query: 198 KVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEHVR 257
           KVC GGI+GLGE + DR  +L+ LANL  PPES+PIN+L+ + G+   +N  VDP + VR
Sbjct: 184 KVCSGGIVGLGETVQDRAGLLVQLANLPEPPESVPINMLVKVKGTPLADNDDVDPFDFVR 243

Query: 258 IISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTILF 317
            I+VARI+MP+S +RL+AGR  MS++ QALCF +GANSIF G  LLT  NP  +KD +LF
Sbjct: 244 TIAVARIMMPRSHVRLSAGREQMSEQTQALCFMAGANSIFYGCKLLTTPNPEEDKDLLLF 303

Query: 318 NRLGLIPDLS 327
            +LGL P  S
Sbjct: 304 RKLGLNPQHS 313


>gi|119774575|ref|YP_927315.1| biotin synthase [Shewanella amazonensis SB2B]
 gi|254811238|sp|A1S5I9|BIOB_SHEAM RecName: Full=Biotin synthase
 gi|119767075|gb|ABL99645.1| Biotin synthase [Shewanella amazonensis SB2B]
          Length = 354

 Score =  329 bits (843), Expect = 4e-88,   Method: Composition-based stats.
 Identities = 175/311 (56%), Positives = 230/311 (73%)

Query: 16  PKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQS 75
              W+ +EV  ++ +P NDLLF +H++HR+ F+PN +Q+S+LL+IKTG CPE+C YC QS
Sbjct: 7   RHDWSRQEVEALFALPMNDLLFRAHSIHREVFDPNEVQISRLLSIKTGACPEDCKYCPQS 66

Query: 76  VHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSL 135
               + L+  +L+ +++VL EA+ AK+ GATR+CMGAAWR P ERD+  + DM+K VKS+
Sbjct: 67  ARYDTGLEKERLLEIEKVLTEARAAKDAGATRFCMGAAWRNPHERDMPYLTDMVKEVKSM 126

Query: 136 GLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKS 195
           GLETCMTLGMLS  QA  L++AGLDYYNHN+DTS  FY  + TT T++DRL TL NVR +
Sbjct: 127 GLETCMTLGMLSAHQANQLAEAGLDYYNHNLDTSPEFYGDIITTRTYQDRLDTLSNVRAA 186

Query: 196 GIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEH 255
           G+KVC GGI+G+GE   DR  +L  LANL   P+S+PIN+L+ + G+  +    +DP+E 
Sbjct: 187 GMKVCSGGIVGMGEQATDRAGLLQQLANLEQHPDSVPINMLVKVTGTPLDSVDDLDPLEF 246

Query: 256 VRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTI 315
           VR I+VARILMP SR+RL+AGR  MSDELQA+CFF+GANSIF G  LLT  NP  N D  
Sbjct: 247 VRTIAVARILMPLSRVRLSAGRENMSDELQAMCFFAGANSIFYGCKLLTTPNPEENDDMS 306

Query: 316 LFNRLGLIPDL 326
           LF RLGL P+ 
Sbjct: 307 LFRRLGLKPEQ 317


>gi|327482504|gb|AEA85814.1| biotin synthase [Pseudomonas stutzeri DSM 4166]
          Length = 351

 Score =  329 bits (842), Expect = 5e-88,   Method: Composition-based stats.
 Identities = 164/314 (52%), Positives = 230/314 (73%)

Query: 12  PTKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGY 71
            +     W+  EV  ++  PFNDLLF + TVHR++F+PN +Q+S LL+IKTG CPE+C Y
Sbjct: 6   ASVTRHDWSLAEVKALFEQPFNDLLFQAQTVHRQHFDPNRVQVSTLLSIKTGACPEDCKY 65

Query: 72  CNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKG 131
           C QS H  + L   KL+ V +VL+ A  AK  G+TR+CMGAAW+ P  +D+  ++ M++G
Sbjct: 66  CPQSGHYNTGLDKEKLMEVQKVLEAAAEAKAIGSTRFCMGAAWKHPSAKDMPYVLKMVEG 125

Query: 132 VKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLEN 191
           VK++GLETCMTLG L  EQ + L+ AGLDYYNHN+DTS  FY ++ TT T+ +RL+TL  
Sbjct: 126 VKAMGLETCMTLGKLDQEQTRALAAAGLDYYNHNLDTSPEFYGNIITTRTYAERLETLSY 185

Query: 192 VRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVD 251
           VR++G+K+C GGILG+GE +DDR  +L+ LANL   PES+PIN+L+ + G+   E + VD
Sbjct: 186 VREAGMKICSGGILGMGESLDDRAGLLIQLANLPEHPESVPINMLVKVKGTPLAEEQDVD 245

Query: 252 PIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYN 311
           P + +R+++VARI+MPKS +RL+AGR  M++++QAL FF+GANSIF G+ LLT  NP  +
Sbjct: 246 PFDFIRMLAVARIMMPKSHVRLSAGREQMNEQMQALAFFAGANSIFYGEKLLTTANPQAD 305

Query: 312 KDTILFNRLGLIPD 325
           KD  LF RLG+ P+
Sbjct: 306 KDMQLFARLGIKPE 319


>gi|16764157|ref|NP_459772.1| biotin synthetase [Salmonella enterica subsp. enterica serovar
           Typhimurium str. LT2]
 gi|161614971|ref|YP_001588936.1| biotin synthetase [Salmonella enterica subsp. enterica serovar
           Paratyphi B str. SPB7]
 gi|167550532|ref|ZP_02344289.1| biotin synthase [Salmonella enterica subsp. enterica serovar
           Saintpaul str. SARA29]
 gi|167994442|ref|ZP_02575533.1| biotin synthase [Salmonella enterica subsp. enterica serovar
           4,[5],12:i:- str. CVM23701]
 gi|168466379|ref|ZP_02700241.1| biotin synthase [Salmonella enterica subsp. enterica serovar
           Newport str. SL317]
 gi|194445747|ref|YP_002040030.1| biotin synthase [Salmonella enterica subsp. enterica serovar
           Newport str. SL254]
 gi|197264303|ref|ZP_03164377.1| biotin synthase [Salmonella enterica subsp. enterica serovar
           Saintpaul str. SARA23]
 gi|224582607|ref|YP_002636405.1| biotin synthetase [Salmonella enterica subsp. enterica serovar
           Paratyphi C strain RKS4594]
 gi|17865692|sp|P12678|BIOB_SALTY RecName: Full=Biotin synthase
 gi|254810802|sp|B4SZJ7|BIOB_SALNS RecName: Full=Biotin synthase
 gi|254810803|sp|A9MTI8|BIOB_SALPB RecName: Full=Biotin synthase
 gi|254810804|sp|C0PWY2|BIOB_SALPC RecName: Full=Biotin synthase
 gi|16419299|gb|AAL19731.1| biotin synthetase [Salmonella enterica subsp. enterica serovar
           Typhimurium str. LT2]
 gi|161364335|gb|ABX68103.1| hypothetical protein SPAB_02725 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|194404410|gb|ACF64632.1| biotin synthase [Salmonella enterica subsp. enterica serovar
           Newport str. SL254]
 gi|195630936|gb|EDX49522.1| biotin synthase [Salmonella enterica subsp. enterica serovar
           Newport str. SL317]
 gi|197242558|gb|EDY25178.1| biotin synthase [Salmonella enterica subsp. enterica serovar
           Saintpaul str. SARA23]
 gi|205324625|gb|EDZ12464.1| biotin synthase [Salmonella enterica subsp. enterica serovar
           Saintpaul str. SARA29]
 gi|205327729|gb|EDZ14493.1| biotin synthase [Salmonella enterica subsp. enterica serovar
           4,[5],12:i:- str. CVM23701]
 gi|224467134|gb|ACN44964.1| biotin synthetase [Salmonella enterica subsp. enterica serovar
           Paratyphi C strain RKS4594]
 gi|267992532|gb|ACY87417.1| biotin synthetase [Salmonella enterica subsp. enterica serovar
           Typhimurium str. 14028S]
 gi|301157380|emb|CBW16869.1| biotin synthetase [Salmonella enterica subsp. enterica serovar
           Typhimurium str. SL1344]
 gi|312911817|dbj|BAJ35791.1| biotin synthase [Salmonella enterica subsp. enterica serovar
           Typhimurium str. T000240]
 gi|321226368|gb|EFX51419.1| Biotin synthase [Salmonella enterica subsp. enterica serovar
           Typhimurium str. TN061786]
 gi|323129102|gb|ADX16532.1| biotin synthetase [Salmonella enterica subsp. enterica serovar
           Typhimurium str. 4/74]
 gi|332987725|gb|AEF06708.1| biotin synthetase [Salmonella enterica subsp. enterica serovar
           Typhimurium str. UK-1]
          Length = 346

 Score =  329 bits (842), Expect = 5e-88,   Method: Composition-based stats.
 Identities = 166/310 (53%), Positives = 229/310 (73%)

Query: 18  VWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQSVH 77
            WT  +V +++  P  +LLF +  +HR++F+P  +Q+S LL+IKTG CPE+C YC QS  
Sbjct: 6   RWTLSQVTELFEKPLLELLFEAQQIHRQHFDPQQVQVSTLLSIKTGACPEDCKYCPQSSR 65

Query: 78  NKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLGL 137
            K+ L+A +L+ V+QVL  A+ AK  G+TR+CMGAAWR P ERD+  +  +++GVK++GL
Sbjct: 66  YKTGLEAERLMEVEQVLDSARKAKNAGSTRFCMGAAWRNPHERDMPYLEKIVQGVKAMGL 125

Query: 138 ETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSGI 197
           ETCMTLGML+  QAQ L+ AGLDYYNHN+DTS  FY ++ TT T+++RL TLE VR++GI
Sbjct: 126 ETCMTLGMLNESQAQRLANAGLDYYNHNLDTSPEFYGNIITTRTYQERLDTLEKVREAGI 185

Query: 198 KVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEHVR 257
           KVC GGI+GLGE + DR  +LL LANL TPPES+PIN+L+ + G+   +N  VD  + +R
Sbjct: 186 KVCSGGIVGLGETVTDRAGLLLQLANLPTPPESVPINMLVKVKGTPLADNDDVDAFDFIR 245

Query: 258 IISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTILF 317
            I+VARI+MP S +RL+AGR  M+++ QA+CF +GANSIF G  LLT  NP+ +KD  LF
Sbjct: 246 TIAVARIMMPTSYVRLSAGREQMNEQTQAMCFMAGANSIFYGCKLLTTPNPAEDKDLQLF 305

Query: 318 NRLGLIPDLS 327
            +LGL P  +
Sbjct: 306 RKLGLNPQQT 315


>gi|2498182|sp|Q47862|BIOB_ESCVU RecName: Full=Biotin synthase
 gi|1228114|gb|AAC44534.1| biotin synthetase [Pantoea agglomerans]
          Length = 346

 Score =  329 bits (842), Expect = 5e-88,   Method: Composition-based stats.
 Identities = 164/310 (52%), Positives = 225/310 (72%)

Query: 18  VWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQSVH 77
            WT  +V ++++ P  DLLF + T+HR++F+P  +Q+S LL+IKTG CPE+C YC QS  
Sbjct: 6   RWTLSQVTELFDKPLLDLLFEAQTIHRQHFDPRQVQVSTLLSIKTGACPEDCKYCPQSSR 65

Query: 78  NKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLGL 137
            K+ L+  +L+ V+QVL  A+ AK  G+TR+CMGAAW+ P ERD+  +  M++GVK++GL
Sbjct: 66  YKTGLETERLMEVEQVLDSARKAKNAGSTRFCMGAAWKNPHERDMPYLEQMVQGVKAMGL 125

Query: 138 ETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSGI 197
           E CMTLG L   QAQ L+ AGLDYYNHN+DTS  FY ++ TT T+++RL TL+ VR +GI
Sbjct: 126 EACMTLGTLDETQAQRLASAGLDYYNHNLDTSPEFYGNIITTRTYQERLDTLDKVRDAGI 185

Query: 198 KVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEHVR 257
           KVC GGI+GLGE + DR  +LL LANL TPPES+PIN+L+ + G+   +N  VD  + +R
Sbjct: 186 KVCSGGIVGLGETVKDRAGLLLQLANLPTPPESVPINMLVKVKGTPLADNDDVDAFDFIR 245

Query: 258 IISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTILF 317
            I+VARI+MP S +RL+AGR  M+++ QA+CF +GANSIF G  LLT  NP  +KD  LF
Sbjct: 246 TIAVARIMMPTSFVRLSAGREQMNEQTQAMCFMAGANSIFYGCKLLTTPNPEEDKDVQLF 305

Query: 318 NRLGLIPDLS 327
            +LGL P  +
Sbjct: 306 RKLGLNPQQT 315


>gi|146310924|ref|YP_001175998.1| biotin synthase [Enterobacter sp. 638]
 gi|254810682|sp|A4W8B7|BIOB_ENT38 RecName: Full=Biotin synthase
 gi|145317800|gb|ABP59947.1| biotin synthase [Enterobacter sp. 638]
          Length = 346

 Score =  329 bits (842), Expect = 6e-88,   Method: Composition-based stats.
 Identities = 167/310 (53%), Positives = 229/310 (73%)

Query: 18  VWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQSVH 77
            WT  +V +++N PF +L+F +  +HR++F+P H+Q+S LL+IKTG CPE+C YC QS  
Sbjct: 6   RWTMSQVTELFNKPFLELMFEAQQIHRQHFDPRHVQVSTLLSIKTGACPEDCKYCPQSAR 65

Query: 78  NKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLGL 137
            K+ L+A +L+ V+QVL  A+ AK  G+TR+CMGAAW+ P +RD+  +  M++GVK +GL
Sbjct: 66  YKTGLEAERLMEVEQVLDSARKAKNAGSTRFCMGAAWKNPHDRDMPYLEQMVQGVKEMGL 125

Query: 138 ETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSGI 197
           E CMTLG L+  QAQ LS AGLDYYNHN+DTS  FY ++ TT T+++RL TLE VR++GI
Sbjct: 126 EACMTLGTLNDSQAQRLSAAGLDYYNHNLDTSPEFYGNIITTRTYQERLDTLEKVREAGI 185

Query: 198 KVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEHVR 257
           KVC GGI+GLGE ++DR  +LL LANL TPPES+PIN+L+ + G+   +N  VD  + +R
Sbjct: 186 KVCSGGIVGLGETVNDRAGLLLQLANLPTPPESVPINMLVKVKGTPMADNDDVDAFDFIR 245

Query: 258 IISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTILF 317
            I+VARI+MP S +RL+AGR  MS++ QA+CF +GANSIF G  LLT  NP  +KD  LF
Sbjct: 246 TIAVARIMMPTSFVRLSAGREQMSEQTQAMCFMAGANSIFYGCKLLTTPNPEEDKDVQLF 305

Query: 318 NRLGLIPDLS 327
            +LGL P  +
Sbjct: 306 RKLGLNPTQT 315


>gi|157146592|ref|YP_001453911.1| hypothetical protein CKO_02353 [Citrobacter koseri ATCC BAA-895]
 gi|254810597|sp|A8AJ12|BIOB_CITK8 RecName: Full=Biotin synthase
 gi|157083797|gb|ABV13475.1| hypothetical protein CKO_02353 [Citrobacter koseri ATCC BAA-895]
          Length = 346

 Score =  328 bits (841), Expect = 6e-88,   Method: Composition-based stats.
 Identities = 164/311 (52%), Positives = 229/311 (73%)

Query: 18  VWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQSVH 77
            WT  +V +++N P  DLLF +  +HR++F+P  +Q+S LL+IKTG CPE+C YC QS  
Sbjct: 6   RWTLSQVTELFNKPLLDLLFDAQQIHRQHFDPQQVQVSTLLSIKTGACPEDCKYCPQSSR 65

Query: 78  NKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLGL 137
            K+ L+A +L+ V+QVL  A+ AK  G+TR+CMGAAW+ P ERD+  +  M++GVK++GL
Sbjct: 66  YKTGLEAERLMEVEQVLDSARKAKNAGSTRFCMGAAWKNPHERDMPYLEQMVQGVKAMGL 125

Query: 138 ETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSGI 197
           E CMTLG L+  QAQ L+ AGLDYYNHN+DTS  FY ++ TT ++++RL TL+ VR++GI
Sbjct: 126 EACMTLGTLNESQAQRLANAGLDYYNHNLDTSPEFYGNIITTRSYQERLDTLDKVREAGI 185

Query: 198 KVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEHVR 257
           KVC GGI+GLGE + DR  +LL LANL TPPES+PIN+L+ + G+   +N+ VD  + +R
Sbjct: 186 KVCSGGIVGLGETVKDRAGLLLQLANLPTPPESVPINMLVKVKGTPLADNEDVDAFDFIR 245

Query: 258 IISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTILF 317
            I+VARI+MP S +RL+AGR  M+++ QA+CF +GANSIF G  LLT  NP  +KD  LF
Sbjct: 246 TIAVARIMMPTSYVRLSAGREQMNEQTQAMCFMAGANSIFYGCKLLTTPNPEEDKDLQLF 305

Query: 318 NRLGLIPDLSA 328
            +LGL P  ++
Sbjct: 306 RKLGLNPQQTS 316


>gi|261246052|emb|CBG23854.1| biotin synthetase [Salmonella enterica subsp. enterica serovar
           Typhimurium str. D23580]
          Length = 346

 Score =  328 bits (841), Expect = 6e-88,   Method: Composition-based stats.
 Identities = 166/310 (53%), Positives = 229/310 (73%)

Query: 18  VWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQSVH 77
            WT  +V +++  P  +LLF +  +HR++F+P  +Q+S LL+IKTG CPE+C YC QS  
Sbjct: 6   RWTLSQVTELFEKPLLELLFEAQQIHRQHFDPQQVQVSTLLSIKTGACPEDCKYCPQSSR 65

Query: 78  NKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLGL 137
            K+ L+A +L+ V+QVL  A+ AK  G+TR+CMGAAWR P ERD+  +  +++GVK++GL
Sbjct: 66  YKTGLEAERLMEVEQVLDSARKAKNAGSTRFCMGAAWRNPHERDMPYLEKIVQGVKAMGL 125

Query: 138 ETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSGI 197
           ETCMTLGML+  QAQ L+ AGLDYYNHN+DTS  FY ++ TT T+++RL TLE VR++GI
Sbjct: 126 ETCMTLGMLNESQAQRLANAGLDYYNHNLDTSPEFYGNIITTRTYQERLDTLEKVREAGI 185

Query: 198 KVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEHVR 257
           KVC GGI+GLGE + DR  +LL LANL TPPES+PIN+L+ + G+   +N  VD  + +R
Sbjct: 186 KVCSGGIVGLGETVTDRAGLLLQLANLPTPPESVPINMLVKVKGTPLADNDDVDTFDFIR 245

Query: 258 IISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTILF 317
            I+VARI+MP S +RL+AGR  M+++ QA+CF +GANSIF G  LLT  NP+ +KD  LF
Sbjct: 246 TIAVARIMMPTSYVRLSAGREQMNEQTQAMCFMAGANSIFYGCKLLTTPNPAEDKDLQLF 305

Query: 318 NRLGLIPDLS 327
            +LGL P  +
Sbjct: 306 RKLGLNPQQT 315


>gi|161504039|ref|YP_001571151.1| biotin synthetase [Salmonella enterica subsp. arizonae serovar
           62:z4,z23:-- str. RSK2980]
 gi|254810797|sp|A9MJE6|BIOB_SALAR RecName: Full=Biotin synthase
 gi|160865386|gb|ABX22009.1| hypothetical protein SARI_02132 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:--]
          Length = 346

 Score =  328 bits (841), Expect = 6e-88,   Method: Composition-based stats.
 Identities = 166/310 (53%), Positives = 232/310 (74%)

Query: 18  VWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQSVH 77
            WT  +V +++  P  +LLF +  +HR++F+P  IQ+S LL+IKTG CPE+C YC QS  
Sbjct: 6   RWTLSQVTELFEKPLLELLFEAQQIHRQHFDPKQIQVSTLLSIKTGACPEDCKYCPQSSR 65

Query: 78  NKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLGL 137
            K+ L+A +L+ V+QVL+ A+ AK  G+TR+CMGAAW+ P+ERD+  +  +++GVK++GL
Sbjct: 66  YKTGLEAERLMEVEQVLESARKAKNAGSTRFCMGAAWKNPRERDMPYLEQIVQGVKAMGL 125

Query: 138 ETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSGI 197
           ETCMTLGML+  QAQ L+ AGLDYYNHN+DTS  FY ++ TT T+++RL TLE VR++GI
Sbjct: 126 ETCMTLGMLNESQAQRLANAGLDYYNHNLDTSPEFYGNIITTRTYQERLDTLEKVREAGI 185

Query: 198 KVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEHVR 257
           KVC GGI+GLGE ++DR  +LL LANL TPPES+PIN+L+ + G+   +N  VD  + +R
Sbjct: 186 KVCSGGIVGLGETVNDRAGLLLQLANLPTPPESVPINMLVKVKGTPLADNDDVDAFDFIR 245

Query: 258 IISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTILF 317
            I+VARI+MP S +RL+AGR  M+++ QA+CF +GANSIF G  LLT  NP+ +KD  LF
Sbjct: 246 TIAVARIMMPTSYVRLSAGREQMNEQTQAMCFMAGANSIFYGCKLLTTPNPAEDKDLQLF 305

Query: 318 NRLGLIPDLS 327
            +LGL P  +
Sbjct: 306 RKLGLNPQQT 315


>gi|283479061|emb|CAY74977.1| biotin synthetase [Erwinia pyrifoliae DSM 12163]
          Length = 351

 Score =  328 bits (841), Expect = 6e-88,   Method: Composition-based stats.
 Identities = 162/310 (52%), Positives = 224/310 (72%)

Query: 18  VWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQSVH 77
            WT  +   ++  PF +L+F +   HR++F+P  +Q+S LL+IKTG CPE+C YC QS  
Sbjct: 12  RWTLSQAQALFEKPFLELMFEAQLTHRQHFDPRQVQVSTLLSIKTGACPEDCKYCPQSAR 71

Query: 78  NKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLGL 137
            K+ L++ +L+ V++VL  A+ AK  G+ R+CMGAAW+ P ERD+  +  M++GVK++G+
Sbjct: 72  YKTGLESERLMEVEEVLSSARKAKAAGSGRFCMGAAWKNPHERDMPYLEKMVQGVKAMGM 131

Query: 138 ETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSGI 197
           ETCMTLG LS +QAQ L+ AGLD+YNHN+DTS  FY  + TT +++DRL TL  VR +GI
Sbjct: 132 ETCMTLGSLSQQQAQRLADAGLDFYNHNLDTSPEFYRSIITTRSYQDRLDTLGQVRNAGI 191

Query: 198 KVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEHVR 257
           KVC GGI+GLGE + DR  +L+ LANL  PPES+PIN+L+ + G+   +N  VDP + VR
Sbjct: 192 KVCSGGIVGLGETVQDRAGLLVQLANLPEPPESVPINMLVKVKGTPLADNDDVDPFDFVR 251

Query: 258 IISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTILF 317
            I+VARI+MP+S +RL+AGR  MS++ QALCF +GANSIF G  LLT  NP  +KD +LF
Sbjct: 252 TIAVARIMMPRSHVRLSAGREQMSEQTQALCFMAGANSIFYGCKLLTTPNPEEDKDLLLF 311

Query: 318 NRLGLIPDLS 327
            +LGL P  S
Sbjct: 312 RKLGLNPQHS 321


>gi|56414104|ref|YP_151179.1| biotin synthetase [Salmonella enterica subsp. enterica serovar
           Paratyphi A str. ATCC 9150]
 gi|168230678|ref|ZP_02655736.1| biotin synthase [Salmonella enterica subsp. enterica serovar
           Kentucky str. CDC 191]
 gi|168236718|ref|ZP_02661776.1| biotin synthase [Salmonella enterica subsp. enterica serovar
           Schwarzengrund str. SL480]
 gi|168240652|ref|ZP_02665584.1| biotin synthase [Salmonella enterica subsp. enterica serovar
           Heidelberg str. SL486]
 gi|168263711|ref|ZP_02685684.1| biotin synthase [Salmonella enterica subsp. enterica serovar Hadar
           str. RI_05P066]
 gi|168820067|ref|ZP_02832067.1| biotin synthase [Salmonella enterica subsp. enterica serovar
           Weltevreden str. HI_N05-537]
 gi|194451531|ref|YP_002044822.1| biotin synthase [Salmonella enterica subsp. enterica serovar
           Heidelberg str. SL476]
 gi|194470543|ref|ZP_03076527.1| biotin synthase [Salmonella enterica subsp. enterica serovar
           Kentucky str. CVM29188]
 gi|194737665|ref|YP_002113887.1| biotin synthase [Salmonella enterica subsp. enterica serovar
           Schwarzengrund str. CVM19633]
 gi|197363026|ref|YP_002142663.1| biotin synthetase [Salmonella enterica subsp. enterica serovar
           Paratyphi A str. AKU_12601]
 gi|198244425|ref|YP_002214759.1| biotin synthase [Salmonella enterica subsp. enterica serovar Dublin
           str. CT_02021853]
 gi|200389406|ref|ZP_03216017.1| biotin synthase [Salmonella enterica subsp. enterica serovar
           Virchow str. SL491]
 gi|204929936|ref|ZP_03220957.1| biotin synthase [Salmonella enterica subsp. enterica serovar
           Javiana str. GA_MM04042433]
 gi|207856232|ref|YP_002242883.1| biotin synthetase [Salmonella enterica subsp. enterica serovar
           Enteritidis str. P125109]
 gi|81599446|sp|Q5PG48|BIOB_SALPA RecName: Full=Biotin synthase
 gi|254810798|sp|B5FP61|BIOB_SALDC RecName: Full=Biotin synthase
 gi|254810799|sp|B5QX65|BIOB_SALEP RecName: Full=Biotin synthase
 gi|254810801|sp|B4TC48|BIOB_SALHS RecName: Full=Biotin synthase
 gi|254810805|sp|B5BC31|BIOB_SALPK RecName: Full=Biotin synthase
 gi|254810806|sp|B4TQT9|BIOB_SALSV RecName: Full=Biotin synthase
 gi|56128361|gb|AAV77867.1| biotin synthetase [Salmonella enterica subsp. enterica serovar
           Paratyphi A str. ATCC 9150]
 gi|194409835|gb|ACF70054.1| biotin synthase [Salmonella enterica subsp. enterica serovar
           Heidelberg str. SL476]
 gi|194456907|gb|EDX45746.1| biotin synthase [Salmonella enterica subsp. enterica serovar
           Kentucky str. CVM29188]
 gi|194713167|gb|ACF92388.1| biotin synthase [Salmonella enterica subsp. enterica serovar
           Schwarzengrund str. CVM19633]
 gi|197094503|emb|CAR60022.1| biotin synthetase [Salmonella enterica subsp. enterica serovar
           Paratyphi A str. AKU_12601]
 gi|197290189|gb|EDY29546.1| biotin synthase [Salmonella enterica subsp. enterica serovar
           Schwarzengrund str. SL480]
 gi|197938941|gb|ACH76274.1| biotin synthase [Salmonella enterica subsp. enterica serovar Dublin
           str. CT_02021853]
 gi|199601851|gb|EDZ00397.1| biotin synthase [Salmonella enterica subsp. enterica serovar
           Virchow str. SL491]
 gi|204320930|gb|EDZ06131.1| biotin synthase [Salmonella enterica subsp. enterica serovar
           Javiana str. GA_MM04042433]
 gi|205334802|gb|EDZ21566.1| biotin synthase [Salmonella enterica subsp. enterica serovar
           Kentucky str. CDC 191]
 gi|205340434|gb|EDZ27198.1| biotin synthase [Salmonella enterica subsp. enterica serovar
           Heidelberg str. SL486]
 gi|205343171|gb|EDZ29935.1| biotin synthase [Salmonella enterica subsp. enterica serovar
           Weltevreden str. HI_N05-537]
 gi|205347752|gb|EDZ34383.1| biotin synthase [Salmonella enterica subsp. enterica serovar Hadar
           str. RI_05P066]
 gi|206708035|emb|CAR32325.1| biotin synthetase [Salmonella enterica subsp. enterica serovar
           Enteritidis str. P125109]
 gi|320085066|emb|CBY94853.1| biotin synthetase [Salmonella enterica subsp. enterica serovar
           Weltevreden str. 2007-60-3289-1]
 gi|322613857|gb|EFY10795.1| biotin synthase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 315996572]
 gi|322620356|gb|EFY17223.1| biotin synthase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 495297-1]
 gi|322622782|gb|EFY19627.1| biotin synthase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 495297-3]
 gi|322628694|gb|EFY25481.1| biotin synthase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 495297-4]
 gi|322631632|gb|EFY28388.1| biotin synthase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 515920-1]
 gi|322637158|gb|EFY33861.1| biotin synthase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 515920-2]
 gi|322641642|gb|EFY38278.1| biotin synthase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 531954]
 gi|322648023|gb|EFY44493.1| biotin synthase [Salmonella enterica subsp. enterica serovar
           Montevideo str. NC_MB110209-0054]
 gi|322648495|gb|EFY44947.1| biotin synthase [Salmonella enterica subsp. enterica serovar
           Montevideo str. OH_2009072675]
 gi|322654232|gb|EFY50555.1| biotin synthase [Salmonella enterica subsp. enterica serovar
           Montevideo str. CASC_09SCPH15965]
 gi|322658147|gb|EFY54414.1| biotin synthase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 19N]
 gi|322663621|gb|EFY59823.1| biotin synthase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 81038-01]
 gi|322670357|gb|EFY66497.1| biotin synthase [Salmonella enterica subsp. enterica serovar
           Montevideo str. MD_MDA09249507]
 gi|322671593|gb|EFY67715.1| biotin synthase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 414877]
 gi|322676949|gb|EFY73016.1| biotin synthase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 366867]
 gi|322682874|gb|EFY78893.1| biotin synthase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 413180]
 gi|322686553|gb|EFY82535.1| biotin synthase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 446600]
 gi|323194550|gb|EFZ79743.1| biotin synthase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 609458-1]
 gi|323199119|gb|EFZ84215.1| biotin synthase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 556150-1]
 gi|323202075|gb|EFZ87134.1| biotin synthase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 609460]
 gi|323208900|gb|EFZ93837.1| biotin synthase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 507440-20]
 gi|323211368|gb|EFZ96210.1| biotin synthase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 556152]
 gi|323215263|gb|EGA00009.1| biotin synthase [Salmonella enterica subsp. enterica serovar
           Montevideo str. MB101509-0077]
 gi|323220817|gb|EGA05255.1| biotin synthase [Salmonella enterica subsp. enterica serovar
           Montevideo str. MB102109-0047]
 gi|323223867|gb|EGA08168.1| biotin synthase [Salmonella enterica subsp. enterica serovar
           Montevideo str. MB110209-0055]
 gi|323229941|gb|EGA14064.1| biotin synthase [Salmonella enterica subsp. enterica serovar
           Montevideo str. MB111609-0052]
 gi|323233166|gb|EGA17262.1| biotin synthase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 2009083312]
 gi|323240901|gb|EGA24943.1| biotin synthase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 2009085258]
 gi|323243218|gb|EGA27238.1| biotin synthase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 315731156]
 gi|323248757|gb|EGA32685.1| biotin synthase [Salmonella enterica subsp. enterica serovar
           Montevideo str. IA_2009159199]
 gi|323251761|gb|EGA35628.1| biotin synthase [Salmonella enterica subsp. enterica serovar
           Montevideo str. IA_2010008282]
 gi|323258747|gb|EGA42404.1| biotin synthase [Salmonella enterica subsp. enterica serovar
           Montevideo str. IA_2010008283]
 gi|323260708|gb|EGA44313.1| biotin synthase [Salmonella enterica subsp. enterica serovar
           Montevideo str. IA_2010008284]
 gi|323267856|gb|EGA51335.1| biotin synthase [Salmonella enterica subsp. enterica serovar
           Montevideo str. IA_2010008285]
 gi|323268760|gb|EGA52220.1| biotin synthase [Salmonella enterica subsp. enterica serovar
           Montevideo str. IA_2010008287]
 gi|326622514|gb|EGE28859.1| biotin synthetase [Salmonella enterica subsp. enterica serovar
           Dublin str. 3246]
          Length = 346

 Score =  328 bits (841), Expect = 7e-88,   Method: Composition-based stats.
 Identities = 165/310 (53%), Positives = 229/310 (73%)

Query: 18  VWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQSVH 77
            WT  +V +++  P  +LLF +  +HR++F+P  +Q+S LL+IKTG CPE+C YC QS  
Sbjct: 6   RWTLSQVTELFEKPLLELLFEAQQIHRQHFDPQQVQVSTLLSIKTGACPEDCKYCPQSSR 65

Query: 78  NKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLGL 137
            K+ L+A +L+ V+QVL  A+ AK  G+TR+CMGAAW+ P ERD+  +  +++GVK++GL
Sbjct: 66  YKTGLEAERLMEVEQVLDSARKAKNAGSTRFCMGAAWKNPHERDMPYLEQIVQGVKAMGL 125

Query: 138 ETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSGI 197
           ETCMTLGML+  QAQ L+ AGLDYYNHN+DTS  FY ++ TT T+++RL TLE VR++GI
Sbjct: 126 ETCMTLGMLNESQAQRLANAGLDYYNHNLDTSPEFYGNIITTRTYQERLDTLEKVREAGI 185

Query: 198 KVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEHVR 257
           KVC GGI+GLGE + DR  +LL LANL TPPES+PIN+L+ + G+   +N  VD  + +R
Sbjct: 186 KVCSGGIVGLGETVTDRAGLLLQLANLPTPPESVPINMLVKVKGTPLADNDDVDAFDFIR 245

Query: 258 IISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTILF 317
            I+VARI+MP S +RL+AGR  M+++ QA+CF +GANSIF G  LLT  NP+ +KD  LF
Sbjct: 246 TIAVARIMMPTSYVRLSAGREQMNEQTQAMCFMAGANSIFYGCKLLTTPNPAEDKDLQLF 305

Query: 318 NRLGLIPDLS 327
            +LGL P  +
Sbjct: 306 RKLGLNPQQT 315


>gi|311695377|gb|ADP98250.1| biotin synthase [marine bacterium HP15]
          Length = 352

 Score =  328 bits (840), Expect = 8e-88,   Method: Composition-based stats.
 Identities = 175/315 (55%), Positives = 243/315 (77%)

Query: 12  PTKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGY 71
            T+    WT +E  +++ +PFNDLLF + +VHR+ F+PN +Q+S LL+IKTG CPE+C Y
Sbjct: 3   ATELRHDWTLQEARELFELPFNDLLFRAQSVHRQYFDPNEVQVSTLLSIKTGACPEDCKY 62

Query: 72  CNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKG 131
           C QS H  + L+  KL+ +++V+ EA+ AKE GA+R+CMGAAWR P ++D+  ++DM+K 
Sbjct: 63  CPQSGHYNTGLEKEKLLEIEKVVAEARAAKEKGASRFCMGAAWRSPSKKDMPYVLDMVKQ 122

Query: 132 VKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLEN 191
           VKSLGLETCMTLGML  EQA  L+ AGLDYYNHN+DTSE++Y H+ TT T++DRL TL+N
Sbjct: 123 VKSLGLETCMTLGMLKEEQAAELADAGLDYYNHNLDTSEKYYSHIITTRTYQDRLDTLDN 182

Query: 192 VRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVD 251
           VRK+G+KVCCGGI+G+GE  DDR+ +L+ LANL   PES+P+N+L+ + G+  E+ + +D
Sbjct: 183 VRKAGMKVCCGGIMGMGEDEDDRVGLLVQLANLPHHPESVPVNMLVKVKGTPLEDVEDLD 242

Query: 252 PIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYN 311
           P E +RII+VARILMP S +RL+AGR  M++++QALCF +GANSIF G+ LLT  NP  +
Sbjct: 243 PFEFIRIIAVARILMPASHVRLSAGRENMNEQMQALCFMAGANSIFYGEKLLTTANPEAD 302

Query: 312 KDTILFNRLGLIPDL 326
            D +LF RLG+ P+ 
Sbjct: 303 ADMLLFKRLGIRPEQ 317


>gi|205352053|ref|YP_002225854.1| biotin synthetase [Salmonella enterica subsp. enterica serovar
           Gallinarum str. 287/91]
 gi|254810800|sp|B5R761|BIOB_SALG2 RecName: Full=Biotin synthase
 gi|205271834|emb|CAR36668.1| biotin synthetase [Salmonella enterica subsp. enterica serovar
           Gallinarum str. 287/91]
 gi|326627094|gb|EGE33437.1| biotin synthetase [Salmonella enterica subsp. enterica serovar
           Gallinarum str. 9]
          Length = 346

 Score =  328 bits (840), Expect = 8e-88,   Method: Composition-based stats.
 Identities = 165/310 (53%), Positives = 229/310 (73%)

Query: 18  VWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQSVH 77
            WT  +V +++  P  +LLF +  +HR++F+P  +Q+S LL+IKTG CPE+C YC QS  
Sbjct: 6   RWTLSQVTELFEKPLLELLFEAQQIHRQHFDPQQVQVSTLLSIKTGACPEDCKYCPQSSR 65

Query: 78  NKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLGL 137
            K+ L+A +L+ V+QVL  A+ AK  G+TR+CMGAAW+ P ERD+  +  +++GVK++GL
Sbjct: 66  YKTGLEAERLMAVEQVLDSARKAKNAGSTRFCMGAAWKNPHERDMPYLEQIVQGVKAMGL 125

Query: 138 ETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSGI 197
           ETCMTLGML+  QAQ L+ AGLDYYNHN+DTS  FY ++ TT T+++RL TLE VR++GI
Sbjct: 126 ETCMTLGMLNESQAQRLANAGLDYYNHNLDTSPEFYGNIITTRTYQERLDTLEKVREAGI 185

Query: 198 KVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEHVR 257
           KVC GGI+GLGE + DR  +LL LANL TPPES+PIN+L+ + G+   +N  VD  + +R
Sbjct: 186 KVCSGGIVGLGETVTDRAGLLLQLANLPTPPESVPINMLVKVKGTPLADNDDVDAFDFIR 245

Query: 258 IISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTILF 317
            I+VARI+MP S +RL+AGR  M+++ QA+CF +GANSIF G  LLT  NP+ +KD  LF
Sbjct: 246 TIAVARIMMPTSYVRLSAGREQMNEQTQAMCFMAGANSIFYGCKLLTTPNPAEDKDLQLF 305

Query: 318 NRLGLIPDLS 327
            +LGL P  +
Sbjct: 306 RKLGLNPQQT 315


>gi|16759719|ref|NP_455336.1| biotin synthetase [Salmonella enterica subsp. enterica serovar
           Typhi str. CT18]
 gi|29142508|ref|NP_805850.1| biotin synthetase [Salmonella enterica subsp. enterica serovar
           Typhi str. Ty2]
 gi|197250225|ref|YP_002145750.1| biotin synthase [Salmonella enterica subsp. enterica serovar Agona
           str. SL483]
 gi|213052118|ref|ZP_03344996.1| biotin synthase [Salmonella enterica subsp. enterica serovar Typhi
           str. E00-7866]
 gi|213424808|ref|ZP_03357558.1| biotin synthase [Salmonella enterica subsp. enterica serovar Typhi
           str. E02-1180]
 gi|213583481|ref|ZP_03365307.1| biotin synthase [Salmonella enterica subsp. enterica serovar Typhi
           str. E98-0664]
 gi|213618803|ref|ZP_03372629.1| biotin synthase [Salmonella enterica subsp. enterica serovar Typhi
           str. E98-2068]
 gi|213647611|ref|ZP_03377664.1| biotin synthase [Salmonella enterica subsp. enterica serovar Typhi
           str. J185]
 gi|238913354|ref|ZP_04657191.1| biotin synthase [Salmonella enterica subsp. enterica serovar
           Tennessee str. CDC07-0191]
 gi|289825268|ref|ZP_06544547.1| biotin synthase [Salmonella enterica subsp. enterica serovar Typhi
           str. E98-3139]
 gi|81593553|sp|Q8Z893|BIOB_SALTI RecName: Full=Biotin synthase
 gi|254810795|sp|B5F072|BIOB_SALA4 RecName: Full=Biotin synthase
 gi|25294059|pir||AH0596 biotin synthetase [imported] - Salmonella enterica subsp. enterica
           serovar Typhi (strain CT18)
 gi|16502012|emb|CAD05242.1| biotin synthetase [Salmonella enterica subsp. enterica serovar
           Typhi]
 gi|29138139|gb|AAO69710.1| biotin synthetase [Salmonella enterica subsp. enterica serovar
           Typhi str. Ty2]
 gi|197213928|gb|ACH51325.1| biotin synthase [Salmonella enterica subsp. enterica serovar Agona
           str. SL483]
          Length = 346

 Score =  328 bits (840), Expect = 9e-88,   Method: Composition-based stats.
 Identities = 165/310 (53%), Positives = 229/310 (73%)

Query: 18  VWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQSVH 77
            WT  +V +++  P  +LLF +  +HR++F+P  +Q+S LL+IKTG CPE+C YC QS  
Sbjct: 6   RWTLSQVTELFEKPLLELLFEAQQIHRQHFDPQQVQVSTLLSIKTGACPEDCKYCPQSSR 65

Query: 78  NKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLGL 137
            K+ L+A +L+ V+QVL  A+ AK  G+TR+CMGAAW+ P ERD+  +  +++GVK++GL
Sbjct: 66  YKTGLEAERLMEVEQVLDSARKAKNAGSTRFCMGAAWKNPHERDMPYLEKIVQGVKAMGL 125

Query: 138 ETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSGI 197
           ETCMTLGML+  QAQ L+ AGLDYYNHN+DTS  FY ++ TT T+++RL TLE VR++GI
Sbjct: 126 ETCMTLGMLNESQAQRLANAGLDYYNHNLDTSPEFYGNIITTRTYQERLDTLEKVREAGI 185

Query: 198 KVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEHVR 257
           KVC GGI+GLGE + DR  +LL LANL TPPES+PIN+L+ + G+   +N  VD  + +R
Sbjct: 186 KVCSGGIVGLGETVTDRAGLLLQLANLPTPPESVPINMLVKVKGTPLADNDDVDAFDFIR 245

Query: 258 IISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTILF 317
            I+VARI+MP S +RL+AGR  M+++ QA+CF +GANSIF G  LLT  NP+ +KD  LF
Sbjct: 246 TIAVARIMMPTSYVRLSAGREQMNEQTQAMCFMAGANSIFYGCKLLTTPNPAEDKDLQLF 305

Query: 318 NRLGLIPDLS 327
            +LGL P  +
Sbjct: 306 RKLGLNPQQT 315


>gi|313496728|gb|ADR58094.1| BioB [Pseudomonas putida BIRD-1]
          Length = 352

 Score =  328 bits (840), Expect = 9e-88,   Method: Composition-based stats.
 Identities = 167/313 (53%), Positives = 229/313 (73%)

Query: 13  TKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYC 72
                 W+  EV  ++  PFNDLLF + TVHR +F+PN +Q+S LL+IKTG CPE+C YC
Sbjct: 7   ATTRHDWSLAEVKALFQQPFNDLLFQAQTVHRAHFDPNRVQVSTLLSIKTGACPEDCKYC 66

Query: 73  NQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGV 132
            QS H  + L+  KL+ V +VL+EA  AK  G+TR+CMGAAW+ P  +D+  +++M+KGV
Sbjct: 67  PQSGHYNTGLEKQKLMEVQKVLEEAARAKAIGSTRFCMGAAWKHPSAKDMPYVLEMVKGV 126

Query: 133 KSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENV 192
           K++GLETCMTLG L  EQ + L++AGLDYYNHN+DTS  FY  + TT T+ +RLQTL  V
Sbjct: 127 KAMGLETCMTLGKLDQEQTKALAQAGLDYYNHNLDTSPEFYGSIITTRTYSERLQTLAYV 186

Query: 193 RKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDP 252
           R +G+K+C GGILG+GE +DDR  +L+ LANL   PES+PIN+L+ + G+   E + VDP
Sbjct: 187 RDAGMKICSGGILGMGESLDDRAGLLIQLANLPEHPESVPINMLVKVAGTPLAEEEDVDP 246

Query: 253 IEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNK 312
            + +R+++VARILMPKS +RL+AGR  M++++QAL F +GANSIF G+ LLT  NP  +K
Sbjct: 247 FDFIRMLAVARILMPKSHVRLSAGREQMNEQMQALAFMAGANSIFYGEKLLTTANPQADK 306

Query: 313 DTILFNRLGLIPD 325
           D  LF RLG+ P+
Sbjct: 307 DMQLFARLGIKPE 319


>gi|325271488|ref|ZP_08138006.1| biotin synthase [Pseudomonas sp. TJI-51]
 gi|324103378|gb|EGC00707.1| biotin synthase [Pseudomonas sp. TJI-51]
          Length = 352

 Score =  328 bits (840), Expect = 9e-88,   Method: Composition-based stats.
 Identities = 168/313 (53%), Positives = 229/313 (73%)

Query: 13  TKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYC 72
                 W+  EV  ++  PFNDLLF + TVHR +F+PN +Q+S LL+IKTG CPE+C YC
Sbjct: 7   ATTRHDWSLAEVKALFQQPFNDLLFQAQTVHRAHFDPNRVQVSTLLSIKTGACPEDCKYC 66

Query: 73  NQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGV 132
            QS H  + L+  KL+ V +VL+EA  AK  G+TR+CMGAAW+ P  +D+  +++M+KGV
Sbjct: 67  PQSGHYNTGLEKQKLMEVQKVLEEAARAKAIGSTRFCMGAAWKHPSAKDMPYVLEMVKGV 126

Query: 133 KSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENV 192
           K+LGLETCMTLG L  EQ Q L++AGLDYYNHN+DTS  FY  + TT T+ +RLQTL  V
Sbjct: 127 KALGLETCMTLGKLDQEQTQALAQAGLDYYNHNLDTSPEFYGSIITTRTYSERLQTLAYV 186

Query: 193 RKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDP 252
           R +G+K+C GGILG+GE +DDR  +L+ LANL   PES+PIN+L+ + G+   E + VDP
Sbjct: 187 RDAGMKICSGGILGMGESLDDRAGLLIQLANLPEHPESVPINMLVKVAGTPLAEEEDVDP 246

Query: 253 IEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNK 312
            + +R+++VAR+LMPKS +RL+AGR  M++++QAL F +GANSIF G+ LLT  NP  +K
Sbjct: 247 FDFIRMLAVARLLMPKSHVRLSAGREQMNEQMQALAFMAGANSIFYGEKLLTTANPQADK 306

Query: 313 DTILFNRLGLIPD 325
           D  LF RLG+ P+
Sbjct: 307 DMQLFARLGIKPE 319


>gi|271501013|ref|YP_003334038.1| biotin synthase [Dickeya dadantii Ech586]
 gi|270344568|gb|ACZ77333.1| biotin synthase [Dickeya dadantii Ech586]
          Length = 345

 Score =  328 bits (840), Expect = 9e-88,   Method: Composition-based stats.
 Identities = 161/309 (52%), Positives = 228/309 (73%)

Query: 19  WTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQSVHN 78
           WT ++   +++ PF +L+F +  VHR++F+P  +Q+S LL+IKTG CPE+C YC QS   
Sbjct: 7   WTLEQAQALFDKPFLELMFEAQQVHRQHFDPRQVQVSTLLSIKTGACPEDCKYCPQSARY 66

Query: 79  KSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLGLE 138
           ++ ++  +L+ V+QVL+ A+ AK  G+TR+CMGAAW+ P ERD+  +  M++GVK +G+E
Sbjct: 67  RTGIETERLMQVEQVLESARQAKAAGSTRFCMGAAWKNPHERDMPYLESMVRGVKEMGME 126

Query: 139 TCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSGIK 198
           TCMTLG L  +QAQ L+ AGLD+YNHN+DTS  FY ++ TT T+++RL TL+ VR +GIK
Sbjct: 127 TCMTLGTLHGDQAQRLAAAGLDFYNHNLDTSPEFYGNIITTRTYQERLDTLDKVRGAGIK 186

Query: 199 VCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEHVRI 258
           VC GGI+GLGE + DR  +L+ LANL TPPES+PIN+L+ + G+   EN  VDP + +R 
Sbjct: 187 VCSGGIVGLGETVRDRAGLLVQLANLPTPPESVPINMLVKVKGTPLAENDDVDPFDFIRT 246

Query: 259 ISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTILFN 318
           I+VARI+MP S +RL+AGR  MS++ QA+CF +GANSIF G  LLT  NP  +KD +LF 
Sbjct: 247 IAVARIMMPTSYVRLSAGREQMSEQTQAMCFMAGANSIFYGCKLLTTPNPKEDKDLLLFR 306

Query: 319 RLGLIPDLS 327
           +LGL P  +
Sbjct: 307 KLGLNPQQT 315


>gi|167031408|ref|YP_001666639.1| biotin synthase [Pseudomonas putida GB-1]
 gi|254810783|sp|B0KJ53|BIOB_PSEPG RecName: Full=Biotin synthase
 gi|166857896|gb|ABY96303.1| biotin synthase [Pseudomonas putida GB-1]
          Length = 352

 Score =  327 bits (839), Expect = 1e-87,   Method: Composition-based stats.
 Identities = 166/313 (53%), Positives = 228/313 (72%)

Query: 13  TKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYC 72
                 W+  EV  ++  PFNDLLF + TVHR +F+PN +Q+S LL+IKTG CPE+C YC
Sbjct: 7   ATTRHDWSLAEVKALFQQPFNDLLFQAQTVHRAHFDPNRVQVSTLLSIKTGACPEDCKYC 66

Query: 73  NQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGV 132
            QS H  + L+  KL+ V +VL+EA  AK  G+TR+CMGAAW+ P  +D+  +++M+KGV
Sbjct: 67  PQSGHYNTGLEKQKLMEVQKVLEEAARAKAIGSTRFCMGAAWKHPSAKDMPYVLEMVKGV 126

Query: 133 KSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENV 192
           K++GLETCMTLG L  +Q   L++AGLDYYNHN+DTS  FY  + TT T+ +RLQTL  V
Sbjct: 127 KAMGLETCMTLGKLDQDQTLALAQAGLDYYNHNLDTSPEFYGSIITTRTYGERLQTLAYV 186

Query: 193 RKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDP 252
           R +G+K+C GGILG+GE +DDR  +L+ LANL   PES+PIN+L+ + G+   E + VDP
Sbjct: 187 RDAGMKICSGGILGMGESLDDRAGLLIQLANLPEHPESVPINMLVKVAGTPLAEEEDVDP 246

Query: 253 IEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNK 312
            + +R+++VARILMPKS +RL+AGR  M++++QAL F +GANSIF G+ LLT  NP  +K
Sbjct: 247 FDFIRMLAVARILMPKSHVRLSAGREQMNEQMQALAFMAGANSIFYGEKLLTTANPQADK 306

Query: 313 DTILFNRLGLIPD 325
           D  LF RLG+ P+
Sbjct: 307 DMQLFARLGIKPE 319


>gi|237730750|ref|ZP_04561231.1| biotin synthase [Citrobacter sp. 30_2]
 gi|226906289|gb|EEH92207.1| biotin synthase [Citrobacter sp. 30_2]
          Length = 346

 Score =  327 bits (839), Expect = 1e-87,   Method: Composition-based stats.
 Identities = 165/311 (53%), Positives = 227/311 (72%)

Query: 18  VWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQSVH 77
            WT  +V +++  P  DLLF +  VHR++F+P  +Q+S LL+IKTG CPE+C YC QS  
Sbjct: 6   RWTMSQVTELFEKPLLDLLFEAQQVHRQHFDPQQVQVSTLLSIKTGACPEDCKYCPQSSR 65

Query: 78  NKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLGL 137
            K+ L+  +L+ V+QVL  A+ AK+ G+TR+CMGAAW+ P ERD+  +  M++GVK LGL
Sbjct: 66  YKTGLETERLMEVEQVLDSARKAKQAGSTRFCMGAAWKNPHERDMPYLEQMVQGVKELGL 125

Query: 138 ETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSGI 197
           E CMTLG L   QAQ L+ AGLDYYNHN+DTS  FY ++ TT ++++RL TL+ VR++GI
Sbjct: 126 EACMTLGTLDESQAQRLANAGLDYYNHNLDTSPEFYGNIITTRSYQERLDTLDKVREAGI 185

Query: 198 KVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEHVR 257
           KVC GGI+GLGE + DR  +LL LANL TPPES+PIN+L+ + G+   +N  VD  + +R
Sbjct: 186 KVCSGGIVGLGETVTDRAGLLLQLANLPTPPESVPINMLVKVKGTPLADNDDVDAFDFIR 245

Query: 258 IISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTILF 317
            I+VARI+MP S +RL+AGR  M+++ QA+CF +GANSIF G  LLT  NP+ +KD +LF
Sbjct: 246 TIAVARIMMPTSYVRLSAGREQMNEQTQAMCFMAGANSIFYGCKLLTTPNPNEDKDLLLF 305

Query: 318 NRLGLIPDLSA 328
            +LGL P  +A
Sbjct: 306 RKLGLNPQQTA 316


>gi|227328807|ref|ZP_03832831.1| biotin synthase [Pectobacterium carotovorum subsp. carotovorum
           WPP14]
          Length = 345

 Score =  327 bits (839), Expect = 1e-87,   Method: Composition-based stats.
 Identities = 160/310 (51%), Positives = 227/310 (73%)

Query: 19  WTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQSVHN 78
           WT ++   ++N PF +L+F +  +HR++F+P  +Q+S LL+IKTG CPE+C YC QS   
Sbjct: 7   WTLEQAQDLFNKPFLELMFEAQQIHRQHFDPRQVQVSTLLSIKTGSCPEDCKYCPQSSRY 66

Query: 79  KSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLGLE 138
           ++ +   +L+ V+QVL+ A+ AK  G+TR+CMGAAW+ P ERD+  +  M++GVK++G+E
Sbjct: 67  RTGIDTERLMQVEQVLESARQAKAAGSTRFCMGAAWKNPHERDMPYLEQMVQGVKAMGME 126

Query: 139 TCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSGIK 198
           TCMTLG L  +QA+ L+ AGLD+YNHN+DTS  FY  + TT T+++RL TL+ VR +GIK
Sbjct: 127 TCMTLGTLHNDQAERLASAGLDFYNHNLDTSPEFYGSIITTRTYQERLDTLDKVRGAGIK 186

Query: 199 VCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEHVRI 258
           VC GGI+GLGE + DR  +L+ LANL TPPES+PIN+L+ + G+   +N  VDP + +R 
Sbjct: 187 VCSGGIVGLGETVRDRAGLLVQLANLPTPPESVPINMLVKVKGTPLADNDDVDPFDFIRT 246

Query: 259 ISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTILFN 318
           I+VARI+MP S +RL+AGR  MS++ QA+CF +GANSIF G  LLT  NP  +KD  LF 
Sbjct: 247 IAVARIMMPASYVRLSAGREQMSEQTQAMCFMAGANSIFYGCKLLTTPNPKEDKDLALFL 306

Query: 319 RLGLIPDLSA 328
           +LGL P  +A
Sbjct: 307 KLGLNPQQTA 316


>gi|254810628|sp|B3PI87|BIOB_CELJU RecName: Full=Biotin synthase
          Length = 358

 Score =  327 bits (838), Expect = 1e-87,   Method: Composition-based stats.
 Identities = 169/310 (54%), Positives = 232/310 (74%)

Query: 16  PKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQS 75
              W+  E+  ++ +PF+DL+F + +VHR  F PN +Q+S L +IKTG CPE+C YC QS
Sbjct: 16  RHDWSRAEIKALFELPFSDLMFQAQSVHRAWFNPNEVQVSTLCSIKTGACPEDCAYCPQS 75

Query: 76  VHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSL 135
               + L+  KL+ V++V++EA+ AK +GATR+CMGAAWR PK +D+  +  M+KGVKSL
Sbjct: 76  ARYDTGLEKEKLMAVEKVIEEARAAKASGATRFCMGAAWRSPKGKDMPYVTAMVKGVKSL 135

Query: 136 GLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKS 195
           G+ETCMTLGMLS  QAQ L+ AGLDYYNHN+DTS  +Y  + TT T++DRL+TL+NVRK+
Sbjct: 136 GMETCMTLGMLSEAQAQDLADAGLDYYNHNLDTSPEYYGEIITTRTYQDRLETLDNVRKA 195

Query: 196 GIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEH 255
           G+KVCCGGI+G+GE + DR  +L  LAN++  PES+PIN+L+ + G+  E    +DPI+ 
Sbjct: 196 GMKVCCGGIVGMGEEVLDRAGLLQQLANMAEHPESVPINMLVKVGGTPLEREADLDPIDF 255

Query: 256 VRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTI 315
           +R I+VARILMPKS +RL+AGR  M+++ QAL F +GANSIF G+ LLT  NP  NKD  
Sbjct: 256 IRTIAVARILMPKSHVRLSAGREQMNEQTQALAFLAGANSIFYGEKLLTTPNPEANKDMQ 315

Query: 316 LFNRLGLIPD 325
           LFN+LG+ P+
Sbjct: 316 LFNKLGIKPE 325


>gi|293397188|ref|ZP_06641462.1| biotin synthase [Serratia odorifera DSM 4582]
 gi|291420659|gb|EFE93914.1| biotin synthase [Serratia odorifera DSM 4582]
          Length = 345

 Score =  327 bits (838), Expect = 1e-87,   Method: Composition-based stats.
 Identities = 159/310 (51%), Positives = 228/310 (73%)

Query: 19  WTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQSVHN 78
           WT  +   +++ P  +LLF + T+HR++F+P  +Q+S LL+IKTG CPE+C YC QS   
Sbjct: 7   WTVGQAQALFDKPLLELLFEAQTIHRQHFDPRQVQVSTLLSIKTGACPEDCKYCPQSSRY 66

Query: 79  KSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLGLE 138
           K+ L+  +L+ V+QVL+ A+ AK  G+TR+CMGAAW+ P ERD+  +  M++GVK++G+E
Sbjct: 67  KTGLETERLMQVEQVLESARKAKAAGSTRFCMGAAWKNPHERDMPYLQQMVQGVKAMGME 126

Query: 139 TCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSGIK 198
           TCMTLG L   QA+ L+ AGLDYYNHN+DTS  FY ++ TT ++++RL TL+ VR +GIK
Sbjct: 127 TCMTLGTLDGTQAERLADAGLDYYNHNLDTSPEFYGNIITTRSYQERLDTLDKVRDAGIK 186

Query: 199 VCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEHVRI 258
           VC GGI+GLGE + DR  +L+ LANL  PPES+PIN+L+ + G+   +N  VDP + +R 
Sbjct: 187 VCSGGIVGLGETVRDRAGLLVQLANLPKPPESVPINMLVKVKGTPLADNDDVDPFDFIRT 246

Query: 259 ISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTILFN 318
           I+VARI+MP S +RL+AGR  M+++ QA+CF +GANS+F G  LLT  NP  +KD +LF 
Sbjct: 247 IAVARIMMPGSYVRLSAGREQMNEQTQAMCFMAGANSVFYGCKLLTTPNPEEDKDLLLFR 306

Query: 319 RLGLIPDLSA 328
           +LGL P+ +A
Sbjct: 307 KLGLNPEQTA 316


>gi|283784535|ref|YP_003364400.1| biotin synthetase [Citrobacter rodentium ICC168]
 gi|282947989|emb|CBG87553.1| biotin synthetase [Citrobacter rodentium ICC168]
          Length = 346

 Score =  327 bits (838), Expect = 1e-87,   Method: Composition-based stats.
 Identities = 164/311 (52%), Positives = 225/311 (72%)

Query: 18  VWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQSVH 77
            WT  +V +++  P  +LLF +  +HR++F+P  +Q+S LL+IKTG CPE+C YC QS  
Sbjct: 6   RWTLSQVTELFEKPLLELLFEAQQIHRQHFDPRQVQVSTLLSIKTGACPEDCKYCPQSAR 65

Query: 78  NKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLGL 137
            K+ L+A +L+ V+QVL  A+ AK  G+TR+CMGAAW+ P ERD+  +  M++GVK++GL
Sbjct: 66  YKTGLEAERLMEVEQVLDSARKAKNAGSTRFCMGAAWKNPHERDMPFLEQMVQGVKAMGL 125

Query: 138 ETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSGI 197
           E CMTLG LS  QAQ L+ AGLDYYNHN+DTS  FY ++ TT T+++RL TL+ VR +GI
Sbjct: 126 EACMTLGALSESQAQRLAAAGLDYYNHNLDTSPEFYGNIITTRTYQERLDTLDKVRDAGI 185

Query: 198 KVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEHVR 257
           KVC GGI+GLGE + DR  +LL LANL TPPES+PIN+L+ + G+   +N  VD  + +R
Sbjct: 186 KVCSGGIVGLGETVKDRAGLLLQLANLPTPPESVPINMLVKVKGTPLADNDDVDAFDFIR 245

Query: 258 IISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTILF 317
            I+VARI+MP S +RL+AGR  M+++ QA+CF +GANSIF G  LLT  NP  + D  LF
Sbjct: 246 TIAVARIMMPASYVRLSAGREQMNEQTQAMCFMAGANSIFYGCKLLTTPNPEEDNDLRLF 305

Query: 318 NRLGLIPDLSA 328
            +LGL P  +A
Sbjct: 306 RKLGLNPQQTA 316


>gi|312171803|emb|CBX80060.1| biotin synthetase [Erwinia amylovora ATCC BAA-2158]
          Length = 343

 Score =  327 bits (838), Expect = 2e-87,   Method: Composition-based stats.
 Identities = 161/310 (51%), Positives = 226/310 (72%)

Query: 18  VWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQSVH 77
            WT  +   ++  PF +L+F +   HR++F+P  +Q+S LL+IKTG CPE+C YC QS  
Sbjct: 4   RWTLSQAQALFEQPFLELMFEAQQTHRQHFDPRQVQVSTLLSIKTGACPEDCKYCPQSAR 63

Query: 78  NKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLGL 137
            K+ L+A +L+ V++VL  A+ AK  G+ R+CMGAAW+ P ERD+  +  M+KGVK++G+
Sbjct: 64  YKTGLEAERLMEVEEVLSSARKAKAAGSGRFCMGAAWKNPHERDMPHLEKMVKGVKAMGM 123

Query: 138 ETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSGI 197
           ETCMTLG LS +QAQ L+ AGLD+YNHN+DTS  FY  + TT ++++RL TL  VR++GI
Sbjct: 124 ETCMTLGSLSQQQAQRLAHAGLDFYNHNLDTSPEFYGSIITTRSYQERLDTLGKVREAGI 183

Query: 198 KVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEHVR 257
           KVC GGI+GLGE + DR  +L+ LANL  PPES+PIN+L+ + G+   +N  VDP + VR
Sbjct: 184 KVCSGGIVGLGETVQDRAGLLVQLANLPEPPESVPINMLVKVKGTPLADNDDVDPFDFVR 243

Query: 258 IISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTILF 317
            I+VARI+MP+S +RL+AGR  MS++ QA+CF +GAN+IF G  LLT  NP+ +KD +LF
Sbjct: 244 TIAVARIMMPRSHVRLSAGREQMSEQTQAMCFMAGANAIFYGCKLLTTPNPAEDKDLLLF 303

Query: 318 NRLGLIPDLS 327
            +LGL P  S
Sbjct: 304 RKLGLNPQHS 313


>gi|256823348|ref|YP_003147311.1| biotin synthase [Kangiella koreensis DSM 16069]
 gi|256796887|gb|ACV27543.1| biotin synthase [Kangiella koreensis DSM 16069]
          Length = 374

 Score =  327 bits (838), Expect = 2e-87,   Method: Composition-based stats.
 Identities = 165/319 (51%), Positives = 233/319 (73%)

Query: 7   VPEENPTKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCP 66
           + + N  +    W   E+  IYN PFNDLLF +  +HR++F PN +Q S LL+IKTG CP
Sbjct: 13  LEKLNSGQVRHDWDLAEIEAIYNQPFNDLLFAAQNIHRQHFNPNQVQTSTLLSIKTGACP 72

Query: 67  ENCGYCNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIV 126
           E+C YC QS H  + L   +L+ V++V+ +A+ AK+NGATR+CMGAAWR P+E+DL +++
Sbjct: 73  EDCAYCPQSGHYNTGLSKEQLMAVEEVISKAQQAKKNGATRFCMGAAWRSPREKDLDVVL 132

Query: 127 DMIKGVKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRL 186
           +M++ VK LGLETC+TLGML+ EQAQ L +AGLDYYNHN+DTS  +Y  + TT T+++RL
Sbjct: 133 EMVRQVKDLGLETCVTLGMLTDEQAQKLGEAGLDYYNHNLDTSPEYYQQIITTRTYKNRL 192

Query: 187 QTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEE 246
            TL+NVR +GI VC GGI+G+GE  +DR  +L  LAN+   P+S+PIN+L+ + G+   +
Sbjct: 193 DTLQNVRDAGINVCSGGIIGMGEETNDRYGLLQQLANMPEHPQSVPINMLVAVEGTPLGD 252

Query: 247 NKKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAK 306
            +K+D IE VR+I+ ARI+MP+S +RL+AGR  M++E Q LC+ +GANSIF G+ LLT  
Sbjct: 253 VEKLDSIEFVRMIATARIMMPQSYVRLSAGREDMNEETQTLCYLAGANSIFYGEKLLTTA 312

Query: 307 NPSYNKDTILFNRLGLIPD 325
           NP    D +LF RLG+ P+
Sbjct: 313 NPEAEADMLLFKRLGIEPE 331


>gi|192360896|ref|YP_001980950.1| biotin synthase [Cellvibrio japonicus Ueda107]
 gi|190687061|gb|ACE84739.1| biotin synthase [Cellvibrio japonicus Ueda107]
          Length = 366

 Score =  327 bits (837), Expect = 2e-87,   Method: Composition-based stats.
 Identities = 169/310 (54%), Positives = 232/310 (74%)

Query: 16  PKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQS 75
              W+  E+  ++ +PF+DL+F + +VHR  F PN +Q+S L +IKTG CPE+C YC QS
Sbjct: 24  RHDWSRAEIKALFELPFSDLMFQAQSVHRAWFNPNEVQVSTLCSIKTGACPEDCAYCPQS 83

Query: 76  VHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSL 135
               + L+  KL+ V++V++EA+ AK +GATR+CMGAAWR PK +D+  +  M+KGVKSL
Sbjct: 84  ARYDTGLEKEKLMAVEKVIEEARAAKASGATRFCMGAAWRSPKGKDMPYVTAMVKGVKSL 143

Query: 136 GLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKS 195
           G+ETCMTLGMLS  QAQ L+ AGLDYYNHN+DTS  +Y  + TT T++DRL+TL+NVRK+
Sbjct: 144 GMETCMTLGMLSEAQAQDLADAGLDYYNHNLDTSPEYYGEIITTRTYQDRLETLDNVRKA 203

Query: 196 GIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEH 255
           G+KVCCGGI+G+GE + DR  +L  LAN++  PES+PIN+L+ + G+  E    +DPI+ 
Sbjct: 204 GMKVCCGGIVGMGEEVLDRAGLLQQLANMAEHPESVPINMLVKVGGTPLEREADLDPIDF 263

Query: 256 VRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTI 315
           +R I+VARILMPKS +RL+AGR  M+++ QAL F +GANSIF G+ LLT  NP  NKD  
Sbjct: 264 IRTIAVARILMPKSHVRLSAGREQMNEQTQALAFLAGANSIFYGEKLLTTPNPEANKDMQ 323

Query: 316 LFNRLGLIPD 325
           LFN+LG+ P+
Sbjct: 324 LFNKLGIKPE 333


>gi|62179362|ref|YP_215779.1| biotin synthetase [Salmonella enterica subsp. enterica serovar
           Choleraesuis str. SC-B67]
 gi|75484353|sp|Q57RG3|BIOB_SALCH RecName: Full=Biotin synthase
 gi|62126995|gb|AAX64698.1| biotin synthetase [Salmonella enterica subsp. enterica serovar
           Choleraesuis str. SC-B67]
 gi|322713833|gb|EFZ05404.1| biotin synthetase [Salmonella enterica subsp. enterica serovar
           Choleraesuis str. A50]
          Length = 346

 Score =  327 bits (837), Expect = 2e-87,   Method: Composition-based stats.
 Identities = 166/310 (53%), Positives = 229/310 (73%)

Query: 18  VWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQSVH 77
            WT  +V +++  P  +LLF +  +HR++F+P  +Q+S LL+IKTG CPE+C YC QS  
Sbjct: 6   RWTLSQVTELFGKPLLELLFEAQQIHRQHFDPQQVQVSTLLSIKTGACPEDCKYCPQSSR 65

Query: 78  NKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLGL 137
            K+ L+A +L+ V+QVL  A+ AK  G+TR+CMGAAWR P ERD+  +  +++GVK++GL
Sbjct: 66  YKTGLEAERLMEVEQVLDSARKAKNAGSTRFCMGAAWRNPHERDMPYLEKIVQGVKAMGL 125

Query: 138 ETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSGI 197
           ETCMTLGML+  QAQ L+ AGLDYYNHN+DTS  FY ++ TT T+++RL TLE VR++GI
Sbjct: 126 ETCMTLGMLNESQAQRLANAGLDYYNHNLDTSPEFYGNIITTRTYQERLDTLEKVREAGI 185

Query: 198 KVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEHVR 257
           KVC GGI+GLGE + DR  +LL LANL TPPES+PIN+L+ + G+   +N  VD  + +R
Sbjct: 186 KVCSGGIVGLGETVTDRAGLLLQLANLPTPPESVPINMLVKVKGTPLADNDDVDAFDFIR 245

Query: 258 IISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTILF 317
            I+VARI+MP S +RL+AGR  M+++ QA+CF +GANSIF G  LLT  NP+ +KD  LF
Sbjct: 246 TIAVARIMMPTSYVRLSAGREQMNEQTQAMCFMAGANSIFYGCKLLTTPNPAEDKDLQLF 305

Query: 318 NRLGLIPDLS 327
            +LGL P  +
Sbjct: 306 RKLGLNPQQT 315


>gi|213022186|ref|ZP_03336633.1| biotin synthase [Salmonella enterica subsp. enterica serovar Typhi
           str. 404ty]
          Length = 314

 Score =  327 bits (837), Expect = 2e-87,   Method: Composition-based stats.
 Identities = 165/309 (53%), Positives = 228/309 (73%)

Query: 18  VWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQSVH 77
            WT  +V +++  P  +LLF +  +HR++F+P  +Q+S LL+IKTG CPE+C YC QS  
Sbjct: 6   RWTLSQVTELFEKPLLELLFEAQQIHRQHFDPQQVQVSTLLSIKTGACPEDCKYCPQSSR 65

Query: 78  NKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLGL 137
            K+ L+A +L+ V+QVL  A+ AK  G+TR+CMGAAW+ P ERD+  +  +++GVK++GL
Sbjct: 66  YKTGLEAERLMEVEQVLDSARKAKNAGSTRFCMGAAWKNPHERDMPYLEKIVQGVKAMGL 125

Query: 138 ETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSGI 197
           ETCMTLGML+  QAQ L+ AGLDYYNHN+DTS  FY ++ TT T+++RL TLE VR++GI
Sbjct: 126 ETCMTLGMLNESQAQRLANAGLDYYNHNLDTSPEFYGNIITTRTYQERLDTLEKVREAGI 185

Query: 198 KVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEHVR 257
           KVC GGI+GLGE + DR  +LL LANL TPPES+PIN+L+ + G+   +N  VD  + +R
Sbjct: 186 KVCSGGIVGLGETVTDRAGLLLQLANLPTPPESVPINMLVKVKGTPLADNDDVDAFDFIR 245

Query: 258 IISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTILF 317
            I+VARI+MP S +RL+AGR  M+++ QA+CF +GANSIF G  LLT  NP+ +KD  LF
Sbjct: 246 TIAVARIMMPTSYVRLSAGREQMNEQTQAMCFMAGANSIFYGCKLLTTPNPAEDKDLQLF 305

Query: 318 NRLGLIPDL 326
            +LGL P  
Sbjct: 306 RKLGLNPQQ 314


>gi|300992214|ref|ZP_07179823.1| biotin synthase [Escherichia coli MS 200-1]
 gi|300305377|gb|EFJ59897.1| biotin synthase [Escherichia coli MS 200-1]
 gi|324011079|gb|EGB80298.1| biotin synthase [Escherichia coli MS 60-1]
          Length = 338

 Score =  327 bits (837), Expect = 2e-87,   Method: Composition-based stats.
 Identities = 166/306 (54%), Positives = 227/306 (74%)

Query: 23  EVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQSVHNKSKL 82
           +V +++  P  DLLF +  VHR++F+P  +Q+S LL+IKTG CPE+C YC QS   K+ L
Sbjct: 3   QVTELFEKPLLDLLFEAQQVHRQHFDPRQVQVSTLLSIKTGACPEDCKYCPQSSRYKTGL 62

Query: 83  KASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLGLETCMT 142
           +A +L+ V+QVL+ A+ AK  G+TR+CMGAAW+ P+ERD+  +  M++GVK++GLE CMT
Sbjct: 63  EAERLMEVEQVLESARKAKAAGSTRFCMGAAWKNPRERDMPYLEQMVQGVKAMGLEACMT 122

Query: 143 LGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSGIKVCCG 202
           LG LS  QAQ L+ AGLDYYNHN+DTS  FY ++ TT T+++RL TLE VR++GIKVC G
Sbjct: 123 LGTLSESQAQRLANAGLDYYNHNLDTSPEFYGNIITTRTYQERLDTLEKVREAGIKVCSG 182

Query: 203 GILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEHVRIISVA 262
           GI+GLGE + DR  +LL LANL TPPES+PIN+L+ + G+   +N  VD  + +R I+VA
Sbjct: 183 GIVGLGETVKDRAGLLLQLANLPTPPESVPINMLVKVKGTPLADNDDVDAFDFIRTIAVA 242

Query: 263 RILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTILFNRLGL 322
           RI+MP S +RL+AGR  M+++ QA+CF +GANSIF G  LLT  NP  +KD  LF +LGL
Sbjct: 243 RIMMPTSYVRLSAGREQMNEQTQAMCFMAGANSIFYGCKLLTTPNPEEDKDLQLFRKLGL 302

Query: 323 IPDLSA 328
            P  +A
Sbjct: 303 NPQQTA 308


>gi|296103300|ref|YP_003613446.1| biotin synthase [Enterobacter cloacae subsp. cloacae ATCC 13047]
 gi|295057759|gb|ADF62497.1| biotin synthase [Enterobacter cloacae subsp. cloacae ATCC 13047]
          Length = 346

 Score =  327 bits (837), Expect = 2e-87,   Method: Composition-based stats.
 Identities = 167/310 (53%), Positives = 231/310 (74%)

Query: 18  VWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQSVH 77
            WT  +V +++N PF +L+F +  VHR++F+P H+Q+S LL+IKTG CPE+C YC QS  
Sbjct: 6   RWTMSQVTELFNKPFLELMFEAQQVHRQHFDPRHVQVSTLLSIKTGACPEDCKYCPQSAR 65

Query: 78  NKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLGL 137
            K+ L++ +L+ V+QVL+ A+ AK  G+TR+CMGAAW+ P +RD+  +  M+KGVK +GL
Sbjct: 66  YKTGLESERLMEVEQVLESARKAKNAGSTRFCMGAAWKNPHDRDMPYLEQMVKGVKEMGL 125

Query: 138 ETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSGI 197
           E CMTLG L+ EQAQ LS AGLDYYNHN+DTS  FY ++ TT T+++RL TL+ VR++GI
Sbjct: 126 EACMTLGTLNEEQAQRLSAAGLDYYNHNLDTSPEFYGNIITTRTYQERLDTLDKVREAGI 185

Query: 198 KVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEHVR 257
           KVC GGI+GLGE + DR  +LL LANL TPPES+PIN+L+ + G+   +N+ VD  + +R
Sbjct: 186 KVCSGGIVGLGETVKDRAGLLLQLANLPTPPESVPINMLVKVKGTPLADNEDVDAFDFIR 245

Query: 258 IISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTILF 317
            I+VARI+MP S +RL+AGR  M+++ QA+CF +GANSIF G  LLT  NP  +KD  LF
Sbjct: 246 TIAVARIMMPTSYVRLSAGREQMNEQTQAMCFMAGANSIFYGCKLLTTPNPEEDKDVQLF 305

Query: 318 NRLGLIPDLS 327
            +LGL P  +
Sbjct: 306 RKLGLNPHQT 315


>gi|300993250|ref|ZP_07180297.1| biotin synthase [Escherichia coli MS 45-1]
 gi|301051307|ref|ZP_07198133.1| biotin synthase [Escherichia coli MS 185-1]
 gi|300297066|gb|EFJ53451.1| biotin synthase [Escherichia coli MS 185-1]
 gi|300406658|gb|EFJ90196.1| biotin synthase [Escherichia coli MS 45-1]
 gi|315287200|gb|EFU46612.1| biotin synthase [Escherichia coli MS 110-3]
 gi|315292633|gb|EFU51985.1| biotin synthase [Escherichia coli MS 153-1]
 gi|315299294|gb|EFU58546.1| biotin synthase [Escherichia coli MS 16-3]
 gi|324009639|gb|EGB78858.1| biotin synthase [Escherichia coli MS 57-2]
          Length = 338

 Score =  327 bits (837), Expect = 2e-87,   Method: Composition-based stats.
 Identities = 166/306 (54%), Positives = 226/306 (73%)

Query: 23  EVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQSVHNKSKL 82
           +V +++  P  DLLF +  VHR++F+P  +Q+S LL+IKTG CPE+C YC QS   K+ L
Sbjct: 3   QVTELFEKPLLDLLFEAQQVHRQHFDPRQVQVSTLLSIKTGACPEDCKYCPQSSRYKTGL 62

Query: 83  KASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLGLETCMT 142
           +A +L+ V+QVL+ A+ AK  G+TR+CMGAAW+ P ERD+  +  M++GVK++GLE CMT
Sbjct: 63  EAERLMEVEQVLESARKAKAAGSTRFCMGAAWKNPHERDMPYLEQMVQGVKAMGLEACMT 122

Query: 143 LGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSGIKVCCG 202
           LG LS  QAQ L+ AGLDYYNHN+DTS  FY ++ TT T+++RL TLE VR++GIKVC G
Sbjct: 123 LGTLSESQAQRLANAGLDYYNHNLDTSPEFYGNIITTRTYQERLDTLEKVREAGIKVCSG 182

Query: 203 GILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEHVRIISVA 262
           GI+GLGE + DR  +LL LANL TPPES+PIN+L+ + G+   +N  VD  + +R I+VA
Sbjct: 183 GIVGLGETVKDRAGLLLQLANLPTPPESVPINMLVKVKGTPLADNDDVDAFDFIRTIAVA 242

Query: 263 RILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTILFNRLGL 322
           RI+MP S +RL+AGR  M+++ QA+CF +GANSIF G  LLT  NP  +KD  LF +LGL
Sbjct: 243 RIMMPTSYVRLSAGREQMNEQTQAMCFMAGANSIFYGCKLLTTPNPEEDKDLQLFRKLGL 302

Query: 323 IPDLSA 328
            P  +A
Sbjct: 303 NPQQTA 308


>gi|254784710|ref|YP_003072138.1| biotin synthase [Teredinibacter turnerae T7901]
 gi|237686766|gb|ACR14030.1| biotin synthase [Teredinibacter turnerae T7901]
          Length = 351

 Score =  327 bits (837), Expect = 2e-87,   Method: Composition-based stats.
 Identities = 166/310 (53%), Positives = 230/310 (74%)

Query: 16  PKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQS 75
              WT  EV  ++++PFNDL+F + +VHR+ F+PN +Q+S L +IKTG CPE+C YC QS
Sbjct: 9   RHNWTRAEVEALFDLPFNDLMFRAQSVHRQFFDPNEVQVSTLCSIKTGACPEDCAYCPQS 68

Query: 76  VHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSL 135
               + L+  KL+ V++VL+EA+ AK++GATR+CMGAAWR P +RD+  ++DM+KGVKS+
Sbjct: 69  SRYDTGLEREKLMAVEKVLEEARAAKDSGATRFCMGAAWRSPHQRDMKYVLDMVKGVKSM 128

Query: 136 GLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKS 195
           G+ETCMTLGML+ +QA  L  AGLDYYNHN+DTS  +Y  + TT T++DRL TLENVR +
Sbjct: 129 GMETCMTLGMLTADQALELKGAGLDYYNHNLDTSPEYYDCIITTRTYQDRLDTLENVRAA 188

Query: 196 GIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEH 255
           G+KVC GGI+G+GE   DR  +L  LAN+   PES+PIN+L+ + G+   E   +DP + 
Sbjct: 189 GMKVCAGGIVGMGEEQKDRAGLLTQLANMDQHPESVPINMLVRVAGTPLAEQADLDPFDF 248

Query: 256 VRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTI 315
           +R I+VARI+MP S +RL+AGR  M+D++Q+L F +GANSIF G+ LLT  NP  N+D  
Sbjct: 249 IRTIAVARIMMPASHVRLSAGREEMNDQMQSLAFLAGANSIFYGEKLLTTPNPEANEDMQ 308

Query: 316 LFNRLGLIPD 325
           LF RLG+ P+
Sbjct: 309 LFKRLGIRPE 318


>gi|148545643|ref|YP_001265745.1| biotin synthase [Pseudomonas putida F1]
 gi|254810782|sp|A5VXF1|BIOB_PSEP1 RecName: Full=Biotin synthase
 gi|148509701|gb|ABQ76561.1| biotin synthase [Pseudomonas putida F1]
          Length = 352

 Score =  326 bits (836), Expect = 2e-87,   Method: Composition-based stats.
 Identities = 167/313 (53%), Positives = 227/313 (72%)

Query: 13  TKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYC 72
                 W+  EV  ++  PFNDLLF + TVHR +F PN +Q+S LL+IKTG CPE+C YC
Sbjct: 7   ATTRHDWSLAEVKALFQQPFNDLLFQAQTVHRAHFNPNRVQVSTLLSIKTGACPEDCKYC 66

Query: 73  NQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGV 132
            QS H  + L+  KL+ V +VL+EA  AK  G+TR+CMGAAW+ P  +D+  +++M+KGV
Sbjct: 67  PQSGHYNTGLEKQKLMEVQKVLEEAARAKAIGSTRFCMGAAWKHPSAKDMPYVLEMVKGV 126

Query: 133 KSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENV 192
           K++GLETCMTLG L  EQ + L+ AGLDYYNHN+DTS  FY  + TT T+ +RLQTL  V
Sbjct: 127 KAMGLETCMTLGKLDQEQTKALAHAGLDYYNHNLDTSPEFYGSIITTRTYSERLQTLAYV 186

Query: 193 RKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDP 252
           R +G+K+C GGILG+GE +DDR  +L+ LANL   PES+PIN+L+ + G+   E + VDP
Sbjct: 187 RDAGMKICSGGILGMGESLDDRAGLLIQLANLPEHPESVPINMLVKVAGTPLAEEEDVDP 246

Query: 253 IEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNK 312
            + +R+++VARILMPKS +RL+AGR  M++++QAL F +GANSIF G+ LLT  NP  +K
Sbjct: 247 FDFIRMLAVARILMPKSHVRLSAGREQMNEQMQALAFMAGANSIFYGEKLLTTANPQADK 306

Query: 313 DTILFNRLGLIPD 325
           D  LF RLG+ P+
Sbjct: 307 DMQLFARLGIKPE 319


>gi|300816419|ref|ZP_07096641.1| biotin synthase [Escherichia coli MS 107-1]
 gi|300822942|ref|ZP_07103077.1| biotin synthase [Escherichia coli MS 119-7]
 gi|300898263|ref|ZP_07116614.1| biotin synthase [Escherichia coli MS 198-1]
 gi|300907101|ref|ZP_07124767.1| biotin synthase [Escherichia coli MS 84-1]
 gi|300922798|ref|ZP_07138885.1| biotin synthase [Escherichia coli MS 182-1]
 gi|300929423|ref|ZP_07144892.1| biotin synthase [Escherichia coli MS 187-1]
 gi|300939808|ref|ZP_07154446.1| biotin synthase [Escherichia coli MS 21-1]
 gi|300947145|ref|ZP_07161359.1| biotin synthase [Escherichia coli MS 116-1]
 gi|300957720|ref|ZP_07169908.1| biotin synthase [Escherichia coli MS 175-1]
 gi|301020734|ref|ZP_07184802.1| biotin synthase [Escherichia coli MS 69-1]
 gi|301304100|ref|ZP_07210217.1| biotin synthase [Escherichia coli MS 124-1]
 gi|301327967|ref|ZP_07221132.1| biotin synthase [Escherichia coli MS 78-1]
 gi|309797952|ref|ZP_07692331.1| biotin synthase [Escherichia coli MS 145-7]
 gi|300315588|gb|EFJ65372.1| biotin synthase [Escherichia coli MS 175-1]
 gi|300358052|gb|EFJ73922.1| biotin synthase [Escherichia coli MS 198-1]
 gi|300398545|gb|EFJ82083.1| biotin synthase [Escherichia coli MS 69-1]
 gi|300401146|gb|EFJ84684.1| biotin synthase [Escherichia coli MS 84-1]
 gi|300420902|gb|EFK04213.1| biotin synthase [Escherichia coli MS 182-1]
 gi|300453223|gb|EFK16843.1| biotin synthase [Escherichia coli MS 116-1]
 gi|300455340|gb|EFK18833.1| biotin synthase [Escherichia coli MS 21-1]
 gi|300462623|gb|EFK26116.1| biotin synthase [Escherichia coli MS 187-1]
 gi|300524483|gb|EFK45552.1| biotin synthase [Escherichia coli MS 119-7]
 gi|300531109|gb|EFK52171.1| biotin synthase [Escherichia coli MS 107-1]
 gi|300840707|gb|EFK68467.1| biotin synthase [Escherichia coli MS 124-1]
 gi|300845532|gb|EFK73292.1| biotin synthase [Escherichia coli MS 78-1]
 gi|308118440|gb|EFO55702.1| biotin synthase [Escherichia coli MS 145-7]
 gi|315257761|gb|EFU37729.1| biotin synthase [Escherichia coli MS 85-1]
 gi|324018553|gb|EGB87772.1| biotin synthase [Escherichia coli MS 117-3]
          Length = 338

 Score =  326 bits (836), Expect = 2e-87,   Method: Composition-based stats.
 Identities = 166/306 (54%), Positives = 225/306 (73%)

Query: 23  EVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQSVHNKSKL 82
           +V +++  P  DLLF +  VHR++F+P  +Q+S LL+IKTG CPE+C YC QS   K+ L
Sbjct: 3   QVTELFEKPLLDLLFEAQQVHRQHFDPRQVQVSTLLSIKTGACPEDCKYCPQSSRYKTGL 62

Query: 83  KASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLGLETCMT 142
           +A +L+ V+QVL+ A+ AK  G+TR+CMGAAW+ P ERD+  +  M++GVK++GLE CMT
Sbjct: 63  EAERLMEVEQVLESARKAKAAGSTRFCMGAAWKNPHERDMPYLEQMVQGVKAMGLEACMT 122

Query: 143 LGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSGIKVCCG 202
           LG LS  QAQ L+ AGLDYYNHN+DTS  FY ++ TT T+++RL TLE VR +GIKVC G
Sbjct: 123 LGTLSESQAQRLANAGLDYYNHNLDTSPEFYGNIITTRTYQERLDTLEKVRDAGIKVCSG 182

Query: 203 GILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEHVRIISVA 262
           GI+GLGE + DR  +LL LANL TPPES+PIN+L+ + G+   +N  VD  + +R I+VA
Sbjct: 183 GIVGLGETVKDRAGLLLQLANLPTPPESVPINMLVKVKGTPLADNDDVDAFDFIRTIAVA 242

Query: 263 RILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTILFNRLGL 322
           RI+MP S +RL+AGR  M+++ QA+CF +GANSIF G  LLT  NP  +KD  LF +LGL
Sbjct: 243 RIMMPTSYVRLSAGREQMNEQTQAMCFMAGANSIFYGCKLLTTPNPEEDKDLQLFRKLGL 302

Query: 323 IPDLSA 328
            P  +A
Sbjct: 303 NPQQTA 308


>gi|117618103|ref|YP_856027.1| biotin synthase [Aeromonas hydrophila subsp. hydrophila ATCC 7966]
 gi|254810542|sp|A0KIC6|BIOB_AERHH RecName: Full=Biotin synthase
 gi|117559510|gb|ABK36458.1| biotin synthase [Aeromonas hydrophila subsp. hydrophila ATCC 7966]
          Length = 362

 Score =  326 bits (836), Expect = 2e-87,   Method: Composition-based stats.
 Identities = 168/313 (53%), Positives = 226/313 (72%)

Query: 16  PKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQS 75
              WT  EV  ++ +PFNDLLF + TVHR +F+PN +Q+S LL+IKTG CPE+C YC QS
Sbjct: 12  RHDWTLAEVQALFALPFNDLLFQAQTVHRAHFDPNEVQVSTLLSIKTGACPEDCKYCPQS 71

Query: 76  VHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSL 135
               + L+A +L+ V++VL+ A+ AK NG++R+CMGAAWR PKE+D+  I+ MI+ V+ L
Sbjct: 72  ARYHTGLEAERLMEVEKVLERAREAKANGSSRFCMGAAWRNPKEKDMPYILRMIEEVRGL 131

Query: 136 GLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKS 195
           G+ETCMTLGML+ +QA  L  AGLDYYNHN+DTS  FY  + TT T++DRL TL  VR +
Sbjct: 132 GMETCMTLGMLTADQAARLGAAGLDYYNHNLDTSPEFYGDIITTRTYQDRLDTLAYVRGA 191

Query: 196 GIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEH 255
           G+KVC GGI+G+GE   DR  +L+ LANL   PES+PIN+L+ + G+  E  + +DP E 
Sbjct: 192 GMKVCSGGIVGMGEQAKDRAGLLMALANLPRHPESVPINMLVKVKGTPLENQENLDPFEF 251

Query: 256 VRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTI 315
           +R I+VARI+MP S +RL+AGR  M++++QA+CF +GANSIF G  LLT  NP  N D  
Sbjct: 252 IRTIAVARIMMPASHVRLSAGREKMNEQMQAMCFMAGANSIFYGCKLLTTPNPDENSDMQ 311

Query: 316 LFNRLGLIPDLSA 328
           LF RLG+ P   A
Sbjct: 312 LFKRLGIRPAQRA 324


>gi|307544760|ref|YP_003897239.1| biotin synthase [Halomonas elongata DSM 2581]
 gi|307216784|emb|CBV42054.1| biotin synthase [Halomonas elongata DSM 2581]
          Length = 370

 Score =  326 bits (835), Expect = 3e-87,   Method: Composition-based stats.
 Identities = 164/313 (52%), Positives = 228/313 (72%)

Query: 14  KKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCN 73
           +    W  +E+  ++++PFNDLLF +  VHR +F+PN +Q+S LL+IKTG CPE+C YC 
Sbjct: 20  EPRHDWRLEEIEALFSLPFNDLLFRAQQVHRAHFDPNAVQVSTLLSIKTGACPEDCKYCP 79

Query: 74  QSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVK 133
           QS H  + L   KL+ V++V+++A+ AK+ GA+R+CMGAAWR P+ERDL ++++M+  VK
Sbjct: 80  QSGHYNTGLGKEKLLEVEKVVEQARAAKQAGASRFCMGAAWRSPRERDLDVVLEMVGRVK 139

Query: 134 SLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVR 193
            LGLETCMTLGM+   QA  L++AGLDYYNHN+DTS  +Y  + TT ++ DRL TL NVR
Sbjct: 140 ELGLETCMTLGMVDAHQASRLAEAGLDYYNHNLDTSPEYYGEIITTRSYADRLDTLSNVR 199

Query: 194 KSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPI 253
            +G+K+C GGILG+GE   DR  +L  LA L+  PES+PIN+L+ +PG+  E  + +DP+
Sbjct: 200 DAGMKICSGGILGMGEATRDRAGLLQQLARLNPHPESVPINMLVKVPGTPMENVEDLDPL 259

Query: 254 EHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKD 313
           E +R I+VARILMP S +RL+AGR  M +  QA+ F +GANSIF GDTLLT  NP   +D
Sbjct: 260 EFIRAIAVARILMPASHVRLSAGREQMDESTQAMAFLAGANSIFYGDTLLTTGNPQVERD 319

Query: 314 TILFNRLGLIPDL 326
             LF++LGL P+ 
Sbjct: 320 RALFDKLGLHPEQ 332


>gi|88859215|ref|ZP_01133855.1| biotin synthase; contains an iron-sulfur cluster and PLP
           [Pseudoalteromonas tunicata D2]
 gi|88818232|gb|EAR28047.1| biotin synthase; contains an iron-sulfur cluster and PLP
           [Pseudoalteromonas tunicata D2]
          Length = 347

 Score =  326 bits (835), Expect = 3e-87,   Method: Composition-based stats.
 Identities = 165/310 (53%), Positives = 231/310 (74%)

Query: 16  PKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQS 75
              WT  +V +++  PFNDLLF + +VHR+NF+PN +Q+S LL+IKTG CPE+C YC QS
Sbjct: 7   RHDWTLSQVKELFEQPFNDLLFQAASVHRQNFKPNEVQISTLLSIKTGACPEDCKYCPQS 66

Query: 76  VHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSL 135
            H K+ L+  +L+ V++V+++AK AK+ GATR+CMGAAW +PK+RD+  I  M+KGVK L
Sbjct: 67  GHYKTDLERERLMEVEKVIEQAKLAKDKGATRFCMGAAWSDPKDRDMPYIEQMVKGVKEL 126

Query: 136 GLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKS 195
           GLETCMTLGML   +A  L  AGLDYYNHN+DTS  +Y  + TT T++DRL T+++VR +
Sbjct: 127 GLETCMTLGMLDNHKAHALKSAGLDYYNHNLDTSAEYYEQIITTRTYQDRLDTIDHVRDA 186

Query: 196 GIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEH 255
           G+KVC GGI+G+GE   DR  +L++LANL   PES+PIN+L+ + G+  E    +D  E 
Sbjct: 187 GMKVCSGGIVGMGEEAKDRFGLLMSLANLPQQPESVPINMLVKVKGTPLENVDDLDHFEF 246

Query: 256 VRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTI 315
           +R I+VARI+MPKS +RL+AGR  M++++Q++CFF+GANSIF GD LLT +NP  + D  
Sbjct: 247 IRTIAVARIMMPKSYVRLSAGRTAMNEQMQSMCFFAGANSIFYGDKLLTTENPEADADMQ 306

Query: 316 LFNRLGLIPD 325
           L  +LG+ P+
Sbjct: 307 LLKKLGMKPE 316


>gi|154250492|ref|YP_001411316.1| biotin synthase [Parvibaculum lavamentivorans DS-1]
 gi|154154442|gb|ABS61659.1| biotin synthase [Parvibaculum lavamentivorans DS-1]
          Length = 368

 Score =  326 bits (835), Expect = 3e-87,   Method: Composition-based stats.
 Identities = 182/322 (56%), Positives = 247/322 (76%)

Query: 2   SRSTVVPEENPTKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIK 61
           +R  V    +P      WT +E+  ++++PFNDLLF +  VHR+ F+ + +Q+S LL+IK
Sbjct: 27  TRDIVTARTDPGALRHDWTREELQALFDLPFNDLLFEAQLVHRRWFKADEVQMSTLLSIK 86

Query: 62  TGGCPENCGYCNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERD 121
           TGGCPE+CGYC QS    + LKASKL+ V++VL EA+ AKE GATRYCMGAAWREPK+RD
Sbjct: 87  TGGCPEDCGYCAQSSKFDTGLKASKLMEVEKVLAEARKAKEAGATRYCMGAAWREPKDRD 146

Query: 122 LSIIVDMIKGVKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHT 181
           + ++  M++G+K +G+ETCMTLGMLS +Q   L+++GLDYYNHNIDTSE +YP V +T T
Sbjct: 147 MDMVCAMVEGIKDMGMETCMTLGMLSGQQVHRLAQSGLDYYNHNIDTSEEYYPKVISTRT 206

Query: 182 FEDRLQTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPG 241
           ++DRL+TLE VR +GI VC GGI+G+GE   DRI ML+TLANL   P+S+PIN+L+P+ G
Sbjct: 207 YQDRLETLERVRNAGINVCSGGIVGMGESPSDRIGMLMTLANLEEHPQSVPINMLMPVEG 266

Query: 242 SKFEENKKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDT 301
           +    ++K+DPI+ VR+I+VARI MP+S +RL+AGR  MS+E QALCF +GANSIF+G+ 
Sbjct: 267 TALGASEKIDPIDFVRLIAVARIAMPQSVVRLSAGREHMSEETQALCFLAGANSIFIGEK 326

Query: 302 LLTAKNPSYNKDTILFNRLGLI 323
           LLT KNP  +KD  LF +LG+ 
Sbjct: 327 LLTTKNPEADKDQRLFAKLGIR 348


>gi|308049086|ref|YP_003912652.1| biotin synthase [Ferrimonas balearica DSM 9799]
 gi|307631276|gb|ADN75578.1| biotin synthase [Ferrimonas balearica DSM 9799]
          Length = 341

 Score =  326 bits (835), Expect = 3e-87,   Method: Composition-based stats.
 Identities = 171/316 (54%), Positives = 234/316 (74%)

Query: 13  TKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYC 72
                 W  +EV  +   P NDLLF + TVHR++F+PN +Q+S+LL+IKTG CPE+C YC
Sbjct: 2   APIRHDWQLEEVQALLAKPLNDLLFEAQTVHRQHFDPNQVQISRLLSIKTGACPEDCKYC 61

Query: 73  NQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGV 132
            QS    + L+  +L+ V++VL EA+ A++ GA+R+CMGAAWR P+ERD+  ++ M++ V
Sbjct: 62  PQSARYHTGLETEQLLEVEKVLTEARAARDAGASRFCMGAAWRNPRERDMPYLLQMVREV 121

Query: 133 KSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENV 192
           KS+G+ETCMTLGMLS EQA+ L++AGLDYYNHN+DTS  FY  + +T +++DRL TL+NV
Sbjct: 122 KSMGMETCMTLGMLSSEQAEALAQAGLDYYNHNLDTSPEFYGEIISTRSYDDRLNTLDNV 181

Query: 193 RKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDP 252
           RK+G+KVC GGILG+GE   DR  +L+ LAN+   PES+PIN+L+ + G+   E   +DP
Sbjct: 182 RKAGMKVCSGGILGMGEQASDRAGLLVQLANMEKHPESVPINMLVKVAGTPMAEQDDLDP 241

Query: 253 IEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNK 312
           IE VR I+VARI+MP+S +RL+AGR  M++ELQA+CFF+GANSIF G  LLT  NP  N 
Sbjct: 242 IEFVRAIAVARIMMPQSHVRLSAGRENMTEELQAMCFFAGANSIFYGCKLLTTANPKENS 301

Query: 313 DTILFNRLGLIPDLSA 328
           D  LF +LGL P+  A
Sbjct: 302 DMALFAKLGLRPEQGA 317


>gi|315126656|ref|YP_004068659.1| biotin synthase; contains an iron-sulfur cluster and PLP
           [Pseudoalteromonas sp. SM9913]
 gi|315015170|gb|ADT68508.1| biotin synthase; contains an iron-sulfur cluster and PLP
           [Pseudoalteromonas sp. SM9913]
          Length = 346

 Score =  326 bits (835), Expect = 3e-87,   Method: Composition-based stats.
 Identities = 166/312 (53%), Positives = 229/312 (73%)

Query: 16  PKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQS 75
              WT +EV  ++ MPFNDLLF + +VHR NF PN +Q+S LL+IKTG CPE+C YC QS
Sbjct: 7   RHDWTHQEVKALFEMPFNDLLFKAASVHRANFNPNEVQISTLLSIKTGACPEDCKYCPQS 66

Query: 76  VHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSL 135
            H K+ L+  +LI V++V+++A+ AK+ GATR+CMGAAW +PK+RD+  I  M+K VK+L
Sbjct: 67  GHYKTDLERERLIEVEKVVEQARLAKQKGATRFCMGAAWSDPKDRDMPYISQMVKEVKAL 126

Query: 136 GLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKS 195
           GLETCMTLGML+ E+A  L  AGLDYYNHN+DTS  +Y  + +T TF+DRL T+ NVR +
Sbjct: 127 GLETCMTLGMLNNEKAHELRSAGLDYYNHNLDTSPEYYEQIISTRTFQDRLDTIGNVRDA 186

Query: 196 GIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEH 255
           G+KVC GGI+G+GE   DR  +L+ LANL   PES+PIN+L+ + G+  E    +D  E 
Sbjct: 187 GMKVCSGGIVGMGEQASDRYGLLMQLANLPQQPESVPINMLVKVKGTPLENVDDLDQFEF 246

Query: 256 VRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTI 315
           +R I+ ARI+MP S +RL+AGR  M++++Q++CFF+GANSIF GD LLT +NP  + D  
Sbjct: 247 IRTIATARIMMPHSYVRLSAGRTAMNEQMQSMCFFAGANSIFYGDKLLTTENPEADADMQ 306

Query: 316 LFNRLGLIPDLS 327
           L  +LG+ P+ +
Sbjct: 307 LIKKLGMNPETA 318


>gi|292487691|ref|YP_003530564.1| biotin synthetase [Erwinia amylovora CFBP1430]
 gi|292898928|ref|YP_003538297.1| biotin synthase [Erwinia amylovora ATCC 49946]
 gi|291198776|emb|CBJ45885.1| biotin synthase [Erwinia amylovora ATCC 49946]
 gi|291553111|emb|CBA20156.1| biotin synthetase [Erwinia amylovora CFBP1430]
          Length = 343

 Score =  326 bits (835), Expect = 3e-87,   Method: Composition-based stats.
 Identities = 160/310 (51%), Positives = 226/310 (72%)

Query: 18  VWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQSVH 77
            WT  +   ++  PF +L+F +   HR++F+P  +Q+S LL+IKTG CPE+C YC QS  
Sbjct: 4   RWTLSQAQALFEQPFLELMFEAQQTHRQHFDPRQVQVSTLLSIKTGACPEDCKYCPQSAR 63

Query: 78  NKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLGL 137
            K+ L+A +L+ V++VL  A+ AK  G+ R+CMGAAW+ P ERD+  +  M++GVK++G+
Sbjct: 64  YKTGLEAERLMEVEEVLSSARKAKAAGSGRFCMGAAWKNPHERDMPHLEKMVQGVKAMGM 123

Query: 138 ETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSGI 197
           ETCMTLG LS +QAQ L+ AGLD+YNHN+DTS  FY  + TT ++++RL TL  VR++GI
Sbjct: 124 ETCMTLGSLSQQQAQRLAHAGLDFYNHNLDTSPEFYGSIITTRSYQERLDTLGKVREAGI 183

Query: 198 KVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEHVR 257
           KVC GGI+GLGE + DR  +L+ LANL  PPES+PIN+L+ + G+   +N  VDP + VR
Sbjct: 184 KVCSGGIVGLGETVQDRAGLLVQLANLPEPPESVPINMLVKVKGTPLADNDDVDPFDFVR 243

Query: 258 IISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTILF 317
            I+VARI+MP+S +RL+AGR  MS++ QA+CF +GAN+IF G  LLT  NP+ +KD +LF
Sbjct: 244 TIAVARIMMPRSHVRLSAGREQMSEQTQAMCFMAGANAIFYGCKLLTTPNPAEDKDLLLF 303

Query: 318 NRLGLIPDLS 327
            +LGL P  S
Sbjct: 304 RKLGLNPQHS 313


>gi|152969357|ref|YP_001334466.1| biotin synthesis protein [Klebsiella pneumoniae subsp. pneumoniae
           MGH 78578]
 gi|262041147|ref|ZP_06014364.1| biotin synthase [Klebsiella pneumoniae subsp. rhinoscleromatis ATCC
           13884]
 gi|330014550|ref|ZP_08307938.1| biotin synthase [Klebsiella sp. MS 92-3]
 gi|150954206|gb|ABR76236.1| biotin synthesis, sulfur insertion? [Klebsiella pneumoniae subsp.
           pneumoniae MGH 78578]
 gi|259041521|gb|EEW42575.1| biotin synthase [Klebsiella pneumoniae subsp. rhinoscleromatis ATCC
           13884]
 gi|328532998|gb|EGF59774.1| biotin synthase [Klebsiella sp. MS 92-3]
          Length = 338

 Score =  326 bits (835), Expect = 3e-87,   Method: Composition-based stats.
 Identities = 163/306 (53%), Positives = 228/306 (74%)

Query: 23  EVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQSVHNKSKL 82
           +V +++N P  DLLF +  +HR++F+P  +Q+S LL+IKTG CPE+C YC QS   K+ L
Sbjct: 3   QVTELFNKPLIDLLFEAQQIHRQHFDPRQVQVSTLLSIKTGACPEDCKYCPQSARYKTGL 62

Query: 83  KASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLGLETCMT 142
           +A +L+ V+QVL+ A+ AK  G+TR+CMGAAW+ P +RD+  +  M+KGVK+LGLE+CMT
Sbjct: 63  EAERLMEVEQVLESARQAKNAGSTRFCMGAAWKNPNDRDMPYLEQMVKGVKALGLESCMT 122

Query: 143 LGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSGIKVCCG 202
           LG L+  QAQ L++AGLDYYNHN+DTS  FY ++ TT T+++RL TL+ VR +GIKVC G
Sbjct: 123 LGTLTDSQAQRLAEAGLDYYNHNLDTSPEFYGNIITTRTYQERLDTLDKVRDAGIKVCSG 182

Query: 203 GILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEHVRIISVA 262
           GI+GLGE + DR  +LL LANL TPPES+PIN+L+ + G+   +N  VD  + +R I++A
Sbjct: 183 GIVGLGESVKDRAGLLLQLANLPTPPESVPINMLVKVKGTPLADNDDVDAFDFIRTIAIA 242

Query: 263 RILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTILFNRLGL 322
           RI+MP S +RL+AGR  M+++ QA+CF +GANSIF G  LLT  NP  +KD  LF +LG+
Sbjct: 243 RIMMPTSYVRLSAGREQMNEQTQAMCFMAGANSIFYGCKLLTTPNPEEDKDLQLFRKLGI 302

Query: 323 IPDLSA 328
            P  +A
Sbjct: 303 NPQQTA 308


>gi|163752223|ref|ZP_02159425.1| biotin synthase [Shewanella benthica KT99]
 gi|161327904|gb|EDP99082.1| biotin synthase [Shewanella benthica KT99]
          Length = 354

 Score =  326 bits (835), Expect = 3e-87,   Method: Composition-based stats.
 Identities = 169/314 (53%), Positives = 231/314 (73%)

Query: 13  TKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYC 72
            +    W   E+ +++++P NDLLF +H++HR+ F+PN +Q+S+LL+IKTG CPE+C YC
Sbjct: 4   VQLRHDWQLDEITELFDLPMNDLLFKAHSLHRQVFDPNEVQISRLLSIKTGACPEDCKYC 63

Query: 73  NQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGV 132
            QS    + L+  +LI +D+VL EA++AK  GA+R+CMGAAWR P  RD+  + DM++ V
Sbjct: 64  PQSARYDTGLEKERLIEIDKVLTEARSAKAAGASRFCMGAAWRNPHPRDMPYLKDMVREV 123

Query: 133 KSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENV 192
           + +G+ETCMTLGMLS EQA  L++AGLDYYNHN+DTS  +Y  + TT T++DRL TL NV
Sbjct: 124 RGMGMETCMTLGMLSPEQASELAEAGLDYYNHNLDTSPEYYGDIITTRTYQDRLDTLSNV 183

Query: 193 RKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDP 252
           R +G+KVC GGI+G+GE   DR  +L  LAN+   PES+PIN+L+ + G+ FE    +DP
Sbjct: 184 RAAGMKVCSGGIVGMGEQASDRAGLLQQLANMEQHPESVPINMLVKVAGTPFENIDDLDP 243

Query: 253 IEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNK 312
           +  VR I+VARILMP +R+RL+AGR  MSDE+QA+CFF+GANSIF G  LLT  NP  N+
Sbjct: 244 LVFVRTIAVARILMPYARVRLSAGREKMSDEMQAMCFFAGANSIFYGCKLLTTNNPEENE 303

Query: 313 DTILFNRLGLIPDL 326
           D  LF RLGL P+ 
Sbjct: 304 DMALFKRLGLHPEQ 317


>gi|253990415|ref|YP_003041771.1| biotin synthetase [Photorhabdus asymbiotica subsp. asymbiotica ATCC
           43949]
 gi|253781865|emb|CAQ85028.1| biotin synthetase (biotin synthase) [Photorhabdus asymbiotica]
          Length = 345

 Score =  326 bits (835), Expect = 4e-87,   Method: Composition-based stats.
 Identities = 167/313 (53%), Positives = 230/313 (73%)

Query: 15  KPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQ 74
           + K WT K+  +++  PF +LLF +  VHR +F+P  +Q+S LL+IKTG CPE+C YC Q
Sbjct: 3   ERKQWTIKQAQELFGKPFFELLFQAQQVHRMHFDPQQVQVSTLLSIKTGACPEDCKYCPQ 62

Query: 75  SVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKS 134
           S   K+ L+  +L+ V+QV+  A+ AK  G+TR+CMGAAW+ P ERD+  +  M+K VK+
Sbjct: 63  SSRYKTGLEKERLMEVEQVIDSARKAKNAGSTRFCMGAAWKNPHERDMPYLEKMVKEVKA 122

Query: 135 LGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRK 194
           LG+ETCMTLGML+  QAQ L+ AGLDYYNHN+DTS  FY ++ TT T++DRL TL+NVR 
Sbjct: 123 LGMETCMTLGMLNGSQAQRLADAGLDYYNHNLDTSPEFYGNIITTRTYQDRLDTLDNVRD 182

Query: 195 SGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIE 254
           +GIKVC GGI+GLGE I DR  +L+ LANL  PPES+PIN+L+ + G+   +N+ VDP +
Sbjct: 183 AGIKVCSGGIVGLGEEIRDRAALLVQLANLPKPPESVPINMLVKVKGTPLADNEDVDPFD 242

Query: 255 HVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDT 314
            +R I+VARI+MP S +RL+AGR  M+++ QA+CF +GANSIF G  LLT  NP+ +KD 
Sbjct: 243 FIRTIAVARIMMPASHVRLSAGREQMNEQTQAMCFMAGANSIFYGCKLLTTPNPAEDKDL 302

Query: 315 ILFNRLGLIPDLS 327
            LF +LG+ P  +
Sbjct: 303 QLFRKLGINPQQT 315


>gi|269102872|ref|ZP_06155569.1| biotin synthase [Photobacterium damselae subsp. damselae CIP
           102761]
 gi|268162770|gb|EEZ41266.1| biotin synthase [Photobacterium damselae subsp. damselae CIP
           102761]
          Length = 350

 Score =  326 bits (835), Expect = 4e-87,   Method: Composition-based stats.
 Identities = 168/315 (53%), Positives = 237/315 (75%)

Query: 14  KKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCN 73
           +    W  +EV Q+ + PF DLLF +  VHR+  +PN +Q+S LL+IKTG CPE+C YC 
Sbjct: 2   EARHNWNVEEVQQLLDQPFMDLLFQAQQVHRQYHDPNQVQVSTLLSIKTGACPEDCKYCP 61

Query: 74  QSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVK 133
           QS H ++ ++  +L+ V+QVL  A+ AKE+GATR+CMGAAW+ PK RD+  ++DMIKGVK
Sbjct: 62  QSAHYRTDVERERLMEVEQVLTAAQKAKESGATRFCMGAAWKNPKSRDMPYLLDMIKGVK 121

Query: 134 SLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVR 193
           SLGLETCMTLGML+ EQA IL+ AGLDYYNHN+DTS  +Y ++ TT T++DRL TL++VR
Sbjct: 122 SLGLETCMTLGMLTPEQANILADAGLDYYNHNLDTSPEYYGNIITTRTYQDRLDTLDHVR 181

Query: 194 KSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPI 253
           ++G+K+C GGI+G+GE   DR  +L+ LANL   PES+PIN+L+ + G+  E+ + V+P 
Sbjct: 182 QAGMKICSGGIIGMGESHRDRAGLLVELANLPVHPESVPINMLVKVKGTPLEQEEDVEPF 241

Query: 254 EHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKD 313
           + +R+I+VARI+MP+S +RL+AGR  M++++QA+CF +GANSIF G  LLT  NP  +KD
Sbjct: 242 DFIRMIAVARIMMPQSAVRLSAGREQMNEQMQAMCFMAGANSIFYGCKLLTTPNPKEDKD 301

Query: 314 TILFNRLGLIPDLSA 328
            +LF +LG+     A
Sbjct: 302 MVLFEKLGINRQQQA 316


>gi|319788563|ref|YP_004148038.1| biotin synthase [Pseudoxanthomonas suwonensis 11-1]
 gi|317467075|gb|ADV28807.1| biotin synthase [Pseudoxanthomonas suwonensis 11-1]
          Length = 344

 Score =  325 bits (834), Expect = 4e-87,   Method: Composition-based stats.
 Identities = 163/313 (52%), Positives = 225/313 (71%)

Query: 13  TKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYC 72
           ++    W  +E+  ++ +P  +LL+ +  VHR++F+P  +Q+S LL++KTGGCPE+CGYC
Sbjct: 3   SEIRHDWRREELLALFGLPLPELLYRAAQVHREHFDPAEVQVSTLLSVKTGGCPEDCGYC 62

Query: 73  NQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGV 132
            Q+    + ++A+KL++   VL++A+ AK  GA+R+CMGAAWR PK+RD+  +  MI GV
Sbjct: 63  PQAQRYHTGVQATKLMDTGAVLEKARQAKAAGASRFCMGAAWRSPKDRDIPKVAAMIAGV 122

Query: 133 KSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENV 192
           K+LGLETC TLGMLS  QAQ L  AGLDYYNHN+DT+  FY  V  T  ++DRL TLE+V
Sbjct: 123 KALGLETCATLGMLSPGQAQALRDAGLDYYNHNLDTAPEFYGDVIRTREYQDRLDTLEHV 182

Query: 193 RKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDP 252
           R++G+K CCGGI+G+GE  + R  +L  LANL   P+S+PIN L+ +PG+     + +DP
Sbjct: 183 REAGLKTCCGGIVGMGETREQRAGLLQALANLPAHPDSVPINQLVQVPGTPLAGVEPLDP 242

Query: 253 IEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNK 312
            E VR I+VARI MP+S +RL+AGR  MSDELQA+CF +GANSIF G+ LLT  NP+  +
Sbjct: 243 FEFVRTIAVARITMPRSMVRLSAGREAMSDELQAMCFMAGANSIFYGEQLLTTANPAAER 302

Query: 313 DTILFNRLGLIPD 325
           D  LF RLGL P 
Sbjct: 303 DRALFARLGLRPM 315


>gi|325923496|ref|ZP_08185149.1| biotin synthase [Xanthomonas gardneri ATCC 19865]
 gi|325546024|gb|EGD17225.1| biotin synthase [Xanthomonas gardneri ATCC 19865]
          Length = 361

 Score =  325 bits (834), Expect = 4e-87,   Method: Composition-based stats.
 Identities = 159/311 (51%), Positives = 220/311 (70%)

Query: 16  PKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQS 75
              W  KE+  ++++PF +LL  + +VHR +F+P  +Q+S LL++KTGGCPE+C YC Q+
Sbjct: 23  RHDWDRKELQALFDLPFPELLHRAASVHRAHFDPAEVQVSTLLSVKTGGCPEDCAYCPQA 82

Query: 76  VHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSL 135
               + + A KL+  ++V+ +A+ AK  GA+R+CMGAAWR PKERD+  +  MI+ VK++
Sbjct: 83  QRYDTGVTAQKLMETEEVVAKARQAKAAGASRFCMGAAWRSPKERDIPKVAAMIREVKAM 142

Query: 136 GLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKS 195
           GLETC TLGML   QA+ L  AGLDYYNHN+DT+  +Y  +  T  ++DRL TLE+VR  
Sbjct: 143 GLETCATLGMLDAGQARALKDAGLDYYNHNLDTAPDYYDSIIHTRQYQDRLNTLEHVRDV 202

Query: 196 GIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEH 255
           G+K CCGGI+G+GE  + R+ +LL LA L + P+S+PIN L+ + G+     +++DP E 
Sbjct: 203 GLKTCCGGIVGMGETREHRVGLLLALATLPSHPDSVPINQLVQVAGTPLHGTQQLDPFEF 262

Query: 256 VRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTI 315
           VR+I+VARI MPKS +RL+AGR  MSDELQALCF +GANSIF G+ LLT  NP   +D  
Sbjct: 263 VRMIAVARIAMPKSMVRLSAGREAMSDELQALCFLAGANSIFYGEKLLTTGNPDTERDQA 322

Query: 316 LFNRLGLIPDL 326
           LF RLGL P  
Sbjct: 323 LFQRLGLRPMQ 333


>gi|326796483|ref|YP_004314303.1| Biotin synthase [Marinomonas mediterranea MMB-1]
 gi|326547247|gb|ADZ92467.1| Biotin synthase [Marinomonas mediterranea MMB-1]
          Length = 351

 Score =  325 bits (834), Expect = 4e-87,   Method: Composition-based stats.
 Identities = 160/309 (51%), Positives = 232/309 (75%)

Query: 18  VWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQSVH 77
            WTS E+  ++++PF DLLF + +VHR+NF+PN +Q+S LL+IKTG CPE+C YC QS H
Sbjct: 12  DWTSAEIQALFDLPFMDLLFKAQSVHRENFKPNQVQVSTLLSIKTGACPEDCKYCPQSGH 71

Query: 78  NKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLGL 137
             ++L+  KL+ V +VL+EAK AK+ GATR+CMGAAW+ P ++D   +++M+KGVK+LGL
Sbjct: 72  YNTELEKEKLMEVQKVLEEAKAAKDKGATRFCMGAAWKHPSKKDFPYVLEMVKGVKNLGL 131

Query: 138 ETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSGI 197
           E+C+TLG L+ +QA+ LS AGLDYYNHN+DTS  +Y  + +T ++++RL TL  VR SGI
Sbjct: 132 ESCVTLGTLTDDQAKELSGAGLDYYNHNLDTSPEYYDSIISTRSYQERLDTLSRVRDSGI 191

Query: 198 KVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEHVR 257
           K+CCGGI+G+GE   DR+ +L  L+ ++  PES+PIN+L+ + G+  E    +D  + +R
Sbjct: 192 KLCCGGIMGMGEEQKDRVGLLRQLSLMTPHPESVPINMLVKVAGTPLENVDDLDEFDFIR 251

Query: 258 IISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTILF 317
            I+VARI+MP S +RL+AGR  MS++ QALCF +GANSIF G+ LLT  NP  ++D +LF
Sbjct: 252 TIAVARIIMPTSHVRLSAGRQSMSEQTQALCFMAGANSIFYGEKLLTTDNPEADQDRMLF 311

Query: 318 NRLGLIPDL 326
            +LG+ P+ 
Sbjct: 312 KKLGINPEQ 320


>gi|68347277|gb|AAY94883.1| biotin synthetase [Pseudomonas fluorescens Pf-5]
          Length = 385

 Score =  325 bits (834), Expect = 4e-87,   Method: Composition-based stats.
 Identities = 168/310 (54%), Positives = 231/310 (74%)

Query: 16  PKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQS 75
              WT  EV  ++  PFNDLLF + TVHR +F+ N +Q+S LL+IKTG CPE+C YC QS
Sbjct: 44  RHDWTLAEVKALFVQPFNDLLFQAQTVHRAHFDANRVQVSTLLSIKTGACPEDCKYCPQS 103

Query: 76  VHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSL 135
            H  + L+  KL+ V +VL+EA  AK  G+TR+CMGAAW+ P  +D+  +++M+KGVK++
Sbjct: 104 GHYNTGLEKEKLLEVQKVLEEAARAKAIGSTRFCMGAAWKHPSAKDMPYVLEMVKGVKAM 163

Query: 136 GLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKS 195
           GLETCMTLG L  +Q + L+KAGLDYYNHN+DTS  FY ++ TT T+ +RLQTL  VR +
Sbjct: 164 GLETCMTLGRLDQDQTEALAKAGLDYYNHNLDTSPEFYGNIITTRTYSERLQTLAYVRDA 223

Query: 196 GIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEH 255
           G+K+C GGILG+GE +DDR  +L+ LANL   PES+PIN+L+ + G+  E  ++VDP + 
Sbjct: 224 GMKICSGGILGMGESLDDRAGLLIQLANLPEHPESVPINMLVKVAGTPLENAEEVDPFDF 283

Query: 256 VRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTI 315
           +R+++VARILMP+S +RL+AGR  M++++QAL FF+GANSIF GD LLT  NP  +KD  
Sbjct: 284 IRMLAVARILMPQSHVRLSAGREAMNEQMQALAFFAGANSIFYGDKLLTTANPQADKDMQ 343

Query: 316 LFNRLGLIPD 325
           LF RLG+ P+
Sbjct: 344 LFARLGIQPE 353


>gi|253687894|ref|YP_003017084.1| biotin synthase [Pectobacterium carotovorum subsp. carotovorum PC1]
 gi|251754472|gb|ACT12548.1| biotin synthase [Pectobacterium carotovorum subsp. carotovorum PC1]
          Length = 345

 Score =  325 bits (833), Expect = 5e-87,   Method: Composition-based stats.
 Identities = 161/310 (51%), Positives = 228/310 (73%)

Query: 19  WTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQSVHN 78
           WT ++   ++N PF +L+F +  +HR++F+P  +Q+S LL+IKTG CPE+C YC QS   
Sbjct: 7   WTLEQAQDLFNKPFLELMFEAQQIHRQHFDPRQVQVSTLLSIKTGACPEDCKYCPQSSRY 66

Query: 79  KSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLGLE 138
           ++ +   +L+ V+QVL+ A+ AK  G+TR+CMGAAW+ P ERD+  +  M++GVK++G+E
Sbjct: 67  RTGIDTERLMQVEQVLESARQAKAAGSTRFCMGAAWKNPHERDMPYLEQMVQGVKAMGME 126

Query: 139 TCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSGIK 198
           TCMTLG L  +QA+ L+ AGLD+YNHN+DTS  FY  + TT T+++RL TL+ VR +GIK
Sbjct: 127 TCMTLGTLHNDQAERLASAGLDFYNHNLDTSPEFYGSIITTRTYQERLDTLDKVRGAGIK 186

Query: 199 VCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEHVRI 258
           VC GGI+GLGE + DR  +L+ LANL TPPES+PIN+L+ + G+   EN+ VDP + +R 
Sbjct: 187 VCSGGIVGLGETVRDRAGLLVQLANLPTPPESVPINMLVKVKGTPLAENEDVDPFDFIRT 246

Query: 259 ISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTILFN 318
           I+VARI+MP S +RL+AGR  MS++ QA+CF +GANSIF G  LLT  NP  +KD  LF 
Sbjct: 247 IAVARIMMPASYVRLSAGREQMSEQTQAMCFMAGANSIFYGCKLLTTPNPKEDKDLALFL 306

Query: 319 RLGLIPDLSA 328
           +LGL P  +A
Sbjct: 307 KLGLNPQQTA 316


>gi|90022781|ref|YP_528608.1| biotin synthase [Saccharophagus degradans 2-40]
 gi|123276264|sp|Q21FY3|BIOB_SACD2 RecName: Full=Biotin synthase
 gi|89952381|gb|ABD82396.1| biotin synthase [Saccharophagus degradans 2-40]
          Length = 350

 Score =  325 bits (833), Expect = 6e-87,   Method: Composition-based stats.
 Identities = 171/315 (54%), Positives = 234/315 (74%)

Query: 11  NPTKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCG 70
           NP+     WT KEV  ++ +PFNDLLF + T+HR+ F  N +Q+S L +IKTG CPE+C 
Sbjct: 3   NPSLVRSNWTRKEVEALFALPFNDLLFEAQTIHRQFFNANEVQVSTLCSIKTGACPEDCA 62

Query: 71  YCNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIK 130
           YC QS    + L+  KL+ V++VL+EAK AK++GATR+CMGAAWR PK++D+  +  M+K
Sbjct: 63  YCPQSARYDTGLEREKLMAVEKVLEEAKAAKDSGATRFCMGAAWRSPKKKDMPYVTAMVK 122

Query: 131 GVKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLE 190
           GVK +GLE CMTLGM+  +QA  L++AGLDYYNHN+DTS  +Y  + TT T++DRL TL+
Sbjct: 123 GVKEMGLEACMTLGMIDKDQATELAEAGLDYYNHNLDTSPEYYGDIITTRTYQDRLDTLD 182

Query: 191 NVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKV 250
           NVR +G+KVCCGGI+G+GE   DR+ +LL LAN+   PES+PIN+L+ + G+  E+ + +
Sbjct: 183 NVRHAGMKVCCGGIMGMGEDESDRVGLLLQLANMPQHPESVPINMLVAVEGTPLEQQEAL 242

Query: 251 DPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSY 310
           DP + +R I+VARILMP+S +RL+AGR  M+D+ QAL F +GANSIF G+ LLT  NP  
Sbjct: 243 DPFDFIRTIAVARILMPQSHVRLSAGREDMNDQTQALAFHAGANSIFYGEKLLTTANPES 302

Query: 311 NKDTILFNRLGLIPD 325
           NKD  LF RLG+ P+
Sbjct: 303 NKDMQLFKRLGINPE 317


>gi|307130546|ref|YP_003882562.1| biotin synthase [Dickeya dadantii 3937]
 gi|306528075|gb|ADM98005.1| biotin synthase [Dickeya dadantii 3937]
          Length = 346

 Score =  325 bits (833), Expect = 6e-87,   Method: Composition-based stats.
 Identities = 159/309 (51%), Positives = 225/309 (72%)

Query: 19  WTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQSVHN 78
           WT ++   +++ PF +L+F +  VHR++F+P  +Q+S LL+IKTG CPE+C YC QS   
Sbjct: 8   WTLEQAQALFDKPFLELMFEAQQVHRQHFDPRQVQVSTLLSIKTGACPEDCKYCPQSARY 67

Query: 79  KSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLGLE 138
           ++ ++  +L+ V+QVL  A+ AK  G+TR+CMGAAW+ P ERD+  +  M++GVK +G+E
Sbjct: 68  RTGIETERLMQVEQVLDSARQAKAAGSTRFCMGAAWKNPHERDMPYLESMVRGVKEMGME 127

Query: 139 TCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSGIK 198
           TCMTLG L  +QA+ L+ AGLD+YNHN+DTS  FY ++ TT T+++RL TL  VR +GIK
Sbjct: 128 TCMTLGTLHGDQAERLAAAGLDFYNHNLDTSPEFYGNIITTRTYQERLDTLGKVRGAGIK 187

Query: 199 VCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEHVRI 258
           VC GGI+GLGE + DR  +L+ LANL TPPES+PIN+L+ + G+   E + VDP + +R 
Sbjct: 188 VCSGGIVGLGETVRDRAGLLVQLANLPTPPESVPINMLVKVKGTPLAETEDVDPFDFIRT 247

Query: 259 ISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTILFN 318
           I+VARI+MP S +RL+AGR  MS++ QA+CF +GANSIF G  LLT  NP  +KD  LF 
Sbjct: 248 IAVARIMMPASYVRLSAGREQMSEQTQAMCFMAGANSIFYGCKLLTTPNPKEDKDLQLFR 307

Query: 319 RLGLIPDLS 327
           +LGL P  +
Sbjct: 308 KLGLNPQQT 316


>gi|188534393|ref|YP_001908190.1| Biotin synthase [Erwinia tasmaniensis Et1/99]
 gi|254810684|sp|B2VBT9|BIOB_ERWT9 RecName: Full=Biotin synthase
 gi|188029435|emb|CAO97312.1| Biotin synthase [Erwinia tasmaniensis Et1/99]
          Length = 343

 Score =  325 bits (833), Expect = 6e-87,   Method: Composition-based stats.
 Identities = 160/308 (51%), Positives = 222/308 (72%)

Query: 18  VWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQSVH 77
            WT  +   ++  PF +L+F +  +HR  F+P  +Q+S LL+IKTG CPE+C YC QS  
Sbjct: 4   RWTLSQAQALFETPFLELMFEAQQIHRHYFDPRQVQVSTLLSIKTGACPEDCKYCPQSAR 63

Query: 78  NKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLGL 137
            K+ L+A +L+ V++VL  A+ AK  G+ R+CMGAAW+ P ERD+  +  M++GVK +G+
Sbjct: 64  YKTGLEAERLMEVEEVLSSARKAKAAGSGRFCMGAAWKNPHERDMPYLEKMVQGVKEMGM 123

Query: 138 ETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSGI 197
           ETCMTLG LS +QAQ L+ AGLD+YNHN+DTS  FY  + TT ++++RL TL  VR++GI
Sbjct: 124 ETCMTLGSLSEQQAQRLAHAGLDFYNHNLDTSPEFYGSIITTRSYQERLDTLGKVREAGI 183

Query: 198 KVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEHVR 257
           KVC GGI+GLGE + DR  +L+ LANL  PPES+PIN+L+ + G+   +N  VDP + VR
Sbjct: 184 KVCSGGIVGLGETVQDRAGLLVQLANLPEPPESVPINMLVKVKGTPMADNDDVDPFDFVR 243

Query: 258 IISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTILF 317
            I+VARI+MP+S +RL+AGR  MS++ QA+CF +GANSIF G  LLT  NP  +KD +LF
Sbjct: 244 TIAVARIMMPRSHVRLSAGREQMSEQTQAMCFMAGANSIFYGCKLLTTPNPDEDKDLLLF 303

Query: 318 NRLGLIPD 325
            +LGL P 
Sbjct: 304 RKLGLNPR 311


>gi|311280349|ref|YP_003942580.1| biotin synthase [Enterobacter cloacae SCF1]
 gi|308749544|gb|ADO49296.1| biotin synthase [Enterobacter cloacae SCF1]
          Length = 346

 Score =  325 bits (832), Expect = 6e-87,   Method: Composition-based stats.
 Identities = 164/310 (52%), Positives = 225/310 (72%)

Query: 18  VWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQSVH 77
            WT  +V +++  P  +LLF +  VHR++F+P  +Q+S LL+IKTG CPE+C YC QS  
Sbjct: 6   RWTMSQVTELFEKPLLELLFEAQQVHRQHFDPRQVQVSTLLSIKTGACPEDCKYCPQSAR 65

Query: 78  NKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLGL 137
            K+ L+  +L+ V+QVL  A+ AK  G+TR+CMGAAW+ P ERD+  +  M+KGVK +GL
Sbjct: 66  YKTGLETERLMEVEQVLDSARKAKNAGSTRFCMGAAWKNPHERDMPYLEQMVKGVKEMGL 125

Query: 138 ETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSGI 197
           E CMTLG LS +QAQ L+ AGLDYYNHN+DTS  FY ++ TT T+++RL TL+ VR +GI
Sbjct: 126 EACMTLGTLSDDQAQRLASAGLDYYNHNLDTSPEFYGNIITTRTYQERLDTLDKVRDAGI 185

Query: 198 KVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEHVR 257
           KVC GGI+GLGE + DR  +LL LANL TPPES+PIN+L+ + G+  E+N  VD  + +R
Sbjct: 186 KVCSGGIVGLGETVKDRAGLLLQLANLPTPPESVPINMLVKVKGTPLEDNDDVDAFDFIR 245

Query: 258 IISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTILF 317
            I+VARI+MP S +RL+AGR  M+++ QA+CF +GANSIF G  LLT  NP  + D +LF
Sbjct: 246 TIAVARIMMPTSHVRLSAGREKMNEQTQAMCFMAGANSIFYGCKLLTTPNPEEDNDLLLF 305

Query: 318 NRLGLIPDLS 327
            +LG+ P  +
Sbjct: 306 RKLGINPQQT 315


>gi|227112995|ref|ZP_03826651.1| biotin synthase [Pectobacterium carotovorum subsp. brasiliensis
           PBR1692]
          Length = 345

 Score =  325 bits (832), Expect = 6e-87,   Method: Composition-based stats.
 Identities = 159/309 (51%), Positives = 226/309 (73%)

Query: 19  WTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQSVHN 78
           WT ++   ++N PF +L+F +  +HR++F+P  +Q+S LL+IKTG CPE+C YC QS   
Sbjct: 7   WTLEQAQDLFNKPFLELMFEAQQIHRQHFDPRQVQVSTLLSIKTGSCPEDCKYCPQSSRY 66

Query: 79  KSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLGLE 138
           ++ +   +L+ V+QVL+ A+ AK  G+TR+CMGAAW+ P ERD+  +  M++GVK++G+E
Sbjct: 67  RTGIDTERLMQVEQVLESARQAKAAGSTRFCMGAAWKNPHERDMPYLEQMVQGVKAMGME 126

Query: 139 TCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSGIK 198
           TCMTLG L  +QA+ L+ AGLD+YNHN+DTS  FY  + TT T+++RL TL+ VR +GIK
Sbjct: 127 TCMTLGTLHNDQAERLASAGLDFYNHNLDTSPEFYGSIITTRTYQERLDTLDKVRGAGIK 186

Query: 199 VCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEHVRI 258
           VC GGI+GLGE + DR  +L+ LANL TPPES+PIN+L+ + G+   +N  VDP + +R 
Sbjct: 187 VCSGGIVGLGETVRDRAGLLVQLANLPTPPESVPINMLVKVKGTPLADNDDVDPFDFIRT 246

Query: 259 ISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTILFN 318
           I+VARI+MP S +RL+AGR  MS++ QA+CF +GANSIF G  LLT  NP  +KD  LF 
Sbjct: 247 IAVARIMMPASYVRLSAGREQMSEQTQAMCFMAGANSIFYGCKLLTTPNPKEDKDLALFL 306

Query: 319 RLGLIPDLS 327
           +LGL P  +
Sbjct: 307 KLGLNPQQT 315


>gi|332993832|gb|AEF03887.1| Biotin synthase [Alteromonas sp. SN2]
          Length = 372

 Score =  325 bits (832), Expect = 7e-87,   Method: Composition-based stats.
 Identities = 163/321 (50%), Positives = 229/321 (71%)

Query: 7   VPEENPTKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCP 66
            P+         W+  EV  +Y +PFNDLLF +  VHR++F PN +Q+S LL+IKTG CP
Sbjct: 6   APDAQNNTIRHDWSQAEVEALYALPFNDLLFQAQVVHRQHFNPNEVQVSTLLSIKTGACP 65

Query: 67  ENCGYCNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIV 126
           E+C YC QS    + L+  +L+ +++V++ AK AK+ G+TR+CMGAAWR P++RD+  IV
Sbjct: 66  EDCKYCPQSARYDTGLEKERLLEIEKVIERAKEAKQVGSTRFCMGAAWRNPRDRDMPYIV 125

Query: 127 DMIKGVKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRL 186
            M++ VK LGLETCMTLGML+ +QA  L +AGLDYYNHN+DTS  +Y  + TT T++DRL
Sbjct: 126 KMVEEVKQLGLETCMTLGMLTRDQAVALKQAGLDYYNHNLDTSPEYYGDIITTRTYQDRL 185

Query: 187 QTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEE 246
            TLENVR +G+ VC GGI+G+GE   DR  +L+ LANL   P+S+PIN+L+ + G+    
Sbjct: 186 NTLENVRAAGMNVCSGGIVGMGETAGDRASLLIQLANLPEQPQSVPINMLVKVKGTPLAS 245

Query: 247 NKKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAK 306
            + +D  E +R I+VARI+MPKS +RL+AGR  M++++QALCF +GANSIF G  LLT  
Sbjct: 246 LEDLDYFEFIRTIAVARIMMPKSHVRLSAGREAMNEQMQALCFMAGANSIFYGCKLLTTS 305

Query: 307 NPSYNKDTILFNRLGLIPDLS 327
           NP  ++D ILF +LG+  + +
Sbjct: 306 NPDTHEDVILFKKLGINTERT 326


>gi|50121749|ref|YP_050916.1| biotin synthase [Pectobacterium atrosepticum SCRI1043]
 gi|81644624|sp|Q6D3B9|BIOB_ERWCT RecName: Full=Biotin synthase
 gi|49612275|emb|CAG75725.1| biotin synthase [Pectobacterium atrosepticum SCRI1043]
          Length = 345

 Score =  325 bits (832), Expect = 7e-87,   Method: Composition-based stats.
 Identities = 160/309 (51%), Positives = 227/309 (73%)

Query: 19  WTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQSVHN 78
           WT ++   ++N PF +L+F +  +HR++F+P  +Q+S LL+IKTG CPE+C YC QS   
Sbjct: 7   WTLEQAQDLFNKPFLELMFEAQQIHRQHFDPRQVQVSTLLSIKTGSCPEDCKYCPQSSRY 66

Query: 79  KSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLGLE 138
           ++ +   +L+ V+QVL  A+ AK  G+TR+CMGAAW+ P ERD+  +  M++GVK++G+E
Sbjct: 67  RTGIDTERLMQVEQVLDSARQAKAAGSTRFCMGAAWKNPHERDMPYLEQMVQGVKAMGME 126

Query: 139 TCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSGIK 198
           TCMTLGML  +QA+ L+ AGLD+YNHN+DTS  FY  + TT T+++RL TL+ VR +GIK
Sbjct: 127 TCMTLGMLHHDQAERLASAGLDFYNHNLDTSPEFYGSIITTRTYQERLDTLDKVRGAGIK 186

Query: 199 VCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEHVRI 258
           VC GGI+GLGE + DR  +L+ LANL TPPES+PIN+L+ + G+   +N+ VDP + +R 
Sbjct: 187 VCSGGIVGLGETVRDRAGLLVQLANLPTPPESVPINMLVKVKGTPLADNEDVDPFDFIRT 246

Query: 259 ISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTILFN 318
           I+VARI+MP S +RL+AGR  MS++ QA+CF +GANSIF G  LLT  NP  +KD  LF 
Sbjct: 247 IAVARIMMPASYVRLSAGREQMSEQTQAMCFMAGANSIFYGCKLLTTPNPKEDKDLALFL 306

Query: 319 RLGLIPDLS 327
           +LGL P  +
Sbjct: 307 KLGLNPQQT 315


>gi|77165566|ref|YP_344091.1| biotin synthase [Nitrosococcus oceani ATCC 19707]
 gi|254434863|ref|ZP_05048371.1| biotin synthase [Nitrosococcus oceani AFC27]
 gi|123730638|sp|Q3J9D5|BIOB_NITOC RecName: Full=Biotin synthase
 gi|76883880|gb|ABA58561.1| biotin synthase [Nitrosococcus oceani ATCC 19707]
 gi|207091196|gb|EDZ68467.1| biotin synthase [Nitrosococcus oceani AFC27]
          Length = 345

 Score =  325 bits (832), Expect = 8e-87,   Method: Composition-based stats.
 Identities = 168/309 (54%), Positives = 220/309 (71%)

Query: 15  KPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQ 74
               W+  EV  ++ +PF +L++ + TVHR++F PN +Q+S LL+IKTGGCPE+C YC Q
Sbjct: 14  PRHDWSIPEVLALFELPFVELIYRAQTVHRQHFNPNQVQMSTLLSIKTGGCPEDCAYCPQ 73

Query: 75  SVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKS 134
           SV   + +KA  L+ +++VL  A+NAK  GA+R+CMGAAWR  KER+L  +  MI  VK+
Sbjct: 74  SVRYSTPVKAEPLLPLEEVLTAARNAKARGASRFCMGAAWRRLKERELEPVAKMITEVKA 133

Query: 135 LGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRK 194
           LGLETC+TLGML   QA+ L  AGLDYYNHN+DTS  FY  + TT T++DRL+TL  VR+
Sbjct: 134 LGLETCVTLGMLGPGQAERLKAAGLDYYNHNLDTSPEFYGEIITTRTYQDRLETLSQVRE 193

Query: 195 SGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIE 254
           +GI VCCGGI+G+GE   DR  +L  LANL   PES+PIN L+ + G+      ++DP E
Sbjct: 194 AGIHVCCGGIVGMGEERSDRAGLLANLANLPRHPESVPINRLVQVEGTPLAGAPELDPFE 253

Query: 255 HVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDT 314
            VR ++ ARILMP S +RL+AGR  MSDELQALCF +GANSIF G+ LLT  NP+ + D 
Sbjct: 254 FVRTVACARILMPASFVRLSAGRETMSDELQALCFLAGANSIFYGEKLLTTPNPTTDHDQ 313

Query: 315 ILFNRLGLI 323
            LF RLGL 
Sbjct: 314 QLFERLGLE 322


>gi|239996194|ref|ZP_04716718.1| Biotin synthase [Alteromonas macleodii ATCC 27126]
          Length = 374

 Score =  324 bits (831), Expect = 8e-87,   Method: Composition-based stats.
 Identities = 165/321 (51%), Positives = 231/321 (71%)

Query: 7   VPEENPTKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCP 66
            P    T     WT  EV  ++ MPFNDLLF +  VHR++F PN +Q+S LL+IKTG CP
Sbjct: 6   APSAQTTTIRNDWTKAEVEALFAMPFNDLLFNAQVVHRQHFNPNEVQVSTLLSIKTGACP 65

Query: 67  ENCGYCNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIV 126
           E+C YC QS    + L+  +L+ +++V++ AK AK  G+TR+CMGAAWR P++RD+  I+
Sbjct: 66  EDCKYCPQSARYDTGLEKERLLEIEKVIQRAKEAKHVGSTRFCMGAAWRNPRDRDMPYIL 125

Query: 127 DMIKGVKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRL 186
            M++ VKSLGLETCMTLGML+ +QA  L +AGLDYYNHN+DTS  +Y  + TT T++DRL
Sbjct: 126 KMVEEVKSLGLETCMTLGMLTRDQAVALKQAGLDYYNHNLDTSPEYYGDIITTRTYQDRL 185

Query: 187 QTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEE 246
            TLENVR +G+ VC GGI+G+GE + DR  ML+ LANL   P+S+PIN+L+ + G+  + 
Sbjct: 186 NTLENVRAAGMNVCSGGIVGMGETVSDRASMLVQLANLPEQPQSVPINMLVKVKGTPLDS 245

Query: 247 NKKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAK 306
            + +D  E +R I+VARI+MPKS +RL+AGR  M++++QALCF +GANSIF G  LLT  
Sbjct: 246 VEDLDYFEFIRTIAVARIMMPKSHVRLSAGREAMNEQMQALCFMAGANSIFYGCKLLTTS 305

Query: 307 NPSYNKDTILFNRLGLIPDLS 327
           NP  ++D +LF +LG+  + +
Sbjct: 306 NPDTHEDVMLFKKLGINTERT 326


>gi|330830397|ref|YP_004393349.1| biotin synthetase [Aeromonas veronii B565]
 gi|328805533|gb|AEB50732.1| Biotin synthetase [Aeromonas veronii B565]
          Length = 362

 Score =  324 bits (831), Expect = 1e-86,   Method: Composition-based stats.
 Identities = 168/313 (53%), Positives = 227/313 (72%)

Query: 16  PKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQS 75
              WT  EV  ++ +PFNDLLF + TVHR  F+PN +Q+S LL+IKTG CPE+C YC QS
Sbjct: 12  RHDWTLAEVQALFALPFNDLLFQAQTVHRAYFDPNEVQVSTLLSIKTGACPEDCKYCPQS 71

Query: 76  VHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSL 135
               + L+A +L+ V++VL+ A+ AK NG++R+CMGAAWR PKE+D+  I+ MI+ V+ L
Sbjct: 72  ARYHTGLEAERLMEVEKVLERAREAKANGSSRFCMGAAWRNPKEKDMPYIIRMIEEVRGL 131

Query: 136 GLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKS 195
           G+ETCMTLGML+ +QA  L  AGLDYYNHN+DTS  FY  + +T T++DRL TLE+VR +
Sbjct: 132 GMETCMTLGMLTADQAARLGAAGLDYYNHNLDTSPEFYGEIISTRTYQDRLDTLEHVRGA 191

Query: 196 GIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEH 255
           G+KVC GGI+G+GE   DR  +L+ LANL   PES+PIN+L+ + G+  E  + +DP E 
Sbjct: 192 GMKVCSGGIVGMGEQAKDRAGLLMALANLPRHPESVPINMLVKVKGTPLENEENLDPFEF 251

Query: 256 VRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTI 315
           +R I+VARI+MP S +RL+AGR  M++++QA+CF +GANSIF G  LLT  NP  N D  
Sbjct: 252 IRTIAVARIMMPASHVRLSAGREKMNEQMQAMCFMAGANSIFYGCKLLTTPNPDENSDMQ 311

Query: 316 LFNRLGLIPDLSA 328
           LF RLG+ P   A
Sbjct: 312 LFKRLGIRPAQRA 324


>gi|161501959|ref|YP_262751.2| biotin synthetase [Pseudomonas fluorescens Pf-5]
 gi|254810859|sp|Q4K4T2|BIOB_PSEF5 RecName: Full=Biotin synthase
          Length = 351

 Score =  324 bits (831), Expect = 1e-86,   Method: Composition-based stats.
 Identities = 168/310 (54%), Positives = 231/310 (74%)

Query: 16  PKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQS 75
              WT  EV  ++  PFNDLLF + TVHR +F+ N +Q+S LL+IKTG CPE+C YC QS
Sbjct: 10  RHDWTLAEVKALFVQPFNDLLFQAQTVHRAHFDANRVQVSTLLSIKTGACPEDCKYCPQS 69

Query: 76  VHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSL 135
            H  + L+  KL+ V +VL+EA  AK  G+TR+CMGAAW+ P  +D+  +++M+KGVK++
Sbjct: 70  GHYNTGLEKEKLLEVQKVLEEAARAKAIGSTRFCMGAAWKHPSAKDMPYVLEMVKGVKAM 129

Query: 136 GLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKS 195
           GLETCMTLG L  +Q + L+KAGLDYYNHN+DTS  FY ++ TT T+ +RLQTL  VR +
Sbjct: 130 GLETCMTLGRLDQDQTEALAKAGLDYYNHNLDTSPEFYGNIITTRTYSERLQTLAYVRDA 189

Query: 196 GIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEH 255
           G+K+C GGILG+GE +DDR  +L+ LANL   PES+PIN+L+ + G+  E  ++VDP + 
Sbjct: 190 GMKICSGGILGMGESLDDRAGLLIQLANLPEHPESVPINMLVKVAGTPLENAEEVDPFDF 249

Query: 256 VRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTI 315
           +R+++VARILMP+S +RL+AGR  M++++QAL FF+GANSIF GD LLT  NP  +KD  
Sbjct: 250 IRMLAVARILMPQSHVRLSAGREAMNEQMQALAFFAGANSIFYGDKLLTTANPQADKDMQ 309

Query: 316 LFNRLGLIPD 325
           LF RLG+ P+
Sbjct: 310 LFARLGIQPE 319


>gi|315122058|ref|YP_004062547.1| biotin synthase [Candidatus Liberibacter solanacearum CLso-ZC1]
 gi|313495460|gb|ADR52059.1| biotin synthase [Candidatus Liberibacter solanacearum CLso-ZC1]
          Length = 328

 Score =  324 bits (831), Expect = 1e-86,   Method: Composition-based stats.
 Identities = 282/327 (86%), Positives = 306/327 (93%)

Query: 1   MSRSTVVPEENPTKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNI 60
           M +S    ++    KPK WT KEV QIY MPFNDLLFWSHTVHRKNFEPNHIQLSKLLNI
Sbjct: 1   MCKSNATSKKECDNKPKTWTFKEVLQIYQMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNI 60

Query: 61  KTGGCPENCGYCNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKER 120
           KTGGCPE+CGYCNQSVHNK+KLKASKL++VDQVLKEA+ AKENGATRYCMGAAWREPK+R
Sbjct: 61  KTGGCPEDCGYCNQSVHNKTKLKASKLLDVDQVLKEAQLAKENGATRYCMGAAWREPKKR 120

Query: 121 DLSIIVDMIKGVKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTH 180
           D+++IVDMI+GVKSLGLETCMTLGMLS EQAQ LS+AGLDYYNHNIDTSERFYP+V TTH
Sbjct: 121 DIAVIVDMIRGVKSLGLETCMTLGMLSSEQAQELSEAGLDYYNHNIDTSERFYPNVITTH 180

Query: 181 TFEDRLQTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIP 240
           TFE+RLQTLENVRKSGIKVCCGGILGLGE  DDRIDML+TLANL+TPPESIPINLLIPIP
Sbjct: 181 TFENRLQTLENVRKSGIKVCCGGILGLGETTDDRIDMLITLANLATPPESIPINLLIPIP 240

Query: 241 GSKFEENKKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGD 300
           GSKF ENKKVDPIE+VRII+VARILMPKSRLRLAAGR MMSDELQALCFFSGANSIFVGD
Sbjct: 241 GSKFSENKKVDPIEYVRIIAVARILMPKSRLRLAAGRVMMSDELQALCFFSGANSIFVGD 300

Query: 301 TLLTAKNPSYNKDTILFNRLGLIPDLS 327
           TLLTAKNP+YNKDTILF+RLGL+PDL+
Sbjct: 301 TLLTAKNPNYNKDTILFDRLGLMPDLN 327


>gi|295136320|ref|YP_003586996.1| biotin synthase [Zunongwangia profunda SM-A87]
 gi|294984335|gb|ADF54800.1| biotin synthase [Zunongwangia profunda SM-A87]
          Length = 365

 Score =  324 bits (830), Expect = 1e-86,   Method: Composition-based stats.
 Identities = 151/313 (48%), Positives = 216/313 (69%), Gaps = 1/313 (0%)

Query: 14  KKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCN 73
                WT +E+ +IYN P  +LL+ + TVHRK+ +PN +Q+S LL+IKTGGCPE+CGYC 
Sbjct: 2   ATRHNWTKEEILEIYNKPLMELLYEAATVHRKHHDPNTVQVSTLLSIKTGGCPEDCGYCP 61

Query: 74  QSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKER-DLSIIVDMIKGV 132
           Q+    + +  + L++V  V  +A  AK  G++R CMGAAWR  K+  +   +++M++ +
Sbjct: 62  QAARYHTDIAGNDLMSVSHVKAQALRAKSAGSSRVCMGAAWRNVKDGPEFDNVLEMVRTI 121

Query: 133 KSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENV 192
             L +E C TLGML+  QAQ L++AGL  YNHN+DTSE +Y  V +T  FEDRL+T++NV
Sbjct: 122 NKLDMEVCCTLGMLTENQAQRLAEAGLYAYNHNLDTSEEYYKEVISTRGFEDRLETIDNV 181

Query: 193 RKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDP 252
           RK+ + VC GGI+G+GE  +DR  ML+ L+ L+  PES+PIN L+P+ G+  EE   V  
Sbjct: 182 RKTNVTVCSGGIIGMGEKEEDRAGMLVALSTLNPQPESVPINALVPVEGTPMEEQAPVSI 241

Query: 253 IEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNK 312
            E VR+++  RI+MP++++RL+AGR  MS E QA+CFF+GANSIF GD LLT  NP  ++
Sbjct: 242 WEMVRMVATTRIVMPETQVRLSAGRTQMSREGQAMCFFAGANSIFAGDKLLTTPNPDVSE 301

Query: 313 DTILFNRLGLIPD 325
           D  +F  LGL P 
Sbjct: 302 DMQMFKALGLNPQ 314


>gi|261822211|ref|YP_003260317.1| biotin synthase [Pectobacterium wasabiae WPP163]
 gi|261606224|gb|ACX88710.1| biotin synthase [Pectobacterium wasabiae WPP163]
          Length = 345

 Score =  324 bits (830), Expect = 1e-86,   Method: Composition-based stats.
 Identities = 159/309 (51%), Positives = 226/309 (73%)

Query: 19  WTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQSVHN 78
           WT ++   ++N PF +L+F +  +HR++F+P  +Q+S LL+IKTG CPE+C YC QS   
Sbjct: 7   WTLEQAQDLFNKPFLELMFEAQQIHRQHFDPRQVQVSTLLSIKTGSCPEDCKYCPQSSRY 66

Query: 79  KSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLGLE 138
           ++ +   +L+ V+QVL  A+ AK  G+TR+CMGAAW+ P ERD+  +  M++GVK++G+E
Sbjct: 67  RTGIDTERLMQVEQVLDSARQAKAAGSTRFCMGAAWKNPHERDMPYLEQMVQGVKAMGME 126

Query: 139 TCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSGIK 198
           TCMTLG L  +QA+ L+ AGLD+YNHN+DTS  FY  + TT T+++RL TL+ VR +GIK
Sbjct: 127 TCMTLGTLHHDQAERLASAGLDFYNHNLDTSPEFYGSIITTRTYQERLDTLDKVRGAGIK 186

Query: 199 VCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEHVRI 258
           VC GGI+GLGE + DR  +L+ LANL TPPES+PIN+L+ + G+   +N+ VDP + +R 
Sbjct: 187 VCSGGIVGLGETVRDRAGLLVQLANLPTPPESVPINMLVKVKGTPLADNEDVDPFDFIRT 246

Query: 259 ISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTILFN 318
           I+VARI+MP S +RL+AGR  MS++ QA+CF +GANSIF G  LLT  NP  +KD  LF 
Sbjct: 247 IAVARIMMPASYVRLSAGREQMSEQTQAMCFMAGANSIFYGCKLLTTPNPKEDKDLALFL 306

Query: 319 RLGLIPDLS 327
           +LGL P  +
Sbjct: 307 KLGLNPQQT 315


>gi|254810867|sp|A7HP26|BIOB_PARL1 RecName: Full=Biotin synthase
          Length = 338

 Score =  324 bits (830), Expect = 1e-86,   Method: Composition-based stats.
 Identities = 180/318 (56%), Positives = 245/318 (77%)

Query: 6   VVPEENPTKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGC 65
           +    +P      WT +E+  ++++PFNDLLF +  VHR+ F+ + +Q+S LL+IKTGGC
Sbjct: 1   MTARTDPGALRHDWTREELQALFDLPFNDLLFEAQLVHRRWFKADEVQMSTLLSIKTGGC 60

Query: 66  PENCGYCNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSII 125
           PE+CGYC QS    + LKASKL+ V++VL EA+ AKE GATRYCMGAAWREPK+RD+ ++
Sbjct: 61  PEDCGYCAQSSKFDTGLKASKLMEVEKVLAEARKAKEAGATRYCMGAAWREPKDRDMDMV 120

Query: 126 VDMIKGVKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDR 185
             M++G+K +G+ETCMTLGMLS +Q   L+++GLDYYNHNIDTSE +YP V +T T++DR
Sbjct: 121 CAMVEGIKDMGMETCMTLGMLSGQQVHRLAQSGLDYYNHNIDTSEEYYPKVISTRTYQDR 180

Query: 186 LQTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFE 245
           L+TLE VR +GI VC GGI+G+GE   DRI ML+TLANL   P+S+PIN+L+P+ G+   
Sbjct: 181 LETLERVRNAGINVCSGGIVGMGESPSDRIGMLMTLANLEEHPQSVPINMLMPVEGTALG 240

Query: 246 ENKKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTA 305
            ++K+DPI+ VR+I+VARI MP+S +RL+AGR  MS+E QALCF +GANSIF+G+ LLT 
Sbjct: 241 ASEKIDPIDFVRLIAVARIAMPQSVVRLSAGREHMSEETQALCFLAGANSIFIGEKLLTT 300

Query: 306 KNPSYNKDTILFNRLGLI 323
           KNP  +KD  LF +LG+ 
Sbjct: 301 KNPEADKDQRLFAKLGIR 318


>gi|26987104|ref|NP_742529.1| biotin synthase [Pseudomonas putida KT2440]
 gi|81586496|sp|Q88QX2|BIOB_PSEPK RecName: Full=Biotin synthase
 gi|24981732|gb|AAN65993.1|AE016228_6 biotin synthetase [Pseudomonas putida KT2440]
          Length = 352

 Score =  324 bits (830), Expect = 1e-86,   Method: Composition-based stats.
 Identities = 167/313 (53%), Positives = 228/313 (72%)

Query: 13  TKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYC 72
                 W   EV  ++  PFNDLLF + TVHR +F+PN +Q+S LL+IKTG CPE+C YC
Sbjct: 7   ATTRHDWALAEVKALFQQPFNDLLFQAQTVHRAHFDPNRVQVSTLLSIKTGACPEDCKYC 66

Query: 73  NQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGV 132
            QS H  + L+  KL+ V +VL+EA  AK  G+TR+CMGAAW+ P  +D+  +++M+KGV
Sbjct: 67  PQSGHYNTGLEKQKLMEVQKVLEEAARAKAIGSTRFCMGAAWKHPSAKDMPYVLEMVKGV 126

Query: 133 KSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENV 192
           K++GLETCMTLG L  EQ + L++AGLDYYNHN+DTS  FY  + TT T+ +RLQTL  V
Sbjct: 127 KAMGLETCMTLGKLDQEQTKALAQAGLDYYNHNLDTSPEFYGSIITTRTYSERLQTLAYV 186

Query: 193 RKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDP 252
           R +G+K+C GGILG+GE +DDR  +L+ LANL   PES+PIN+L+ + G+   E + VDP
Sbjct: 187 RDAGMKICSGGILGMGESLDDRAGLLIQLANLPEHPESVPINMLVKVAGTPLAEEEDVDP 246

Query: 253 IEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNK 312
            + +R+++VARILMPKS +RL+AGR  M++++QAL F +GANSIF G+ LLT  NP  +K
Sbjct: 247 FDFIRMLAVARILMPKSHVRLSAGREQMNEQMQALAFMAGANSIFYGEKLLTTANPQADK 306

Query: 313 DTILFNRLGLIPD 325
           D  LF RLG+ P+
Sbjct: 307 DMQLFARLGIKPE 319


>gi|300113675|ref|YP_003760250.1| biotin synthase [Nitrosococcus watsonii C-113]
 gi|299539612|gb|ADJ27929.1| biotin synthase [Nitrosococcus watsonii C-113]
          Length = 345

 Score =  324 bits (830), Expect = 1e-86,   Method: Composition-based stats.
 Identities = 167/309 (54%), Positives = 217/309 (70%)

Query: 15  KPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQ 74
               W+  EV  ++ +PF +L++ + T HR++F PN +Q+S LL+IKTGGCPE+C YC Q
Sbjct: 14  PRHDWSIPEVLTLFELPFVELIYRAQTAHRQHFNPNQVQMSTLLSIKTGGCPEDCAYCPQ 73

Query: 75  SVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKS 134
           SV   + +KA  L+ +++VL  A+NAK  GA+R+CMGAAWR  KER+L  + +MI  VK 
Sbjct: 74  SVRYSTPVKAEPLLPLEEVLVAARNAKARGASRFCMGAAWRRLKERELEPVAEMITAVKD 133

Query: 135 LGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRK 194
           LGLETC+TLGML   QA+ L  AGLDYYNHN+DTS  FY  + TT T++DRL+TL  VR+
Sbjct: 134 LGLETCVTLGMLGPGQAERLKAAGLDYYNHNLDTSPEFYGEIITTRTYQDRLETLSQVRE 193

Query: 195 SGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIE 254
           +GI VCCGGI+G+GE    R  +L  LANL   PES+PIN L+ + G+       +DP E
Sbjct: 194 AGIHVCCGGIVGMGEERSHRAGLLANLANLPRHPESVPINRLVQVEGTPLAGTPALDPFE 253

Query: 255 HVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDT 314
            VR ++ ARILMP S +RL+AGR  MSDELQALCF +GANSIF G+ LLT  NPS + D 
Sbjct: 254 FVRTVACARILMPNSFVRLSAGRETMSDELQALCFLAGANSIFYGEKLLTTPNPSTDHDQ 313

Query: 315 ILFNRLGLI 323
            LF RLGL 
Sbjct: 314 QLFERLGLE 322


>gi|212712177|ref|ZP_03320305.1| hypothetical protein PROVALCAL_03259 [Providencia alcalifaciens DSM
           30120]
 gi|212685224|gb|EEB44752.1| hypothetical protein PROVALCAL_03259 [Providencia alcalifaciens DSM
           30120]
          Length = 350

 Score =  324 bits (830), Expect = 1e-86,   Method: Composition-based stats.
 Identities = 168/309 (54%), Positives = 229/309 (74%)

Query: 17  KVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQSV 76
           K WT K+  ++++MPF +LLF +  VHR++F+P  +Q+S LL+IKTG CPE+C YC QS 
Sbjct: 10  KNWTIKQANELFSMPFFELLFQAQQVHRQHFDPQQVQVSTLLSIKTGACPEDCKYCAQSA 69

Query: 77  HNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLG 136
             K+ L+  +L+ V QV++ AK AK  G+TR+CMGAAWR PKERD+  +  M+K VK+LG
Sbjct: 70  RYKTGLETERLMEVQQVVESAKKAKNAGSTRFCMGAAWRNPKERDMPYLEMMVKEVKALG 129

Query: 137 LETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSG 196
           +ETCMTLGM+   QA  L+ AGLDYYNHN+DTS  +Y ++ TT T++DRL TL+NVR +G
Sbjct: 130 METCMTLGMIDDSQAGRLADAGLDYYNHNLDTSPEYYGNIITTRTYQDRLDTLDNVRNAG 189

Query: 197 IKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEHV 256
           IKVC GGILGLGE + DR  +L+ LANL  PPES+PIN+L+ + G+   +N+ VDP + +
Sbjct: 190 IKVCSGGILGLGEKVSDRAALLVQLANLPKPPESVPINMLMKVEGTPMADNEDVDPFDFI 249

Query: 257 RIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTIL 316
           R I+VARI+MP S +RL+AGR  M+++ QALCF +GANS+F G  LLT  NP  NKD  L
Sbjct: 250 RTIAVARIMMPSSYVRLSAGREHMNEQTQALCFMAGANSVFYGCKLLTTPNPDENKDIAL 309

Query: 317 FNRLGLIPD 325
           F +L + P+
Sbjct: 310 FKKLNINPE 318


>gi|114321583|ref|YP_743266.1| biotin synthase [Alkalilimnicola ehrlichii MLHE-1]
 gi|114227977|gb|ABI57776.1| biotin synthase [Alkalilimnicola ehrlichii MLHE-1]
          Length = 337

 Score =  324 bits (830), Expect = 1e-86,   Method: Composition-based stats.
 Identities = 166/308 (53%), Positives = 221/308 (71%)

Query: 15  KPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQ 74
               W+  EV  ++  PFNDLL  + T HR +F+PN +Q+S LL+IKTG CPE+C YC Q
Sbjct: 14  PRHDWSKDEVLALFEQPFNDLLHQAQTTHRAHFDPNTVQVSTLLSIKTGACPEDCKYCPQ 73

Query: 75  SVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKS 134
           SV   + L+  +++ V++V+  A+ A++ GATR+CMGAAWR PK+RDL  +  M++ VK+
Sbjct: 74  SVRYDTGLEREQILAVEEVVAAARRARDAGATRFCMGAAWRSPKDRDLETVEAMVREVKA 133

Query: 135 LGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRK 194
           LGLETC+TLGML   QA+ L +AGLDYYNHN+DTSE +Y  + TT +++DRL TL  VR 
Sbjct: 134 LGLETCLTLGMLRDGQAERLREAGLDYYNHNLDTSEDYYDEIITTRSYQDRLDTLARVRD 193

Query: 195 SGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIE 254
           +G+K CCGGI+G+GE   DR ++L TLA+L   P+S+PIN L+ +PG+     +  DP E
Sbjct: 194 AGLKTCCGGIIGMGETRQDRAELLRTLASLPVQPQSVPINQLVQVPGTPLHGVEPPDPFE 253

Query: 255 HVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDT 314
            VR I+VARILMP S +RL+AGR  MSDELQALCF +GANSIF GD LLT  NP  +KD 
Sbjct: 254 FVRTIAVARILMPASYVRLSAGREQMSDELQALCFLAGANSIFYGDKLLTTGNPEADKDR 313

Query: 315 ILFNRLGL 322
            L  RLG+
Sbjct: 314 RLLARLGM 321


>gi|226942753|ref|YP_002797826.1| Biotin synthase [Azotobacter vinelandii DJ]
 gi|226717680|gb|ACO76851.1| Biotin synthase [Azotobacter vinelandii DJ]
          Length = 351

 Score =  324 bits (829), Expect = 1e-86,   Method: Composition-based stats.
 Identities = 166/316 (52%), Positives = 237/316 (75%)

Query: 10  ENPTKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENC 69
            +       WT  EV  ++ +PFNDLLF +H VHR++F+PN +Q+S LL+IKTG CPE+C
Sbjct: 3   ASAASLRHDWTLDEVRALFELPFNDLLFQAHAVHRQHFDPNRVQVSTLLSIKTGACPEDC 62

Query: 70  GYCNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMI 129
            YC+QS H+ + L  +KL+ V +V++ A  AK  G+TR+CMGAAW+ P  +D+  +++M+
Sbjct: 63  KYCSQSGHHNTGLDKAKLMEVQKVIRAAAEAKAIGSTRFCMGAAWKHPSAKDMPYVLEMV 122

Query: 130 KGVKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTL 189
           KGVK+LGLETCMTLG LS EQ + L++AGLDYYNHN+DTS  FY ++ TT T+ +RL+TL
Sbjct: 123 KGVKALGLETCMTLGTLSREQTRALAEAGLDYYNHNLDTSPEFYGNIVTTRTYAERLETL 182

Query: 190 ENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKK 249
            +VR++G+K+C GGILG+GE +DDR  +L+ LANL   PES+PIN+L+ + G+  E  + 
Sbjct: 183 AHVREAGMKICSGGILGMGESLDDRAGLLIQLANLPEHPESVPINMLVKVKGTPLENAED 242

Query: 250 VDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPS 309
           VDP + +R ++VARI+MP+S +RL+AGR+ M++++QAL FF+GANSIF G+ LLT  NP 
Sbjct: 243 VDPFDFIRTLAVARIMMPRSHVRLSAGRSEMNEQMQALAFFAGANSIFYGERLLTTGNPE 302

Query: 310 YNKDTILFNRLGLIPD 325
             KD  LF RLG+ P+
Sbjct: 303 AEKDMRLFARLGIRPE 318


>gi|294637401|ref|ZP_06715692.1| biotin synthase [Edwardsiella tarda ATCC 23685]
 gi|291089394|gb|EFE21955.1| biotin synthase [Edwardsiella tarda ATCC 23685]
          Length = 353

 Score =  324 bits (829), Expect = 1e-86,   Method: Composition-based stats.
 Identities = 159/310 (51%), Positives = 222/310 (71%)

Query: 18  VWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQSVH 77
            WT  +   ++  P  +LLF +  VHR++F+P  +Q+S LL+IKTG CPE+C YC QS  
Sbjct: 14  RWTLAQAQALFEHPLLELLFQAQQVHRQHFDPRQVQVSTLLSIKTGACPEDCKYCPQSAR 73

Query: 78  NKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLGL 137
            K+ L+A +L+ V+ VL  A+ A+  G+TR+CMGAAW+ P ERD+  +  M++GVK+LG+
Sbjct: 74  YKTGLEAERLMEVEHVLTSARQARAAGSTRFCMGAAWKNPHERDMPYLEQMVRGVKALGM 133

Query: 138 ETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSGI 197
           E CMTLG LS  QAQ L++AGLDYYNHN+DTS  +Y ++ TT  ++DRL TL  VR +GI
Sbjct: 134 EACMTLGALSASQAQRLAQAGLDYYNHNLDTSPEYYANIITTRRYQDRLDTLARVRAAGI 193

Query: 198 KVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEHVR 257
           KVC GGI+GLGE + DR  +L+ LANL TPPES+PIN+L+ + G+   +N  V+P + +R
Sbjct: 194 KVCSGGIVGLGESVRDRAALLVELANLPTPPESVPINMLVKVAGTPLADNPDVEPFDFIR 253

Query: 258 IISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTILF 317
            I+ ARI+MP S +RL+AGR  M+++ QALCF +GANSIF G  LLT  NP+ ++D  LF
Sbjct: 254 TIAAARIMMPTSYVRLSAGREQMNEQTQALCFMAGANSIFYGCRLLTTPNPAEDRDRQLF 313

Query: 318 NRLGLIPDLS 327
            +LGL P  +
Sbjct: 314 RKLGLNPQQT 323


>gi|254427553|ref|ZP_05041260.1| biotin synthase [Alcanivorax sp. DG881]
 gi|196193722|gb|EDX88681.1| biotin synthase [Alcanivorax sp. DG881]
          Length = 383

 Score =  324 bits (829), Expect = 1e-86,   Method: Composition-based stats.
 Identities = 169/309 (54%), Positives = 229/309 (74%)

Query: 16  PKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQS 75
              W   E+  ++ +PFNDL+F +  +HR +F+PN +Q+S LL+IKTG CPE+C YC+QS
Sbjct: 18  RHDWKRSEIDALFALPFNDLIFQAAALHRAHFDPNAVQVSTLLSIKTGACPEDCKYCSQS 77

Query: 76  VHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSL 135
            H  ++L+  KL+ V +V++EAK A++NGA+R+CMGAAWR P+++D+  ++DMI+ VK L
Sbjct: 78  GHYNTELEKEKLLEVSRVVEEAKAARQNGASRFCMGAAWRSPRDKDMPYVLDMIRQVKDL 137

Query: 136 GLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKS 195
           G+ETCMTLGML   QA  L++AGLDYYNHN+DTS  +Y  V TT T+ DRL TL NVR +
Sbjct: 138 GMETCMTLGMLDEGQAGALAEAGLDYYNHNLDTSPEYYGQVITTRTYNDRLSTLANVRDA 197

Query: 196 GIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEH 255
           G+KVCCGGI+G+GE  +DR+ +L  LANL   PES+PIN+L+ I G+   +   +DP E 
Sbjct: 198 GMKVCCGGIVGMGEERNDRVGLLQQLANLPHHPESVPINMLVKIEGTPLADVDDLDPFEF 257

Query: 256 VRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTI 315
           VR ++VARILMP+S +RL+AGR  M+DE QALCF +GANSIF G+ LLT  NP  N D  
Sbjct: 258 VRTVAVARILMPQSYVRLSAGRQEMNDEAQALCFMAGANSIFYGERLLTTDNPEANHDQR 317

Query: 316 LFNRLGLIP 324
           LF RLG+ P
Sbjct: 318 LFKRLGIHP 326


>gi|238898329|ref|YP_002924010.1| biotin synthetase [Candidatus Hamiltonella defensa 5AT
           (Acyrthosiphon pisum)]
 gi|229466088|gb|ACQ67862.1| biotin synthetase [Candidatus Hamiltonella defensa 5AT
           (Acyrthosiphon pisum)]
          Length = 358

 Score =  324 bits (829), Expect = 2e-86,   Method: Composition-based stats.
 Identities = 164/309 (53%), Positives = 222/309 (71%)

Query: 19  WTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQSVHN 78
           WT ++    +  P  +LLF +  +HR++F+P  +Q+S LL+IKTG CPE+C YC QS   
Sbjct: 7   WTLQKAQAFFEQPLLELLFTAQQIHRQHFDPQQVQISTLLSIKTGACPEDCKYCPQSARY 66

Query: 79  KSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLGLE 138
           ++ LK+ KL+ V+QVL  A+ AK  GATR+CMGAAW+ P  RD+  +  M+KGVK++G+E
Sbjct: 67  RTGLKSEKLMQVEQVLASARQAKAAGATRFCMGAAWKNPHPRDMPYLEQMVKGVKAMGME 126

Query: 139 TCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSGIK 198
           TCMTLG L   QA  L+ AGLDYYNHN+DTS  FY  V TT T+++RL TL+ VR++GIK
Sbjct: 127 TCMTLGTLDKTQADRLANAGLDYYNHNLDTSPEFYSSVITTRTYQERLDTLDEVRQAGIK 186

Query: 199 VCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEHVRI 258
           VC GGI+G+GE   DR  +L+ LANLS PPESIPIN+L+ + G+ FE  + +D  + +R 
Sbjct: 187 VCSGGIIGMGESPKDRAGLLVQLANLSPPPESIPINMLVKVKGTPFEHKEDLDVFDFIRT 246

Query: 259 ISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTILFN 318
           I+VARI+MP S +RL+AGR  M+++ QALCF +GANSIF G  LLT  NPS +KD  LF 
Sbjct: 247 IAVARIMMPASYVRLSAGREKMNEQTQALCFMAGANSIFYGSKLLTTSNPSEDKDVQLFR 306

Query: 319 RLGLIPDLS 327
           +LGL P  +
Sbjct: 307 QLGLNPQWT 315


>gi|254810651|sp|Q12D73|BIOB2_POLSJ RecName: Full=Biotin synthase 2
          Length = 343

 Score =  324 bits (829), Expect = 2e-86,   Method: Composition-based stats.
 Identities = 171/321 (53%), Positives = 230/321 (71%), Gaps = 1/321 (0%)

Query: 3   RSTVVPEENPTKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKT 62
           R    P   P + P  W  +++  +Y +PF DLLF +  VHR++F+ N +QLS LL+IKT
Sbjct: 12  RRAPAPTTAP-QAPLRWQVEDIAALYELPFMDLLFRAQQVHREHFDANEVQLSTLLSIKT 70

Query: 63  GGCPENCGYCNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDL 122
           GGC E+CGYC QS H ++++KASKL+ + +V++ A+ AK+ GATR+CMGAAWR PKERD+
Sbjct: 71  GGCAEDCGYCPQSTHFETEVKASKLMPLAEVIEAARAAKDQGATRFCMGAAWRSPKERDM 130

Query: 123 SIIVDMIKGVKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTF 182
             + ++++ V+SLGLETCMTLGML  EQAQ L  AGLDYYNHN+D++  FY  + +T T+
Sbjct: 131 ERVTEIVREVRSLGLETCMTLGMLQAEQAQALKDAGLDYYNHNLDSAPEFYGDIISTRTY 190

Query: 183 EDRLQTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGS 242
           +DRL TL +VR++GI VCCGGI+G+GE    R  ++  LANLS  PES+PIN L+P+ G+
Sbjct: 191 QDRLDTLGHVRQAGINVCCGGIVGMGESRLQRAGLIAQLANLSPYPESVPINNLVPVAGT 250

Query: 243 KFEENKKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTL 302
                  +DP E VR I+VARI MP + +RL+AGR  M + LQALCF +GANSIF GD L
Sbjct: 251 PLANTAPLDPFEFVRTIAVARITMPLTMVRLSAGREQMDEALQALCFAAGANSIFYGDKL 310

Query: 303 LTAKNPSYNKDTILFNRLGLI 323
           LT  NP  ++D  LF RLGL 
Sbjct: 311 LTTSNPQADRDRQLFERLGLK 331


>gi|110835081|ref|YP_693940.1| biotin synthase [Alcanivorax borkumensis SK2]
 gi|123050320|sp|Q0VMD0|BIOB_ALCBS RecName: Full=Biotin synthase
 gi|110648192|emb|CAL17668.1| biotin synthase [Alcanivorax borkumensis SK2]
          Length = 383

 Score =  324 bits (829), Expect = 2e-86,   Method: Composition-based stats.
 Identities = 169/309 (54%), Positives = 230/309 (74%)

Query: 16  PKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQS 75
              W   E+  ++ +PFNDLLF +  +HR +F+PN +Q+S LL+IKTG CPE+C YC+QS
Sbjct: 18  RHDWKRSEIDALFALPFNDLLFQAAALHRAHFDPNAVQVSTLLSIKTGACPEDCKYCSQS 77

Query: 76  VHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSL 135
            H  ++L+  KL+ V +V++EA+ A++NGA+R+CMGAAWR P+++D+  ++DMI+ VK L
Sbjct: 78  GHYNTELEKEKLLEVSRVVEEARAARQNGASRFCMGAAWRSPRDKDMPYVLDMIRQVKDL 137

Query: 136 GLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKS 195
           G+ETCMTLGML+  QA  L++AGLDYYNHN+DTS  +Y  V TT T+ DRL TL NVR +
Sbjct: 138 GMETCMTLGMLNEGQAGALAEAGLDYYNHNLDTSPEYYGQVITTRTYNDRLSTLANVRDA 197

Query: 196 GIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEH 255
           G+KVCCGGI+G+GE  +DR+ +L  LANL   PES+PIN+L+ I G+   +   +DP E 
Sbjct: 198 GMKVCCGGIVGMGEERNDRVGLLQQLANLPHHPESVPINMLVKIEGTPLADVDDLDPFEF 257

Query: 256 VRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTI 315
           VR ++VARILMP+S +RL+AGR  M+DE QALCF +GANSIF G+ LLT  NP  N D  
Sbjct: 258 VRTVAVARILMPQSYVRLSAGRQEMNDEAQALCFMAGANSIFYGERLLTTDNPEANHDQR 317

Query: 316 LFNRLGLIP 324
           LF RLG+ P
Sbjct: 318 LFKRLGIHP 326


>gi|254810641|sp|Q0A5W1|BIOB_ALHEH RecName: Full=Biotin synthase
          Length = 331

 Score =  324 bits (829), Expect = 2e-86,   Method: Composition-based stats.
 Identities = 166/308 (53%), Positives = 221/308 (71%)

Query: 15  KPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQ 74
               W+  EV  ++  PFNDLL  + T HR +F+PN +Q+S LL+IKTG CPE+C YC Q
Sbjct: 8   PRHDWSKDEVLALFEQPFNDLLHQAQTTHRAHFDPNTVQVSTLLSIKTGACPEDCKYCPQ 67

Query: 75  SVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKS 134
           SV   + L+  +++ V++V+  A+ A++ GATR+CMGAAWR PK+RDL  +  M++ VK+
Sbjct: 68  SVRYDTGLEREQILAVEEVVAAARRARDAGATRFCMGAAWRSPKDRDLETVEAMVREVKA 127

Query: 135 LGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRK 194
           LGLETC+TLGML   QA+ L +AGLDYYNHN+DTSE +Y  + TT +++DRL TL  VR 
Sbjct: 128 LGLETCLTLGMLRDGQAERLREAGLDYYNHNLDTSEDYYDEIITTRSYQDRLDTLARVRD 187

Query: 195 SGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIE 254
           +G+K CCGGI+G+GE   DR ++L TLA+L   P+S+PIN L+ +PG+     +  DP E
Sbjct: 188 AGLKTCCGGIIGMGETRQDRAELLRTLASLPVQPQSVPINQLVQVPGTPLHGVEPPDPFE 247

Query: 255 HVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDT 314
            VR I+VARILMP S +RL+AGR  MSDELQALCF +GANSIF GD LLT  NP  +KD 
Sbjct: 248 FVRTIAVARILMPASYVRLSAGREQMSDELQALCFLAGANSIFYGDKLLTTGNPEADKDR 307

Query: 315 ILFNRLGL 322
            L  RLG+
Sbjct: 308 RLLARLGM 315


>gi|292490892|ref|YP_003526331.1| biotin synthase [Nitrosococcus halophilus Nc4]
 gi|291579487|gb|ADE13944.1| biotin synthase [Nitrosococcus halophilus Nc4]
          Length = 344

 Score =  324 bits (829), Expect = 2e-86,   Method: Composition-based stats.
 Identities = 165/308 (53%), Positives = 218/308 (70%)

Query: 16  PKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQS 75
              W+++EV  +   PF DL+  + TVHR++F+PN +Q+S LL+IKTGGCPE+C YC QS
Sbjct: 15  RHDWSTEEVRALLEQPFVDLIHQAQTVHRRHFDPNQVQVSTLLSIKTGGCPEDCAYCPQS 74

Query: 76  VHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSL 135
               + +KA  L+ +D+VL  A+NAK  GA+R+CMGAAWR  K+R+L  + +MI  VK+L
Sbjct: 75  ARYSTPVKAEPLLPLDEVLATARNAKARGASRFCMGAAWRSLKDRELEPVAEMIVAVKAL 134

Query: 136 GLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKS 195
           GLETC+TLGML   QA+ L  AGLDYYNHN+DTS  FY  + +T T++DRL TL  VR++
Sbjct: 135 GLETCVTLGMLGPGQAERLKAAGLDYYNHNLDTSPEFYGEIISTRTYQDRLDTLARVREA 194

Query: 196 GIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEH 255
           GI VC GGI+G+GE  D R  +L  LANL   PES+PIN+L+ + G+       +DP E 
Sbjct: 195 GIHVCSGGIVGMGEDRDHRAGLLANLANLPRHPESVPINMLVQVEGTPLAGAPALDPFEF 254

Query: 256 VRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTI 315
           VR ++ AR+LMP S +RL+AGR  MSDELQALCF +GANSIF G+ LLT  NP+ + D  
Sbjct: 255 VRTVACARLLMPGSFVRLSAGREAMSDELQALCFLAGANSIFYGEKLLTTPNPTTDHDQQ 314

Query: 316 LFNRLGLI 323
           LF RLGL 
Sbjct: 315 LFERLGLK 322


>gi|295096532|emb|CBK85622.1| biotin synthase [Enterobacter cloacae subsp. cloacae NCTC 9394]
          Length = 338

 Score =  324 bits (829), Expect = 2e-86,   Method: Composition-based stats.
 Identities = 166/305 (54%), Positives = 228/305 (74%)

Query: 23  EVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQSVHNKSKL 82
           +V +++N PF +L+F +  VHR++F+P H+Q+S LL+IKTG CPE+C YC QS   K+ L
Sbjct: 3   QVTELFNKPFLELMFEAQQVHRQHFDPRHVQVSTLLSIKTGACPEDCKYCPQSARYKTGL 62

Query: 83  KASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLGLETCMT 142
           ++ +L+ V+QVL  A+ AK  G+TR+CMGAAW+ P +RD+  +  M+KGVK++GLE CMT
Sbjct: 63  ESERLMEVEQVLDSARKAKNAGSTRFCMGAAWKNPHDRDMPYLEQMVKGVKAMGLEACMT 122

Query: 143 LGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSGIKVCCG 202
           LG L+ EQAQ LS AGLDYYNHN+DTS  FY ++ TT T+++RL TL+ VR +GIKVC G
Sbjct: 123 LGTLNEEQAQRLSAAGLDYYNHNLDTSPEFYGNIITTRTYQERLDTLDKVRDAGIKVCSG 182

Query: 203 GILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEHVRIISVA 262
           GI+GLGE + DR  +LL LANL TPPES+PIN+L+ + G+   +N+ VD  + +R I+VA
Sbjct: 183 GIVGLGETVKDRAGLLLQLANLPTPPESVPINMLVKVKGTPLADNEDVDAFDFIRTIAVA 242

Query: 263 RILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTILFNRLGL 322
           RI+MP S +RL+AGR  MS++ QA+CF +GANSIF G  LLT  NP  +KD  LF +LGL
Sbjct: 243 RIMMPTSYVRLSAGREQMSEQTQAMCFMAGANSIFYGCKLLTTPNPEEDKDVQLFRKLGL 302

Query: 323 IPDLS 327
            P  +
Sbjct: 303 NPHQT 307


>gi|104784035|ref|YP_610533.1| biotin synthetase [Pseudomonas entomophila L48]
 gi|123255204|sp|Q1I3N6|BIOB_PSEE4 RecName: Full=Biotin synthase
 gi|95113022|emb|CAK17750.1| biotin synthetase [Pseudomonas entomophila L48]
          Length = 352

 Score =  323 bits (828), Expect = 2e-86,   Method: Composition-based stats.
 Identities = 166/313 (53%), Positives = 227/313 (72%)

Query: 13  TKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYC 72
                 W+  EV  ++  PFNDLLF + T+HR  F+PN +Q+S LL+IKTG CPE+C YC
Sbjct: 7   ATTRHDWSLAEVKALFQQPFNDLLFQAQTMHRAYFDPNRVQVSTLLSIKTGACPEDCKYC 66

Query: 73  NQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGV 132
            QS H  + L+  KL+ V +VL+EA  AK  G+TR+CMGAAW+ P  +D+  +++M+KGV
Sbjct: 67  PQSGHYNTGLEKQKLMEVQKVLEEAARAKAIGSTRFCMGAAWKHPSAKDMPYVLEMVKGV 126

Query: 133 KSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENV 192
           K++GLETCMTLG L  EQ   L++AGLDYYNHN+DTS  FY  + TT T+ +RLQTL  V
Sbjct: 127 KAMGLETCMTLGKLDQEQTLALAQAGLDYYNHNLDTSPEFYGSIITTRTYSERLQTLAYV 186

Query: 193 RKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDP 252
           R +G+K+C GGILG+GE +DDR  +L+ LANL   PES+PIN+L+ + G+   E + VDP
Sbjct: 187 RDAGMKICSGGILGMGESLDDRAGLLIQLANLPEHPESVPINMLVKVAGTPLAEEEDVDP 246

Query: 253 IEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNK 312
            + +R+++VARILMPKS +RL+AGR  M++++QAL F +GANSIF G+ LLT  NP  +K
Sbjct: 247 FDFIRMLAVARILMPKSHVRLSAGREQMNEQMQALAFMAGANSIFYGEKLLTTANPQADK 306

Query: 313 DTILFNRLGLIPD 325
           D  LF RLG+ P+
Sbjct: 307 DMQLFARLGIKPE 319


>gi|88705177|ref|ZP_01102888.1| biotin synthase [Congregibacter litoralis KT71]
 gi|88700267|gb|EAQ97375.1| biotin synthase [Congregibacter litoralis KT71]
          Length = 359

 Score =  323 bits (828), Expect = 2e-86,   Method: Composition-based stats.
 Identities = 171/310 (55%), Positives = 228/310 (73%)

Query: 16  PKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQS 75
              W  +EV +++ +PF+DLLF + +VHR+ F+PN +Q+S LL+IKTG CPE+C YC QS
Sbjct: 30  RHDWQREEVAELFALPFSDLLFRAQSVHRRYFDPNEVQVSTLLSIKTGACPEDCAYCPQS 89

Query: 76  VHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSL 135
               + L    L+ V+QVL++A+ A+ +GATR+CMGAAWR PK+RDL  ++ MI+GVK L
Sbjct: 90  TRFDTGLSVEALMEVNQVLEQARAARRSGATRFCMGAAWRSPKDRDLPALIAMIEGVKDL 149

Query: 136 GLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKS 195
           GLETCMTLGMLS  QA+ L++AGLDYYNHN+DTS  +Y  + TT T+ DRL+TL +VR +
Sbjct: 150 GLETCMTLGMLSDTQAKTLAEAGLDYYNHNLDTSPEYYGDIITTRTYNDRLETLAHVRDA 209

Query: 196 GIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEH 255
           G+KVC GGI+G+GE   DR+ +L  LANL   PES+PIN+L+ +PG+   E   +DP E 
Sbjct: 210 GMKVCSGGIVGMGEEQSDRVGLLQQLANLPEHPESVPINMLVRVPGTPLAEEGDLDPFEF 269

Query: 256 VRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTI 315
           VR I+VARILMP S +RL+AGR  M+D+ QAL F +GANSIF G+ LLT  NP  N D  
Sbjct: 270 VRTIAVARILMPASHVRLSAGREDMNDQTQALAFLAGANSIFYGEKLLTTANPGANTDLA 329

Query: 316 LFNRLGLIPD 325
           LF RLG+ P+
Sbjct: 330 LFARLGINPE 339


>gi|332534611|ref|ZP_08410444.1| biotin synthase [Pseudoalteromonas haloplanktis ANT/505]
 gi|332035961|gb|EGI72441.1| biotin synthase [Pseudoalteromonas haloplanktis ANT/505]
          Length = 346

 Score =  323 bits (828), Expect = 2e-86,   Method: Composition-based stats.
 Identities = 163/310 (52%), Positives = 226/310 (72%)

Query: 16  PKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQS 75
              WT  EV  ++ MPFNDLLF + +VHR NF PN +Q+S LL+IKTG CPE+C YC QS
Sbjct: 7   RHDWTHAEVKALFEMPFNDLLFKAASVHRANFNPNEVQISTLLSIKTGACPEDCKYCPQS 66

Query: 76  VHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSL 135
            H ++ L+  +LI V++V+++A+ AK+ GATR+CMGAAW +PK+RD+  I  M+K VK L
Sbjct: 67  GHYRTDLERERLIEVEKVVEQARLAKQKGATRFCMGAAWSDPKDRDMPYISQMVKEVKEL 126

Query: 136 GLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKS 195
           GLETCMTLG L+ E+A  L  AGLDYYNHN+DTS  +Y  + +T TF+DRL T+++VR +
Sbjct: 127 GLETCMTLGKLTNEKAHELRDAGLDYYNHNLDTSPEYYEQIISTRTFQDRLNTIDHVRDA 186

Query: 196 GIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEH 255
           G+KVC GGI+G+GE   DR  +L+ LANL   PES+PIN+L+ + G+  E    +D  E 
Sbjct: 187 GMKVCSGGIVGMGEQASDRFGLLMQLANLPQQPESVPINMLVKVKGTPLENVDDLDHFEF 246

Query: 256 VRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTI 315
           +R I+ ARI+MP S +RL+AGR  M++++Q++CFF+GANSIF GD LLT +NP  + D  
Sbjct: 247 IRTIATARIMMPHSYVRLSAGRNAMNEQMQSMCFFAGANSIFYGDKLLTTENPDADADMN 306

Query: 316 LFNRLGLIPD 325
           L  +LG+ P+
Sbjct: 307 LIKKLGMNPE 316


>gi|241661747|ref|YP_002980107.1| biotin synthase [Ralstonia pickettii 12D]
 gi|240863774|gb|ACS61435.1| biotin synthase [Ralstonia pickettii 12D]
          Length = 362

 Score =  323 bits (828), Expect = 2e-86,   Method: Composition-based stats.
 Identities = 167/324 (51%), Positives = 229/324 (70%), Gaps = 3/324 (0%)

Query: 2   SRSTVVPEENPTKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIK 61
           ++    P +NP      W+ + +  ++ +PFNDLLF +  VHR NF+ N +QLS LL+IK
Sbjct: 13  AKVPPTPGQNP---NARWSREAIEALFALPFNDLLFQAQQVHRANFDANAVQLSTLLSIK 69

Query: 62  TGGCPENCGYCNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERD 121
           TGGCPE+C YC QS    + ++A KL+ +D+VL+ A  AK+NGA+R+CMGAAWR PK   
Sbjct: 70  TGGCPEDCSYCPQSARYDTGVEAEKLMPIDEVLEAASRAKQNGASRFCMGAAWRNPKPHQ 129

Query: 122 LSIIVDMIKGVKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHT 181
           L  + DM++GVK++GLETC+TLGML  EQA  L +AGLDYYNHN+DT+  FY  + TT T
Sbjct: 130 LDAVADMVRGVKAMGLETCVTLGMLKQEQAAQLKEAGLDYYNHNLDTAPEFYGEIITTRT 189

Query: 182 FEDRLQTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPG 241
           ++DRL TLE+VR +GI VCCGGI+GLGE + +R  ++  LAN+   P+S+PIN L+ + G
Sbjct: 190 YQDRLDTLEHVRDAGINVCCGGIVGLGESVHERAGLIAELANMEPYPDSVPINNLVKVEG 249

Query: 242 SKFEENKKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDT 301
           +    N+++DP + VR I+VARI MPK+ +RL+AGR  M D LQALCF +GANSIF G+ 
Sbjct: 250 TPLAGNEELDPFDFVRTIAVARITMPKAMVRLSAGREAMDDALQALCFMAGANSIFYGEK 309

Query: 302 LLTAKNPSYNKDTILFNRLGLIPD 325
           LLT  NP  + D  L  RLG+  +
Sbjct: 310 LLTTDNPEADADRKLLARLGMRVE 333


>gi|300715917|ref|YP_003740720.1| Biotin synthase [Erwinia billingiae Eb661]
 gi|299061753|emb|CAX58869.1| Biotin synthase [Erwinia billingiae Eb661]
          Length = 343

 Score =  323 bits (828), Expect = 2e-86,   Method: Composition-based stats.
 Identities = 164/310 (52%), Positives = 223/310 (71%)

Query: 18  VWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQSVH 77
            WT  +   +++ PF +L+F +  VHR++F+P  +Q+S LL+IKTG CPE+C YC QS  
Sbjct: 4   RWTIPQAQALFDKPFLELMFEAQQVHRQHFDPRQVQVSTLLSIKTGACPEDCKYCPQSSR 63

Query: 78  NKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLGL 137
            K+ L   +L+ V+ VL  A+ AK  G+ R+CMGAAW+ P ERD+  +  M+KGV+ +GL
Sbjct: 64  YKTGLATERLMEVEDVLTSARKAKAAGSDRFCMGAAWKNPHERDMPYLEQMVKGVREMGL 123

Query: 138 ETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSGI 197
           ETCMTLG LS EQAQ L+ AGLDYYNHN+DTS  FY  + TT ++++RL TL  VR +GI
Sbjct: 124 ETCMTLGTLSEEQAQRLAHAGLDYYNHNLDTSPEFYGSIITTRSYQERLDTLGKVRDAGI 183

Query: 198 KVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEHVR 257
           KVC GGILGLGE ++DR  +L+ LANL TPPES+PIN+L+ + G+   +N  VDP + +R
Sbjct: 184 KVCSGGILGLGETVNDRAGLLVQLANLPTPPESVPINMLVKVKGTPLADNDDVDPFDFIR 243

Query: 258 IISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTILF 317
            I+VARI+MP S +RL+AGR  MS++ QA+CF +GANSIF G  LLT  NP  +KD  LF
Sbjct: 244 AIAVARIMMPTSHVRLSAGREQMSEQTQAMCFMAGANSIFYGCKLLTTPNPEEDKDLQLF 303

Query: 318 NRLGLIPDLS 327
           ++LGL P  +
Sbjct: 304 HKLGLNPRHT 313


>gi|261343470|ref|ZP_05971115.1| biotin synthase [Providencia rustigianii DSM 4541]
 gi|282568618|gb|EFB74153.1| biotin synthase [Providencia rustigianii DSM 4541]
          Length = 345

 Score =  323 bits (828), Expect = 2e-86,   Method: Composition-based stats.
 Identities = 169/309 (54%), Positives = 229/309 (74%)

Query: 17  KVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQSV 76
           K WT K+  ++++MPF +LLF +  VHR++F+P  +Q+S LL+IKTG CPE+C YC QS 
Sbjct: 5   KQWTIKQANELFSMPFFELLFQAQQVHRQHFDPQQVQVSTLLSIKTGACPEDCKYCAQSA 64

Query: 77  HNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLG 136
             K+ L+  +L+ V QVL+ AK AK  G+TR+CMGAAWR PKERD+  +  M+K VK+LG
Sbjct: 65  RYKTGLETERLMEVQQVLESAKKAKHAGSTRFCMGAAWRNPKERDMPYLEMMVKEVKALG 124

Query: 137 LETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSG 196
           +ETCMTLGM+   QA  L++AGLDYYNHN+DTS  +Y ++ TT T++DRL TL NVR +G
Sbjct: 125 METCMTLGMIDDSQASRLAEAGLDYYNHNLDTSPEYYGNIITTRTYQDRLDTLNNVRSAG 184

Query: 197 IKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEHV 256
           IKVC GGILGLGE + DR  +L+ LANL  PPES+PIN+L+ + G+   +N+ VDP + +
Sbjct: 185 IKVCSGGILGLGEKVSDRAALLVQLANLPKPPESVPINMLMKVEGTPMADNEDVDPFDFI 244

Query: 257 RIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTIL 316
           R I+VARI+MP S +RL+AGR  M+++ QALCF +GANS+F G  LLT  NP  NKD  L
Sbjct: 245 RTIAVARIMMPTSYVRLSAGREHMNEQTQALCFMAGANSVFYGCKLLTTPNPDENKDIAL 304

Query: 317 FNRLGLIPD 325
           F +L + P+
Sbjct: 305 FRKLNINPE 313


>gi|126666963|ref|ZP_01737939.1| biotin synthase [Marinobacter sp. ELB17]
 gi|126628679|gb|EAZ99300.1| biotin synthase [Marinobacter sp. ELB17]
          Length = 354

 Score =  323 bits (827), Expect = 2e-86,   Method: Composition-based stats.
 Identities = 172/311 (55%), Positives = 235/311 (75%)

Query: 16  PKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQS 75
              WT ++   ++ +PF+DLLF + T+HR+ F+PN +Q+S LL+IKTG CPE+C YC QS
Sbjct: 7   RHDWTLQQARTLFELPFSDLLFRAQTLHRQYFDPNEVQISTLLSIKTGACPEDCKYCPQS 66

Query: 76  VHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSL 135
            H  + LK  KL++V++V+ EA+ AK  GA+R+CMGAAWR P ++D+  ++DM+K VKS+
Sbjct: 67  GHYNTGLKKEKLLDVEKVVAEARAAKAKGASRFCMGAAWRSPSKKDMPYVLDMVKQVKSM 126

Query: 136 GLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKS 195
           G+ETCMTLGML  EQA  L+ AGLDYYNHN+DTSERFY H+ TT T++DRL TL NVR S
Sbjct: 127 GMETCMTLGMLKSEQADELAAAGLDYYNHNLDTSERFYSHIITTRTYQDRLDTLSNVRNS 186

Query: 196 GIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEH 255
           G+KVCCGGILG+GE  DDR+ +L+ LANL   PES+P+N+L+ + G+  E    +DP + 
Sbjct: 187 GMKVCCGGILGMGEDDDDRMGLLMQLANLPQHPESVPVNMLVKVKGTPLENVADLDPFDF 246

Query: 256 VRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTI 315
           VR+I+VARI+MP S +RL+AGR  M++++QALCF +GANSIF G+ LLT  NP  + D  
Sbjct: 247 VRMIAVARIMMPASHVRLSAGREDMNEQMQALCFMAGANSIFYGEKLLTTANPEADADMA 306

Query: 316 LFNRLGLIPDL 326
           LF RLG+ P+ 
Sbjct: 307 LFRRLGIRPEQ 317


>gi|262375412|ref|ZP_06068645.1| biotin synthase [Acinetobacter lwoffii SH145]
 gi|262309666|gb|EEY90796.1| biotin synthase [Acinetobacter lwoffii SH145]
          Length = 333

 Score =  323 bits (827), Expect = 3e-86,   Method: Composition-based stats.
 Identities = 168/311 (54%), Positives = 231/311 (74%)

Query: 16  PKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQS 75
              W+ +E+  +Y  P  DL+F +  VHR++F  N +Q+S LL+IKTG CPE+C YC+QS
Sbjct: 8   RNDWSREEIQALYQQPLMDLVFQAQQVHREHFTANTVQVSTLLSIKTGKCPEDCKYCSQS 67

Query: 76  VHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSL 135
            H  SKL+A K I VD+V++EAK A  +G++R+CMGAAWR P ERD+  +++M++ VK+L
Sbjct: 68  AHYDSKLEAEKRIAVDKVIQEAKQALASGSSRFCMGAAWRNPHERDMPYVLEMVREVKAL 127

Query: 136 GLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKS 195
           GLETCMTLGML+  QA+ L  AGLDYYNHN+DTS  +Y H+ +T +F+DRL TL++VR++
Sbjct: 128 GLETCMTLGMLNGSQAERLKDAGLDYYNHNLDTSREYYSHIISTRSFDDRLDTLDHVRQA 187

Query: 196 GIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEH 255
           G+KVC GGI+GLGE  DDRI +L  LA L+  PES+PIN+L+PI G+   + +K+D IE 
Sbjct: 188 GMKVCSGGIVGLGESRDDRIGLLYELATLAIHPESVPINMLVPIEGTPMADVEKLDVIEW 247

Query: 256 VRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTI 315
           +R I+VAR+LMPKS +RL+AGR  +SD  QAL F +GANSIF G+ LLT  N S  +D  
Sbjct: 248 IRTIAVARLLMPKSYIRLSAGRESLSDSDQALAFMAGANSIFSGEKLLTTPNTSQGRDQQ 307

Query: 316 LFNRLGLIPDL 326
           LF +LGL+ + 
Sbjct: 308 LFAKLGLVAEQ 318


>gi|91787465|ref|YP_548417.1| biotin synthase [Polaromonas sp. JS666]
 gi|91696690|gb|ABE43519.1| biotin synthase [Polaromonas sp. JS666]
          Length = 344

 Score =  323 bits (827), Expect = 3e-86,   Method: Composition-based stats.
 Identities = 167/306 (54%), Positives = 225/306 (73%)

Query: 18  VWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQSVH 77
            W  +++  +Y +PF DLLF +  VHR++F+ N +QLS LL+IKTGGC E+CGYC QS H
Sbjct: 27  RWQVEDIAALYELPFMDLLFRAQQVHREHFDANEVQLSTLLSIKTGGCAEDCGYCPQSTH 86

Query: 78  NKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLGL 137
            ++++KASKL+ + +V++ A+ AK+ GATR+CMGAAWR PKERD+  + ++++ V+SLGL
Sbjct: 87  FETEVKASKLMPLAEVIEAARAAKDQGATRFCMGAAWRSPKERDMERVTEIVREVRSLGL 146

Query: 138 ETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSGI 197
           ETCMTLGML  EQAQ L  AGLDYYNHN+D++  FY  + +T T++DRL TL +VR++GI
Sbjct: 147 ETCMTLGMLQAEQAQALKDAGLDYYNHNLDSAPEFYGDIISTRTYQDRLDTLGHVRQAGI 206

Query: 198 KVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEHVR 257
            VCCGGI+G+GE    R  ++  LANLS  PES+PIN L+P+ G+       +DP E VR
Sbjct: 207 NVCCGGIVGMGESRLQRAGLIAQLANLSPYPESVPINNLVPVAGTPLANTAPLDPFEFVR 266

Query: 258 IISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTILF 317
            I+VARI MP + +RL+AGR  M + LQALCF +GANSIF GD LLT  NP  ++D  LF
Sbjct: 267 TIAVARITMPLTMVRLSAGREQMDEALQALCFAAGANSIFYGDKLLTTSNPQADRDRQLF 326

Query: 318 NRLGLI 323
            RLGL 
Sbjct: 327 ERLGLK 332


>gi|330445759|ref|ZP_08309411.1| biotin synthase [Photobacterium leiognathi subsp. mandapamensis
           svers.1.1.]
 gi|328489950|dbj|GAA03908.1| biotin synthase [Photobacterium leiognathi subsp. mandapamensis
           svers.1.1.]
          Length = 350

 Score =  323 bits (827), Expect = 3e-86,   Method: Composition-based stats.
 Identities = 162/313 (51%), Positives = 233/313 (74%)

Query: 16  PKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQS 75
              WT +EV  +++ PF DL+F +  VHR+  +PN +Q+S LL+IKTG CPE+C YC QS
Sbjct: 4   RNNWTVEEVQALFDKPFMDLVFEAQQVHRQYHQPNQVQVSTLLSIKTGACPEDCKYCPQS 63

Query: 76  VHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSL 135
            H ++ +   +L+ V++VL  A  AK++GATR+CMGAAW+ PKERD+  ++DM+KGVK++
Sbjct: 64  AHYRTDVDKERLLEVERVLDAANKAKQSGATRFCMGAAWKNPKERDMPYLLDMVKGVKAM 123

Query: 136 GLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKS 195
           GLETCMTLGM++ +QA  L++AGLDYYNHN+DTS  +Y ++ TT T++DRL TL +VR +
Sbjct: 124 GLETCMTLGMITGDQANTLAEAGLDYYNHNLDTSPEYYGNIITTRTYQDRLDTLSHVRDA 183

Query: 196 GIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEH 255
           G+K+C GGI+G+GE   DR  +L+ LANL   PES+PIN+L+ + G+  E  + VDP + 
Sbjct: 184 GMKICSGGIIGMGESSRDRAGLLVELANLPVHPESVPINMLVKVKGTPLESAEDVDPFDF 243

Query: 256 VRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTI 315
           +RI++VARI+MPKS +RL+AGR  M++++QALCF +GANS+F G  LLT  NP  +KD  
Sbjct: 244 IRIVAVARIIMPKSAVRLSAGREDMNEQMQALCFMAGANSVFYGCKLLTTPNPGEDKDMQ 303

Query: 316 LFNRLGLIPDLSA 328
           LF +LG+  +  A
Sbjct: 304 LFAKLGINSEQQA 316


>gi|77461397|ref|YP_350904.1| biotin synthase [Pseudomonas fluorescens Pf0-1]
 gi|123730890|sp|Q3K5P1|BIOB_PSEPF RecName: Full=Biotin synthase
 gi|77385400|gb|ABA76913.1| biotin synthase [Pseudomonas fluorescens Pf0-1]
          Length = 351

 Score =  322 bits (826), Expect = 4e-86,   Method: Composition-based stats.
 Identities = 167/310 (53%), Positives = 228/310 (73%)

Query: 16  PKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQS 75
              WT  EV  ++  PFNDLLF + TVHR +F+ N +Q+S LL+IKTG CPE+C YC QS
Sbjct: 10  RHDWTLAEVKALFVQPFNDLLFQAQTVHRAHFDANRVQVSTLLSIKTGACPEDCKYCPQS 69

Query: 76  VHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSL 135
            H  + L+  KL+ V +VL+EA  AK  G+TR+CMGAAW+ P  +D+  ++ M++GVK++
Sbjct: 70  GHYNTGLEKEKLMEVQKVLEEAARAKAIGSTRFCMGAAWKHPSAKDMPYVLKMVEGVKAM 129

Query: 136 GLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKS 195
           GLETCMTLG L  +Q + L+KAGLDYYNHN+DTS  FY  + TT T+ +RLQTL  VR +
Sbjct: 130 GLETCMTLGRLDQDQTEALAKAGLDYYNHNLDTSPEFYGSIITTRTYAERLQTLAYVRDA 189

Query: 196 GIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEH 255
           G+K+C GGILG+GE +DDR ++L+ LANL   PES+PIN+L+ + G+  E    VDP + 
Sbjct: 190 GMKICSGGILGMGESLDDRANLLIQLANLPEHPESVPINMLVKVAGTPLENADDVDPFDF 249

Query: 256 VRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTI 315
           +R+++VARILMP+S +RL+AGR  M++++QAL FF+GANSIF GD LLT  NP  +KD  
Sbjct: 250 IRMLAVARILMPQSHVRLSAGREAMNEQMQALAFFAGANSIFYGDKLLTTANPQADKDMQ 309

Query: 316 LFNRLGLIPD 325
           LF RLG+ P+
Sbjct: 310 LFARLGIQPE 319


>gi|251790137|ref|YP_003004858.1| biotin synthase [Dickeya zeae Ech1591]
 gi|247538758|gb|ACT07379.1| biotin synthase [Dickeya zeae Ech1591]
          Length = 346

 Score =  322 bits (826), Expect = 4e-86,   Method: Composition-based stats.
 Identities = 158/309 (51%), Positives = 229/309 (74%)

Query: 19  WTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQSVHN 78
           WT ++   +++ PF +L+F +  VHR++F+P  +Q+S LL+IKTG CPE+C YC QS   
Sbjct: 8   WTLEQAQALFDKPFLELMFEAQQVHRRHFDPRQVQVSTLLSIKTGACPEDCKYCPQSARY 67

Query: 79  KSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLGLE 138
           ++ ++  +L+ V+QVL+ A+ AK  G+TR+CMGAAW+ P ERD+  +  M++GVK +G+E
Sbjct: 68  RTGIEIERLMQVEQVLESARQAKATGSTRFCMGAAWKNPHERDMPYLESMVRGVKEMGME 127

Query: 139 TCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSGIK 198
           TCMTLG L  +QA+ L+ AGLD+YNHN+DTS  FY ++ TT T+++RL TL+ VR +GIK
Sbjct: 128 TCMTLGTLHGDQAERLAAAGLDFYNHNLDTSPEFYGNIITTRTYQERLDTLDKVRGAGIK 187

Query: 199 VCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEHVRI 258
           VC GGI+GLGE + DR  +L+ LANL TPPES+PIN+L+ + G+   EN+ +DP + +R 
Sbjct: 188 VCSGGIVGLGETVRDRAGLLVQLANLPTPPESVPINMLVKVKGTPLAENEDLDPFDFIRT 247

Query: 259 ISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTILFN 318
           I+VARI+MP S +RL+AGR  M+++ QA+CF +GANSIF G  LLT  NP  +KD +LF 
Sbjct: 248 IAVARIMMPTSYVRLSAGREQMNEQTQAMCFMAGANSIFYGCKLLTTPNPKEDKDLLLFR 307

Query: 319 RLGLIPDLS 327
           +LGL P  +
Sbjct: 308 KLGLNPQQT 316


>gi|285017172|ref|YP_003374883.1| biotin synthase [Xanthomonas albilineans GPE PC73]
 gi|283472390|emb|CBA14895.1| probable biotin synthase protein [Xanthomonas albilineans]
          Length = 347

 Score =  322 bits (825), Expect = 4e-86,   Method: Composition-based stats.
 Identities = 159/311 (51%), Positives = 218/311 (70%)

Query: 16  PKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQS 75
              W  +E+  ++++PF +LL  +  VHR++F+P  +Q+S LL++KTGGCPE+C YC Q+
Sbjct: 6   RHDWQRQELLALFDLPFPELLHRAAQVHREHFDPAQVQVSTLLSVKTGGCPEDCAYCPQA 65

Query: 76  VHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSL 135
               + ++A KL++ + VL +A+ AK  GA+R+CMGAAWR PKERD+  + +MI+ VK+L
Sbjct: 66  QRYNTGVEAQKLMSTEAVLSKARQAKAAGASRFCMGAAWRSPKERDIPKVAEMIREVKAL 125

Query: 136 GLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKS 195
           GLETC TLGML   QAQ L  AGLDYYNHN+DT+  FY  +  T  ++DRL TL +VR +
Sbjct: 126 GLETCATLGMLDGAQAQALKAAGLDYYNHNLDTAPDFYDTIIHTRQYQDRLDTLAHVRDA 185

Query: 196 GIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEH 255
           G+K CCGGI+G+GE  D R  +L  LANL   P+S+PIN L+ + G+      ++D  E 
Sbjct: 186 GLKTCCGGIVGMGESRDQRAGLLQALANLPVHPDSVPINRLVQVAGTPLHGTAELDAFEF 245

Query: 256 VRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTI 315
           VR I+VARI+MP++ +RL+AGR  MSDELQALCF +GANSIF G+ LLT  NP   +D  
Sbjct: 246 VRTIAVARIVMPQAMVRLSAGRESMSDELQALCFCAGANSIFYGEKLLTTGNPDTERDQA 305

Query: 316 LFNRLGLIPDL 326
           LF RLGL P  
Sbjct: 306 LFARLGLRPMQ 316


>gi|300705381|ref|YP_003746984.1| biotin synthetase [Ralstonia solanacearum CFBP2957]
 gi|299073045|emb|CBJ44402.1| biotin synthetase [Ralstonia solanacearum CFBP2957]
          Length = 362

 Score =  322 bits (825), Expect = 4e-86,   Method: Composition-based stats.
 Identities = 168/324 (51%), Positives = 226/324 (69%), Gaps = 3/324 (0%)

Query: 2   SRSTVVPEENPTKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIK 61
           ++   VP +NP      W+ + +  ++ +PFNDLLF +  VHR NF+ N +QLS LL+IK
Sbjct: 13  AKVPPVPGQNP---NARWSREAIEALFALPFNDLLFQAQQVHRANFDANAVQLSTLLSIK 69

Query: 62  TGGCPENCGYCNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERD 121
           TGGCPE+C YC QS    + ++A KL+ +D VL+ A  A++NGA+R+CMGAAWR PK   
Sbjct: 70  TGGCPEDCSYCPQSARYDTGVEAEKLMPIDAVLEAAARARQNGASRFCMGAAWRNPKPHQ 129

Query: 122 LSIIVDMIKGVKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHT 181
           L  + DM++GVK++GLETC+TLGML  EQAQ L  AGLDYYNHN+DT+  FY  + TT T
Sbjct: 130 LDAVADMVRGVKAMGLETCVTLGMLKQEQAQQLKDAGLDYYNHNLDTAPEFYGEIITTRT 189

Query: 182 FEDRLQTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPG 241
           ++DRL TL +VR +GI VCCGGI+GLGE   +R  ++  LAN+   P+S+PIN L+ + G
Sbjct: 190 YQDRLDTLGHVRDAGINVCCGGIVGLGESRHERAGLVAELANMEPYPDSVPINNLVKVEG 249

Query: 242 SKFEENKKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDT 301
           +    N+ +DP E VR I+VARI MPK+ +RL+AGR  M D LQALCF +GANSIF G+ 
Sbjct: 250 TPLAGNEALDPFEFVRTIAVARITMPKAMVRLSAGREAMDDALQALCFMAGANSIFYGEK 309

Query: 302 LLTAKNPSYNKDTILFNRLGLIPD 325
           LLT  NP  + D  L  RLG+  +
Sbjct: 310 LLTTDNPEADADRKLLARLGMRVE 333


>gi|152997460|ref|YP_001342295.1| biotin synthase [Marinomonas sp. MWYL1]
 gi|150838384|gb|ABR72360.1| biotin synthase [Marinomonas sp. MWYL1]
          Length = 364

 Score =  322 bits (825), Expect = 4e-86,   Method: Composition-based stats.
 Identities = 168/319 (52%), Positives = 231/319 (72%)

Query: 7   VPEENPTKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCP 66
           +   N +     WT  E+  ++++PF DL+F + TVHR+NF PN +Q+S LL+IKTG CP
Sbjct: 14  MSINNISAPRFDWTHAEIKALFDLPFMDLMFRAQTVHRENFAPNEVQVSTLLSIKTGACP 73

Query: 67  ENCGYCNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIV 126
           E+C YC QS H  ++L+  KL+ V +VL+EA  AKE GA+R+CMGAAW+ P E+D   ++
Sbjct: 74  EDCKYCPQSGHYNTELEKEKLMEVQKVLEEAALAKEKGASRFCMGAAWKHPSEKDFPYVL 133

Query: 127 DMIKGVKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRL 186
           +MIKGVKSLGLE+C+TLG L+ +QA+ LS+ GLDYYNHN+DTS  FY  + TT T++DRL
Sbjct: 134 EMIKGVKSLGLESCVTLGSLNDDQAKRLSEVGLDYYNHNLDTSAEFYDSIITTRTYQDRL 193

Query: 187 QTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEE 246
            TL  VR SGIK+CCGGI+G+GE   DR+ +L  L+ ++  PES+PIN+L+ + G+  E 
Sbjct: 194 DTLSRVRDSGIKLCCGGIMGMGEEQKDRVGLLRQLSQMTPHPESVPINMLVKVEGTPLEN 253

Query: 247 NKKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAK 306
              +D  E +R I+VARILMPKS +RL+AGR  M+++ QALCF +GANSIF G+ LLT  
Sbjct: 254 VDDLDTFEFIRTIAVARILMPKSHVRLSAGRQGMNEQTQALCFMAGANSIFYGEKLLTTG 313

Query: 307 NPSYNKDTILFNRLGLIPD 325
           NP  +KD  LF  LG+ P+
Sbjct: 314 NPEADKDMALFANLGINPE 332


>gi|17544985|ref|NP_518387.1| biotin synthase [Ralstonia solanacearum GMI1000]
 gi|81592457|sp|Q8Y2R9|BIOB_RALSO RecName: Full=Biotin synthase
 gi|17427275|emb|CAD13794.1| probable biotin synthase protein [Ralstonia solanacearum GMI1000]
          Length = 360

 Score =  322 bits (825), Expect = 4e-86,   Method: Composition-based stats.
 Identities = 165/308 (53%), Positives = 220/308 (71%)

Query: 18  VWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQSVH 77
            W+ + +  ++ +PFNDLLF +  VHR +F+ N +QLS LL+IKTGGCPE+C YC QS  
Sbjct: 26  RWSREAIEALFALPFNDLLFQAQQVHRAHFDANAVQLSTLLSIKTGGCPEDCSYCPQSAR 85

Query: 78  NKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLGL 137
             + ++A KL+ +D VL+ A  AK+NGA+R+CMGAAWR PK   L  + DM++GVK++GL
Sbjct: 86  YDTGVEAEKLMPIDTVLEAAARAKQNGASRFCMGAAWRNPKPHQLDAVADMVRGVKAMGL 145

Query: 138 ETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSGI 197
           ETC+TLGML  EQAQ L  AGLDYYNHN+DT+  FY  + TT T++DRL TLE+VR +GI
Sbjct: 146 ETCVTLGMLKQEQAQQLKDAGLDYYNHNLDTAPEFYGEIITTRTYQDRLDTLEHVRDAGI 205

Query: 198 KVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEHVR 257
            VCCGGI+GLGE   +R  ++  LAN+   P+S+PIN L+ + G+    N+ +DP E VR
Sbjct: 206 NVCCGGIVGLGESRHERAGLVAELANMEPYPDSVPINNLVKVEGTPLAGNEALDPFEFVR 265

Query: 258 IISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTILF 317
            I+VARI MPK+ +RL+AGR  M D LQALCF +GANSIF G+ LLT  NP  + D  L 
Sbjct: 266 TIAVARITMPKAMVRLSAGREAMDDALQALCFMAGANSIFYGEKLLTTDNPEADADRKLL 325

Query: 318 NRLGLIPD 325
            RLG+  +
Sbjct: 326 ARLGMRVE 333


>gi|270260800|ref|ZP_06189073.1| biotin synthase [Serratia odorifera 4Rx13]
 gi|270044284|gb|EFA17375.1| biotin synthase [Serratia odorifera 4Rx13]
          Length = 345

 Score =  322 bits (825), Expect = 5e-86,   Method: Composition-based stats.
 Identities = 162/309 (52%), Positives = 226/309 (73%)

Query: 19  WTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQSVHN 78
           WT      +++ P  +LLF + TVHR++F+P  +Q+S LL+IKTG CPE+C YC QS   
Sbjct: 7   WTVGLAQTLFDKPLLELLFEAQTVHRRHFDPRQVQVSTLLSIKTGACPEDCKYCPQSSRY 66

Query: 79  KSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLGLE 138
           K+ L+  +L+ V+QVL+ A+ AK NG+TR+CMGAAW+ P ERD+  +  M++GVK++G+E
Sbjct: 67  KTGLETERLMQVEQVLESARKAKANGSTRFCMGAAWKNPHERDMPYLQQMVQGVKAMGME 126

Query: 139 TCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSGIK 198
           TCMTLG L   QA+ L+ AGLDYYNHN+DTS  FY ++ TT ++++RL TL+ VR +GIK
Sbjct: 127 TCMTLGTLDHTQAERLADAGLDYYNHNLDTSPEFYGNIITTRSYQERLDTLDKVRGAGIK 186

Query: 199 VCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEHVRI 258
           VC GGI+GLGE + DR  +L+ LANL TPPES+PIN+L+ + G+   +N  VDP + +R 
Sbjct: 187 VCSGGIVGLGETVRDRAGLLVQLANLPTPPESVPINMLVKVKGTPLADNDDVDPFDFIRT 246

Query: 259 ISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTILFN 318
           I+VARI+MP S +RL+AGR  M+++ QA+CF +GANSIF G  LLT  NP  +KD  LF 
Sbjct: 247 IAVARIMMPASYVRLSAGREQMNEQTQAMCFMAGANSIFYGCKLLTTPNPEEDKDLQLFR 306

Query: 319 RLGLIPDLS 327
           +LGL P  +
Sbjct: 307 KLGLNPQQT 315


>gi|332140853|ref|YP_004426591.1| Biotin synthase [Alteromonas macleodii str. 'Deep ecotype']
 gi|254810546|sp|B4S0P9|BIOB_ALTMD RecName: Full=Biotin synthase
 gi|327550875|gb|AEA97593.1| Biotin synthase [Alteromonas macleodii str. 'Deep ecotype']
          Length = 374

 Score =  322 bits (825), Expect = 5e-86,   Method: Composition-based stats.
 Identities = 164/321 (51%), Positives = 231/321 (71%)

Query: 7   VPEENPTKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCP 66
            P          WT  EV  ++ MPFNDLLF +  VHR++F PN +Q+S LL+IKTG CP
Sbjct: 6   APTAQTITIRNDWTKAEVEALFAMPFNDLLFNAQVVHRQHFNPNEVQVSTLLSIKTGACP 65

Query: 67  ENCGYCNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIV 126
           E+C YC QS    + L+  +L+ +++V++ AK AK+ G+TR+CMGAAWR P++RD+  I+
Sbjct: 66  EDCKYCPQSARYDTGLEKERLLEIEKVIQRAKEAKQVGSTRFCMGAAWRNPRDRDMPYIL 125

Query: 127 DMIKGVKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRL 186
            M++ VKSLGLETCMTLGML+ +QA  L +AGLDYYNHN+DTS  +Y  + TT T+EDRL
Sbjct: 126 KMVEEVKSLGLETCMTLGMLTRDQAVALKQAGLDYYNHNLDTSPEYYGDIITTRTYEDRL 185

Query: 187 QTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEE 246
            TLENVR +G+ VC GGI+G+GE + DR  ML+ LANL   P+S+PIN+L+ + G+  + 
Sbjct: 186 NTLENVRAAGMNVCSGGIVGMGETVSDRASMLVQLANLPEQPQSVPINMLVKVKGTPLDS 245

Query: 247 NKKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAK 306
            + +D  E +R I+VARI+MPKS +RL+AGR  M++++QA+CF +GANSIF G  LLT  
Sbjct: 246 VEDLDYFEFIRTIAVARIMMPKSHVRLSAGREAMNEQMQAMCFMAGANSIFYGCKLLTTS 305

Query: 307 NPSYNKDTILFNRLGLIPDLS 327
           NP  ++D +LF +LG+  + +
Sbjct: 306 NPDTHEDVMLFKKLGINTERT 326


>gi|291085666|ref|ZP_06353671.2| biotin synthase [Citrobacter youngae ATCC 29220]
 gi|291070602|gb|EFE08711.1| biotin synthase [Citrobacter youngae ATCC 29220]
          Length = 338

 Score =  322 bits (825), Expect = 5e-86,   Method: Composition-based stats.
 Identities = 163/306 (53%), Positives = 227/306 (74%)

Query: 23  EVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQSVHNKSKL 82
           +V +++  P  DLLF +  VHR++F+P  +Q+S LL+IKTG CPE+C YC QS   K+ L
Sbjct: 3   QVTELFEKPLLDLLFEAQQVHRQHFDPQQVQVSTLLSIKTGACPEDCKYCPQSSRYKTGL 62

Query: 83  KASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLGLETCMT 142
           +  +L+ V+QVL  A+ AK+ G+TR+CMGAAW+ P ERD+  +  M++GVK+LGLE CMT
Sbjct: 63  ETERLMEVEQVLDSARKAKQAGSTRFCMGAAWKNPHERDMPYLEQMVQGVKALGLEACMT 122

Query: 143 LGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSGIKVCCG 202
           LG L+  QAQ L+ AGLDYYNHN+DTS  FY ++ TT ++++RL TL+ VR++GIKVC G
Sbjct: 123 LGTLNETQAQRLANAGLDYYNHNLDTSPEFYGNIITTRSYQERLDTLDKVREAGIKVCSG 182

Query: 203 GILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEHVRIISVA 262
           GI+GLGE + DR  +LL LANL TPPES+PIN+L+ + G+   +N  VD  + +R I+VA
Sbjct: 183 GIVGLGETVTDRAGLLLQLANLPTPPESVPINMLVKVKGTPLADNDDVDAFDFIRTIAVA 242

Query: 263 RILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTILFNRLGL 322
           RI+MP S +RL+AGR  M+++ QA+CF +GANSIF G  LLT  NP+ +KD +LF +LGL
Sbjct: 243 RIMMPTSYVRLSAGREQMNEQTQAMCFMAGANSIFYGCKLLTTPNPNEDKDLLLFRKLGL 302

Query: 323 IPDLSA 328
            P  +A
Sbjct: 303 NPQQTA 308


>gi|184157874|ref|YP_001846213.1| biotin synthase [Acinetobacter baumannii ACICU]
 gi|213157070|ref|YP_002319115.1| biotin synthase [Acinetobacter baumannii AB0057]
 gi|215483651|ref|YP_002325872.1| biotin synthase [Acinetobacter baumannii AB307-0294]
 gi|239502248|ref|ZP_04661558.1| biotin synthetase [Acinetobacter baumannii AB900]
 gi|301347628|ref|ZP_07228369.1| biotin synthase [Acinetobacter baumannii AB056]
 gi|301510313|ref|ZP_07235550.1| biotin synthase [Acinetobacter baumannii AB058]
 gi|301596865|ref|ZP_07241873.1| biotin synthase [Acinetobacter baumannii AB059]
 gi|254810530|sp|B7H3S4|BIOB_ACIB3 RecName: Full=Biotin synthase
 gi|254810531|sp|B7I4I4|BIOB_ACIB5 RecName: Full=Biotin synthase
 gi|254810532|sp|B2HYX9|BIOB_ACIBC RecName: Full=Biotin synthase
 gi|254810648|sp|A3M4U4|BIOB_ACIBT RecName: Full=Biotin synthase
 gi|254810649|sp|B0VCA8|BIOB_ACIBY RecName: Full=Biotin synthase
 gi|183209468|gb|ACC56866.1| Biotin synthase [Acinetobacter baumannii ACICU]
 gi|193077156|gb|ABO11938.2| biotin synthase [Acinetobacter baumannii ATCC 17978]
 gi|213056230|gb|ACJ41132.1| biotin synthase [Acinetobacter baumannii AB0057]
 gi|213988384|gb|ACJ58683.1| biotin synthase [Acinetobacter baumannii AB307-0294]
          Length = 329

 Score =  322 bits (824), Expect = 5e-86,   Method: Composition-based stats.
 Identities = 170/310 (54%), Positives = 229/310 (73%)

Query: 16  PKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQS 75
              WT +E+  +Y  PF DL+F +  VHR++F  N IQ+S LL+IKTG CPE+C YC+QS
Sbjct: 4   RNDWTREEIQALYEQPFLDLVFKAQQVHREHFTANTIQVSTLLSIKTGKCPEDCKYCSQS 63

Query: 76  VHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSL 135
            H  SKL+A K I V++V+ EAK AK++G++R+CMGAAWR P ERD+  +++M++ VK+L
Sbjct: 64  AHYDSKLEAEKRIAVEKVISEAKAAKDSGSSRFCMGAAWRNPHERDMPYVLEMVREVKAL 123

Query: 136 GLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKS 195
           G+ETCMTLGML+  QA+ L  AGLDYYNHN+DTS  +Y H+ +T TF+DRL TL+ VR++
Sbjct: 124 GMETCMTLGMLNQSQAERLKDAGLDYYNHNLDTSREYYSHIISTRTFDDRLNTLDYVRQA 183

Query: 196 GIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEH 255
           G+KVC GGI+GLGE  +DRI +L  LA L   PES+PIN+L+PI G+   + +K+D IE 
Sbjct: 184 GMKVCSGGIVGLGESREDRIGLLHELATLPIHPESVPINMLVPIEGTPLADVEKLDVIEW 243

Query: 256 VRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTI 315
           +R I+VARI+MP S +RL+AGR  +SD  QAL F +GANS+F GD LLT  N    KD  
Sbjct: 244 IRTIAVARIIMPHSYIRLSAGRESLSDSDQALAFMAGANSLFSGDKLLTTPNAGEGKDQA 303

Query: 316 LFNRLGLIPD 325
           LFN+LGL  +
Sbjct: 304 LFNKLGLTAE 313


>gi|157369554|ref|YP_001477543.1| biotin synthase [Serratia proteamaculans 568]
 gi|254810808|sp|A8GBC5|BIOB_SERP5 RecName: Full=Biotin synthase
 gi|157321318|gb|ABV40415.1| biotin synthase [Serratia proteamaculans 568]
          Length = 345

 Score =  322 bits (824), Expect = 5e-86,   Method: Composition-based stats.
 Identities = 162/309 (52%), Positives = 227/309 (73%)

Query: 19  WTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQSVHN 78
           WT      +++ P  +LLF + TVHR++F+P  +Q+S LL+IKTG CPE+C YC QS   
Sbjct: 7   WTVGLAQTLFDKPLLELLFEAQTVHRQHFDPRQVQVSTLLSIKTGACPEDCKYCPQSSRY 66

Query: 79  KSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLGLE 138
           K+ L++ +L+ V+QVL+ A+ AK NG+TR+CMGAAW+ P ERD+  +  M++GVK++G+E
Sbjct: 67  KTGLESERLMQVEQVLESARKAKANGSTRFCMGAAWKNPHERDMPYLQQMVQGVKAMGME 126

Query: 139 TCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSGIK 198
           TCMTLG L   QA+ L+ AGLDYYNHN+DTS  FY ++ TT ++++RL TL  VR +GIK
Sbjct: 127 TCMTLGTLDGTQAERLADAGLDYYNHNLDTSPEFYGNIITTRSYQERLDTLGKVRGAGIK 186

Query: 199 VCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEHVRI 258
           VC GGI+GLGE + DR  +L+ LANL TPPES+PIN+L+ + G+   +N+ VDP + +R 
Sbjct: 187 VCSGGIVGLGETVRDRAGLLVQLANLPTPPESVPINMLVKVKGTPLADNEDVDPFDFIRT 246

Query: 259 ISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTILFN 318
           I+VARI+MP S +RL+AGR  M+++ QA+CF +GANSIF G  LLT  NP  +KD  LF 
Sbjct: 247 IAVARIMMPASYVRLSAGREQMNEQTQAMCFMAGANSIFYGCKLLTTPNPEEDKDLQLFR 306

Query: 319 RLGLIPDLS 327
           +LGL P  +
Sbjct: 307 KLGLNPQQT 315


>gi|119470297|ref|ZP_01613056.1| biotin synthase [Alteromonadales bacterium TW-7]
 gi|119446469|gb|EAW27744.1| biotin synthase [Alteromonadales bacterium TW-7]
          Length = 346

 Score =  322 bits (824), Expect = 6e-86,   Method: Composition-based stats.
 Identities = 166/310 (53%), Positives = 227/310 (73%)

Query: 16  PKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQS 75
              WT  EV  ++ MPFNDLLF + +VHR NF PN +Q+S LL+IKTG CPE+C YC QS
Sbjct: 7   RHNWTHSEVKALFEMPFNDLLFKAASVHRANFNPNEVQISTLLSIKTGACPEDCKYCPQS 66

Query: 76  VHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSL 135
            H K+ L+  +LI V++V+++A+ AK+ GATR+CMGAAW +PK+RD+  I  M+K VK L
Sbjct: 67  GHYKTDLERERLIEVEKVVEQARLAKQKGATRFCMGAAWSDPKDRDMPYISKMVKEVKEL 126

Query: 136 GLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKS 195
           GLETCMTLG L+ E+A  LS AGLDYYNHN+DTS  +Y  + +T TFEDRL T+++VR +
Sbjct: 127 GLETCMTLGKLTNEKAHELSSAGLDYYNHNLDTSPEYYEQIISTRTFEDRLNTIDHVRDA 186

Query: 196 GIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEH 255
           G+KVC GGI+G+GE   DR  +L+ LANL   PES+PIN+L+ + G+  E    +D  E 
Sbjct: 187 GMKVCSGGIVGMGEQAADRYGLLMQLANLPQQPESVPINMLVKVKGTPLENVDDLDHFEF 246

Query: 256 VRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTI 315
           +R I+ ARI+MP S +RL+AGR  M++++Q++CFF+GANSIF GD LLT +NP  + D  
Sbjct: 247 IRTIATARIMMPHSYVRLSAGRNAMNEQMQSMCFFAGANSIFYGDKLLTTENPEADADMN 306

Query: 316 LFNRLGLIPD 325
           L  +LG+ P+
Sbjct: 307 LIKKLGMNPE 316


>gi|254483199|ref|ZP_05096432.1| biotin synthase [marine gamma proteobacterium HTCC2148]
 gi|214036570|gb|EEB77244.1| biotin synthase [marine gamma proteobacterium HTCC2148]
          Length = 352

 Score =  322 bits (824), Expect = 6e-86,   Method: Composition-based stats.
 Identities = 172/326 (52%), Positives = 234/326 (71%)

Query: 1   MSRSTVVPEENPTKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNI 60
           MS +      N       WTS E+  ++ +PFNDLLF + ++HR+ F+PN +Q+S LL+I
Sbjct: 7   MSTANARTVPNEQHIRHDWTSAEIAALFKLPFNDLLFEAQSLHRQYFDPNQVQVSTLLSI 66

Query: 61  KTGGCPENCGYCNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKER 120
           KTG CPE+C YC QS    + L+  KL+ VDQVL++A+ AK  G+TR+CMGAAWR PK R
Sbjct: 67  KTGACPEDCAYCPQSTRYDTGLEVEKLMEVDQVLEQARAAKNAGSTRFCMGAAWRCPKPR 126

Query: 121 DLSIIVDMIKGVKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTH 180
           D+  +V M++GV+ +G+ETCMTLGMLS EQA+ L+ AGLDYYNHN+DTS  FY  + TT 
Sbjct: 127 DMPHVVAMVEGVRKMGMETCMTLGMLSEEQAKQLADAGLDYYNHNLDTSPEFYGDIITTR 186

Query: 181 TFEDRLQTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIP 240
           T++DRL TL++VR SG+KVC GGI+G+GE   DR  ML  LANL   PES+PIN+L+ + 
Sbjct: 187 TYQDRLDTLDHVRSSGMKVCSGGIVGMGEQQTDRAGMLQQLANLPQHPESVPINMLVRVE 246

Query: 241 GSKFEENKKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGD 300
           G+     + +DPIE +R I+VARI+MP S +RL+AGR  M++++ AL +F+GANSIF G+
Sbjct: 247 GTPLAGQEDLDPIEFIRTIAVARIMMPASHVRLSAGREEMNEQMHALAYFAGANSIFYGE 306

Query: 301 TLLTAKNPSYNKDTILFNRLGLIPDL 326
            LLT  NP  N+D  LF RLG+ P+ 
Sbjct: 307 KLLTTPNPRANEDLALFARLGINPEQ 332


>gi|322833791|ref|YP_004213818.1| biotin synthase [Rahnella sp. Y9602]
 gi|321168992|gb|ADW74691.1| biotin synthase [Rahnella sp. Y9602]
          Length = 345

 Score =  322 bits (824), Expect = 6e-86,   Method: Composition-based stats.
 Identities = 159/307 (51%), Positives = 227/307 (73%)

Query: 19  WTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQSVHN 78
           WT ++   +++ PF +L+F +  +HR++F+P  +Q+S LL+IKTG CPE+C YC QS   
Sbjct: 7   WTLEKTQALFDKPFLELMFEAQQIHRQHFDPRQVQVSTLLSIKTGACPEDCKYCPQSSRY 66

Query: 79  KSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLGLE 138
           K+ L++ +L+ V+QVL+ A+ AK  G+TR+CMGAAW+ P +RD+  +  M++GVK +G+E
Sbjct: 67  KTGLESERLMQVEQVLESARQAKAAGSTRFCMGAAWKNPHDRDMPYLEQMVQGVKEMGME 126

Query: 139 TCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSGIK 198
           TCMTLG L+  QAQ L+ AGLD+YNHN+DTS  FY  + TT ++++RL TL  VR +GIK
Sbjct: 127 TCMTLGTLNTTQAQRLAHAGLDFYNHNLDTSPEFYGSIITTRSYQERLDTLAEVRGAGIK 186

Query: 199 VCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEHVRI 258
           VC GGI+GLGE + DR  +L+ LANL  PPES+PIN+L+ + G+   +N  VDP + +R 
Sbjct: 187 VCSGGIVGLGETVKDRAGLLMQLANLPVPPESVPINMLVKVKGTPLADNDDVDPFDFIRT 246

Query: 259 ISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTILFN 318
           I+VARI+MP+S +RL+AGR  MS++ QA+CF +GANSIF G  LLT  NP+ +KD ILF 
Sbjct: 247 IAVARIMMPQSYVRLSAGREQMSEQTQAMCFMAGANSIFYGCKLLTTPNPAEDKDLILFG 306

Query: 319 RLGLIPD 325
           +LGL P 
Sbjct: 307 KLGLNPQ 313


>gi|145299796|ref|YP_001142637.1| biotin synthase [Aeromonas salmonicida subsp. salmonicida A449]
 gi|254810543|sp|A4SPR7|BIOB_AERS4 RecName: Full=Biotin synthase
 gi|142852568|gb|ABO90889.1| biotin synthase [Aeromonas salmonicida subsp. salmonicida A449]
          Length = 362

 Score =  322 bits (824), Expect = 6e-86,   Method: Composition-based stats.
 Identities = 165/313 (52%), Positives = 225/313 (71%)

Query: 16  PKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQS 75
              WT  EV  ++ +PFNDLLF + T+HR +F+PN +Q+S LL+IKTG CPE+C YC QS
Sbjct: 12  RHDWTLSEVQALFALPFNDLLFQAQTIHRAHFDPNEVQVSTLLSIKTGACPEDCKYCPQS 71

Query: 76  VHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSL 135
               + L+  +L+ V++VL+ A+ A+ NG++R+CMGAAWR PKERD+  I+ MI+ V+ L
Sbjct: 72  ARYHTGLETERLMEVEKVLERAREARANGSSRFCMGAAWRNPKERDMPYILRMIEEVRGL 131

Query: 136 GLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKS 195
           G+ETCMTLGML+ +QA  L  AGLDYYNHN+DTS  FY  + +T T++DRL TLE+VR +
Sbjct: 132 GMETCMTLGMLTADQAARLGAAGLDYYNHNLDTSPEFYGEIISTRTYQDRLDTLEHVRGA 191

Query: 196 GIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEH 255
           G+KVC GGI+G+GE   DR  +L+ LANL   PES+PIN+L+ + G+  E    +D  E 
Sbjct: 192 GMKVCSGGIVGMGEQAKDRAGLLMALANLPRHPESVPINMLVKVKGTPLENEANLDSFEF 251

Query: 256 VRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTI 315
           +R I+VARI+MP S +RL+AGR  M++++QA+CF +GANSIF G  LLT  NP  N D  
Sbjct: 252 IRTIAVARIMMPASHVRLSAGREKMNEQMQAMCFMAGANSIFYGCKLLTTPNPDENSDMQ 311

Query: 316 LFNRLGLIPDLSA 328
           LF RLG+ P   A
Sbjct: 312 LFKRLGIRPAQRA 324


>gi|254810875|sp|A6W0Y1|BIOB_MARMS RecName: Full=Biotin synthase
          Length = 351

 Score =  322 bits (824), Expect = 6e-86,   Method: Composition-based stats.
 Identities = 168/319 (52%), Positives = 231/319 (72%)

Query: 7   VPEENPTKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCP 66
           +   N +     WT  E+  ++++PF DL+F + TVHR+NF PN +Q+S LL+IKTG CP
Sbjct: 1   MSINNISAPRFDWTHAEIKALFDLPFMDLMFRAQTVHRENFAPNEVQVSTLLSIKTGACP 60

Query: 67  ENCGYCNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIV 126
           E+C YC QS H  ++L+  KL+ V +VL+EA  AKE GA+R+CMGAAW+ P E+D   ++
Sbjct: 61  EDCKYCPQSGHYNTELEKEKLMEVQKVLEEAALAKEKGASRFCMGAAWKHPSEKDFPYVL 120

Query: 127 DMIKGVKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRL 186
           +MIKGVKSLGLE+C+TLG L+ +QA+ LS+ GLDYYNHN+DTS  FY  + TT T++DRL
Sbjct: 121 EMIKGVKSLGLESCVTLGSLNDDQAKRLSEVGLDYYNHNLDTSAEFYDSIITTRTYQDRL 180

Query: 187 QTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEE 246
            TL  VR SGIK+CCGGI+G+GE   DR+ +L  L+ ++  PES+PIN+L+ + G+  E 
Sbjct: 181 DTLSRVRDSGIKLCCGGIMGMGEEQKDRVGLLRQLSQMTPHPESVPINMLVKVEGTPLEN 240

Query: 247 NKKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAK 306
              +D  E +R I+VARILMPKS +RL+AGR  M+++ QALCF +GANSIF G+ LLT  
Sbjct: 241 VDDLDTFEFIRTIAVARILMPKSHVRLSAGRQGMNEQTQALCFMAGANSIFYGEKLLTTG 300

Query: 307 NPSYNKDTILFNRLGLIPD 325
           NP  +KD  LF  LG+ P+
Sbjct: 301 NPEADKDMALFANLGINPE 319


>gi|300692763|ref|YP_003753758.1| biotin synthetase [Ralstonia solanacearum PSI07]
 gi|299079823|emb|CBJ52500.1| biotin synthetase [Ralstonia solanacearum PSI07]
          Length = 362

 Score =  321 bits (823), Expect = 7e-86,   Method: Composition-based stats.
 Identities = 168/324 (51%), Positives = 226/324 (69%), Gaps = 3/324 (0%)

Query: 2   SRSTVVPEENPTKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIK 61
           ++    P +NP      W+ + +  ++ +PFNDLLF +  VHR +F+ N +QLS LL+IK
Sbjct: 13  AKVPPTPGQNP---NARWSREAIEALFALPFNDLLFQAQQVHRAHFDANAVQLSTLLSIK 69

Query: 62  TGGCPENCGYCNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERD 121
           TGGCPE+C YC QS    + ++A KL+ +D VL+ A  AK+NGA+R+CMGAAWR PK   
Sbjct: 70  TGGCPEDCSYCPQSARYDTGVEAEKLMPIDTVLEAAARAKQNGASRFCMGAAWRNPKPHQ 129

Query: 122 LSIIVDMIKGVKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHT 181
           L  + DM++GVK++GLETC+TLGML  EQAQ L  AGLDYYNHN+DT+  FY  + TT T
Sbjct: 130 LEAVADMVRGVKAMGLETCVTLGMLKQEQAQQLKDAGLDYYNHNLDTAPEFYGEIITTRT 189

Query: 182 FEDRLQTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPG 241
           ++DRL TLE+VR +GI VCCGGI+GLGE   +R  ++  LAN+   P+S+PIN L+ + G
Sbjct: 190 YQDRLDTLEHVRDAGINVCCGGIVGLGESRHERAGLVAELANMEPYPDSVPINNLVKVEG 249

Query: 242 SKFEENKKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDT 301
           +    N+ +DP E VR I+VARI MPK+ +RL+AGR  M D LQALCF +GANSIF G+ 
Sbjct: 250 TPLAGNEALDPFEFVRTIAVARITMPKAMVRLSAGREAMDDALQALCFMAGANSIFYGEK 309

Query: 302 LLTAKNPSYNKDTILFNRLGLIPD 325
           LLT  NP  + D  L  RLG+  +
Sbjct: 310 LLTTDNPEADADRKLLARLGMRVE 333


>gi|89094135|ref|ZP_01167078.1| biotin synthase; contains an iron-sulfur cluster and PLP
           [Oceanospirillum sp. MED92]
 gi|89081610|gb|EAR60839.1| biotin synthase; contains an iron-sulfur cluster and PLP
           [Oceanospirillum sp. MED92]
          Length = 347

 Score =  321 bits (823), Expect = 8e-86,   Method: Composition-based stats.
 Identities = 166/313 (53%), Positives = 232/313 (74%)

Query: 14  KKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCN 73
           +    W+  EV  ++ +PFNDL+F +H+VHR+NF+PN +Q+S LL+IKTG CPE+C YC 
Sbjct: 6   EIRHDWSEAEVKALFELPFNDLMFHAHSVHRQNFDPNEVQVSTLLSIKTGSCPEDCKYCP 65

Query: 74  QSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVK 133
           QS H  + L+  +L+ V++V+++AK AK  G+TR+CMGAAW+ P ERD+  ++DM++ VK
Sbjct: 66  QSAHYSTGLEKERLMEVERVVEKAKQAKATGSTRFCMGAAWKHPHERDMPYVLDMVRQVK 125

Query: 134 SLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVR 193
            LGLETCMTLGML  ++A  LS AGLDYYNHN+DTS  FY  + TT +++DRL TL+NVR
Sbjct: 126 ELGLETCMTLGMLDQDKADRLSDAGLDYYNHNLDTSPEFYDKIITTRSYQDRLDTLQNVR 185

Query: 194 KSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPI 253
            SG+K+C GGILG+GE   DR  +L+ LAN+   PES+PIN+L+ + G+  E    +D +
Sbjct: 186 DSGMKICSGGILGMGETAKDRYGLLMQLANMPVQPESVPINMLVKVEGTPLENVDDLDHL 245

Query: 254 EHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKD 313
           E +R I+VARI+MPKS +RL+AGR  MSDE+QA+ FF+GANSIF G+ LLT  NP  ++D
Sbjct: 246 EFIRTIAVARIMMPKSHVRLSAGREKMSDEMQAMTFFAGANSIFYGECLLTTPNPETHRD 305

Query: 314 TILFNRLGLIPDL 326
             LF +LG+  + 
Sbjct: 306 LQLFKKLGINMEQ 318


>gi|113970694|ref|YP_734487.1| biotin synthase [Shewanella sp. MR-4]
 gi|114047923|ref|YP_738473.1| biotin synthase [Shewanella sp. MR-7]
 gi|117920962|ref|YP_870154.1| biotin synthase [Shewanella sp. ANA-3]
 gi|122943745|sp|Q0HHN7|BIOB_SHESM RecName: Full=Biotin synthase
 gi|123131284|sp|Q0HTY9|BIOB_SHESR RecName: Full=Biotin synthase
 gi|254811579|sp|A0KY79|BIOB_SHESA RecName: Full=Biotin synthase
 gi|113885378|gb|ABI39430.1| biotin synthase [Shewanella sp. MR-4]
 gi|113889365|gb|ABI43416.1| biotin synthase [Shewanella sp. MR-7]
 gi|117613294|gb|ABK48748.1| biotin synthase [Shewanella sp. ANA-3]
          Length = 350

 Score =  321 bits (823), Expect = 8e-86,   Method: Composition-based stats.
 Identities = 170/316 (53%), Positives = 233/316 (73%)

Query: 13  TKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYC 72
            +    W  +E+  ++ +P NDLLF +H++HR+ ++PN +Q+S+LL+IKTG CPE+C YC
Sbjct: 4   LQVRHDWKREEIEALFALPMNDLLFKAHSIHREVYDPNEVQISRLLSIKTGACPEDCKYC 63

Query: 73  NQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGV 132
            QS    + L+  +L+ ++ VL EA++AK  GA+R+CMGAAWR PK++D+  +  M++ V
Sbjct: 64  PQSARYDTGLEKERLLAMETVLTEARSAKAAGASRFCMGAAWRNPKDKDMPYLKQMVQEV 123

Query: 133 KSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENV 192
           K+LG+ETCMTLGMLS EQA  L+ AGLDYYNHN+DTS  +Y  V TT T+++RL TL +V
Sbjct: 124 KALGMETCMTLGMLSAEQANELADAGLDYYNHNLDTSPEYYGDVITTRTYQNRLDTLSHV 183

Query: 193 RKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDP 252
           R SG+KVC GGI+G+GE   DR  +L  LANL   P+S+PIN+L+ + G+ FE+   +DP
Sbjct: 184 RASGMKVCSGGIVGMGEKATDRAGLLQQLANLPQHPDSVPINMLVKVAGTPFEKLDDLDP 243

Query: 253 IEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNK 312
           +E VR I+VARILMPKSR+RL+AGR  M+DELQA+CFF+GANSIF G  LLT  NP  + 
Sbjct: 244 LEFVRTIAVARILMPKSRVRLSAGRENMTDELQAMCFFAGANSIFYGCKLLTTPNPEESD 303

Query: 313 DTILFNRLGLIPDLSA 328
           D  LF RLGL P+  A
Sbjct: 304 DMGLFRRLGLRPEQGA 319


>gi|330812195|ref|YP_004356657.1| biotin synthase [Pseudomonas brassicacearum subsp. brassicacearum
           NFM421]
 gi|327380303|gb|AEA71653.1| biotin synthase [Pseudomonas brassicacearum subsp. brassicacearum
           NFM421]
          Length = 351

 Score =  321 bits (823), Expect = 8e-86,   Method: Composition-based stats.
 Identities = 165/310 (53%), Positives = 229/310 (73%)

Query: 16  PKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQS 75
              W+  EV  ++  PFNDLLF + TVHR +F+ N +Q+S LL+IKTG CPE+C YC QS
Sbjct: 10  RHDWSLAEVKALFVQPFNDLLFQAQTVHRAHFDANRVQVSTLLSIKTGACPEDCKYCPQS 69

Query: 76  VHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSL 135
            H  + L   KL+ V +VL+EA  AK  G+TR+CMGAAW+ P  +D+  +++M+KGVK++
Sbjct: 70  GHYNTGLDKEKLLEVQKVLEEAARAKAIGSTRFCMGAAWKHPSAKDMPYVLEMVKGVKAM 129

Query: 136 GLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKS 195
           GLETCMTLG L  EQ + L++AGLDYYNHN+DTS  FY  + TT T+ +RLQTL  VR S
Sbjct: 130 GLETCMTLGRLDQEQTEALAQAGLDYYNHNLDTSPEFYGSIITTRTYSERLQTLAYVRDS 189

Query: 196 GIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEH 255
           G+K+C GGILG+GE +DDR ++L+ LANL   PES+PIN+L+ + G+  E  + VDP + 
Sbjct: 190 GMKICSGGILGMGESLDDRANLLIQLANLPEHPESVPINMLVKVAGTPLENAEDVDPFDF 249

Query: 256 VRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTI 315
           +R+++VARI+MP+S +RL+AGR  M++++Q+L F +GANSIF GD LLT  NP  +KD  
Sbjct: 250 IRMLAVARIMMPQSHVRLSAGREAMNEQMQSLAFLAGANSIFYGDKLLTTANPQADKDMQ 309

Query: 316 LFNRLGLIPD 325
           LF+RLG+ P+
Sbjct: 310 LFSRLGIQPE 319


>gi|149910088|ref|ZP_01898735.1| biotin synthase [Moritella sp. PE36]
 gi|149806813|gb|EDM66775.1| biotin synthase [Moritella sp. PE36]
          Length = 360

 Score =  321 bits (823), Expect = 8e-86,   Method: Composition-based stats.
 Identities = 174/309 (56%), Positives = 230/309 (74%)

Query: 16  PKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQS 75
              W   E+  ++N PFNDL+F + TVHR+NF+PN +Q+S LL+IKTG CPE+C YC QS
Sbjct: 6   RHDWQIDEIEALFNQPFNDLMFQAQTVHRQNFDPNSVQISTLLSIKTGACPEDCKYCPQS 65

Query: 76  VHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSL 135
               + ++  +L+ V+ VLK A  AKENGA+R+CMGAAW+ P +RD+  ++DM+KGVK++
Sbjct: 66  ARYTTGIEKERLMQVETVLKRAVEAKENGASRFCMGAAWKNPHKRDMPYLIDMVKGVKAM 125

Query: 136 GLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKS 195
           GLETCMTLGML+ EQAQ LS AGLDYYNHN+DTSE +Y  + TT T++DRL TL++VR +
Sbjct: 126 GLETCMTLGMLAPEQAQSLSAAGLDYYNHNLDTSEEYYEQIITTRTYQDRLDTLDHVRDA 185

Query: 196 GIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEH 255
           G+KVC GGI+G+GE   DRI +L +LANL+  PES+PIN+L+ + G+  E+   +D IE 
Sbjct: 186 GMKVCSGGIVGMGEQQLDRIGLLKSLANLAHHPESVPINMLVKVAGTPLEDTPDLDEIEF 245

Query: 256 VRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTI 315
           VR I+ ARILMPKS +RL+AGR  MS++ QALCF +GANSIF G  LLT  NP    D  
Sbjct: 246 VRTIATARILMPKSYVRLSAGRETMSEQTQALCFMAGANSIFYGCKLLTTDNPDEGSDKR 305

Query: 316 LFNRLGLIP 324
           LF +LGL P
Sbjct: 306 LFKKLGLHP 314


>gi|254810647|sp|B0VR41|BIOB_ACIBS RecName: Full=Biotin synthase
          Length = 329

 Score =  321 bits (823), Expect = 8e-86,   Method: Composition-based stats.
 Identities = 170/310 (54%), Positives = 230/310 (74%)

Query: 16  PKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQS 75
              WT +E+  +Y  PF DL+F +  VHR++F  N IQ+S LL+IKTG CPE+C YC+QS
Sbjct: 4   RNDWTREEIQALYEQPFLDLVFKAQQVHREHFTANTIQVSTLLSIKTGKCPEDCKYCSQS 63

Query: 76  VHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSL 135
            H  SKL+A K I V++V+ EAK AK++G++R+CMGAAWR P ERD+  +++M++ VK+L
Sbjct: 64  AHYDSKLEAEKRIAVEKVISEAKAAKDSGSSRFCMGAAWRNPHERDMPYVLEMVREVKAL 123

Query: 136 GLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKS 195
           G+ETCMTLGML+  QA+ L  AGLDYYNHN+DTS ++Y H+ +T TF+DRL TL+ VR++
Sbjct: 124 GMETCMTLGMLNQSQAERLKDAGLDYYNHNLDTSRKYYSHIISTRTFDDRLNTLDYVRQA 183

Query: 196 GIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEH 255
           G+KVC GGI+GLGE  +DRI +L  LA L   PES+PIN+L+PI G+   + +K+D IE 
Sbjct: 184 GMKVCSGGIVGLGESREDRIGLLHELATLPIHPESVPINMLVPIEGTPLADVEKLDVIEW 243

Query: 256 VRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTI 315
           +R I+VARI+MP S +RL+AGR  +SD  QAL F +GANS+F GD LLT  N    KD  
Sbjct: 244 IRTIAVARIIMPHSYIRLSAGRESLSDSDQALAFMAGANSLFSGDKLLTTPNAGEGKDQA 303

Query: 316 LFNRLGLIPD 325
           LFN+LGL  +
Sbjct: 304 LFNKLGLTAE 313


>gi|237802415|ref|ZP_04590876.1| biotin synthase [Pseudomonas syringae pv. oryzae str. 1_6]
 gi|331025272|gb|EGI05328.1| biotin synthase [Pseudomonas syringae pv. oryzae str. 1_6]
          Length = 352

 Score =  321 bits (822), Expect = 9e-86,   Method: Composition-based stats.
 Identities = 169/310 (54%), Positives = 230/310 (74%)

Query: 16  PKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQS 75
              WT  EV  ++  PFNDLLF + TVHR +F+ N +Q+S LL+IKTG CPE+C YC QS
Sbjct: 10  RHDWTLAEVRALFVQPFNDLLFQAQTVHRAHFDANRVQVSTLLSIKTGACPEDCKYCPQS 69

Query: 76  VHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSL 135
            H  + L+  KL+ V +VL+EA  AK  G+TR+CMGAAW+ P  +D+  +++M+KGVK++
Sbjct: 70  GHYNTGLEKEKLLEVQKVLEEAARAKAIGSTRFCMGAAWKHPSAKDMPYVLEMVKGVKAM 129

Query: 136 GLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKS 195
           GLETCMTLG L  EQ + L+ AGLDYYNHN+DTS  FY  + TT T+ +RLQTL  VR +
Sbjct: 130 GLETCMTLGRLDQEQTEALATAGLDYYNHNLDTSPEFYGSIITTRTYGERLQTLAYVRDA 189

Query: 196 GIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEH 255
           G+K+C GGILG+GE +DDR  +L+ LANL   PES+PIN+L+ + G+  E  + VDP + 
Sbjct: 190 GVKICSGGILGMGESLDDRAGLLIQLANLPEHPESVPINMLVKVAGTPLENAEDVDPFDF 249

Query: 256 VRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTI 315
           +R+++VARILMPKS +RL+AGR  M++++QAL FF+GANSIF GD LLT  NP  +KD +
Sbjct: 250 IRMLAVARILMPKSHVRLSAGREAMNEQMQALAFFAGANSIFYGDKLLTTANPQADKDML 309

Query: 316 LFNRLGLIPD 325
           LF+RLG+ P+
Sbjct: 310 LFSRLGIKPE 319


>gi|268590302|ref|ZP_06124523.1| biotin synthase [Providencia rettgeri DSM 1131]
 gi|291314211|gb|EFE54664.1| biotin synthase [Providencia rettgeri DSM 1131]
          Length = 345

 Score =  321 bits (822), Expect = 9e-86,   Method: Composition-based stats.
 Identities = 169/309 (54%), Positives = 230/309 (74%)

Query: 17  KVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQSV 76
           K WT K+  ++++MPF +LLF +  +HR++F+P  +Q+S LL+IKTG CPE+C YC QS 
Sbjct: 5   KQWTIKQANELFSMPFFELLFQAQQIHRQHFDPQQVQVSTLLSIKTGACPEDCKYCAQSA 64

Query: 77  HNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLG 136
             K+ L+  KL+ V QVL+ AK AK+ G+TR+CMGAAWR PKERD+  +  M+K VK LG
Sbjct: 65  RYKTGLETEKLMEVQQVLESAKKAKQAGSTRFCMGAAWRNPKERDMPYLEMMVKEVKLLG 124

Query: 137 LETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSG 196
           +ETCMTLGM+   QAQ L++AGLDYYNHN+DTS  +Y ++ TT +++DRL TLENVR +G
Sbjct: 125 METCMTLGMIDNSQAQRLAEAGLDYYNHNLDTSPEYYGNIITTRSYQDRLNTLENVRDAG 184

Query: 197 IKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEHV 256
           IKVC GGILGLGE + DR  +L+ LANL  PPES+PIN+L+ + G+   +N+ VD  + +
Sbjct: 185 IKVCSGGILGLGEKVSDRAALLVQLANLPKPPESVPINMLMKVEGTPMADNEDVDAFDFI 244

Query: 257 RIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTIL 316
           R I+VARI+MP S +RL+AGR  M+++ QALCF +GANS+F G  LLT  NP  NKD  L
Sbjct: 245 RTIAVARIMMPTSYVRLSAGREYMNEQTQALCFMAGANSVFYGCKLLTTPNPDENKDLAL 304

Query: 317 FNRLGLIPD 325
           F +L + P+
Sbjct: 305 FRKLDINPE 313


>gi|21229866|ref|NP_635783.1| biotin synthase [Xanthomonas campestris pv. campestris str. ATCC
           33913]
 gi|66766743|ref|YP_241505.1| biotin synthase [Xanthomonas campestris pv. campestris str. 8004]
 gi|188989812|ref|YP_001901822.1| biotin synthase [Xanthomonas campestris pv. campestris str. B100]
 gi|81307267|sp|Q4UZN8|BIOB_XANC8 RecName: Full=Biotin synthase
 gi|81797069|sp|Q8PDF0|BIOB_XANCP RecName: Full=Biotin synthase
 gi|254811607|sp|B0RMR2|BIOB_XANCB RecName: Full=Biotin synthase
 gi|21111368|gb|AAM39707.1| biotin synthase [Xanthomonas campestris pv. campestris str. ATCC
           33913]
 gi|66572075|gb|AAY47485.1| biotin synthase [Xanthomonas campestris pv. campestris str. 8004]
 gi|167731572|emb|CAP49747.1| biotin synthase [Xanthomonas campestris pv. campestris]
          Length = 344

 Score =  321 bits (822), Expect = 9e-86,   Method: Composition-based stats.
 Identities = 157/311 (50%), Positives = 216/311 (69%)

Query: 16  PKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQS 75
              W  KE+  ++ +PF +LL  + +VHR +F+P  +Q+S LL++KTGGCPE+C YC Q+
Sbjct: 6   RHDWDRKELHALFALPFPELLHRAASVHRAHFDPAEVQVSTLLSVKTGGCPEDCAYCPQA 65

Query: 76  VHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSL 135
               + + A KL++ + V+ +A+ AK  GA+R+CMGAAWR PK+RD+  +  MI+ VK++
Sbjct: 66  QRYDTGVSAQKLMDTEDVVAKARQAKAAGASRFCMGAAWRSPKDRDIPKVAAMIREVKAM 125

Query: 136 GLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKS 195
           GLETC TLGML   QA+ L  AGLDYYNHN+DT+  +Y  +  T  ++DRL TLE+VR  
Sbjct: 126 GLETCATLGMLDAGQARALKDAGLDYYNHNLDTAPDYYDSIIHTRQYQDRLNTLEHVRDV 185

Query: 196 GIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEH 255
           G+K CCGGI+G+GE  + R+ +L  LA L   P+S+PIN L+ +PG+     + +D  E 
Sbjct: 186 GLKTCCGGIVGMGETREHRVGLLHALATLPAHPDSVPINQLVQVPGTPLHGTEPLDAFEF 245

Query: 256 VRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTI 315
           VR+I+VARI MPKS +RL+AGR  MSDELQALCF +GANSIF G+ LLT  NP   +D  
Sbjct: 246 VRMIAVARIAMPKSMVRLSAGREAMSDELQALCFLAGANSIFYGEKLLTTGNPDTERDQG 305

Query: 316 LFNRLGLIPDL 326
           LF RLGL P  
Sbjct: 306 LFQRLGLRPMQ 316


>gi|294141480|ref|YP_003557458.1| biotin synthase [Shewanella violacea DSS12]
 gi|293327949|dbj|BAJ02680.1| biotin synthase [Shewanella violacea DSS12]
          Length = 354

 Score =  321 bits (822), Expect = 1e-85,   Method: Composition-based stats.
 Identities = 170/309 (55%), Positives = 228/309 (73%)

Query: 18  VWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQSVH 77
            W   E+ +++++P NDLLF +H++HR+ F+PN +Q+S+LL+IKTG CPE+C YC QS  
Sbjct: 9   DWQRDEITELFDLPMNDLLFKAHSLHRQVFDPNEVQISRLLSIKTGACPEDCKYCPQSAR 68

Query: 78  NKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLGL 137
             + L+  +LI +D+VL EA++AK  GA+R+CMGAAWR P  RD+  + DM+  VK +G+
Sbjct: 69  YDTGLEKERLIEIDKVLTEARSAKAAGASRFCMGAAWRNPHPRDMPYLKDMVSEVKDMGM 128

Query: 138 ETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSGI 197
           ETCMTLGMLS EQA  L++AGLDYYNHN+DTS  +Y  + TT T++DRL TL NVR +G+
Sbjct: 129 ETCMTLGMLSPEQAGELAEAGLDYYNHNLDTSPEYYGDIITTRTYQDRLDTLSNVRAAGM 188

Query: 198 KVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEHVR 257
           KVC GGI+G+GE   DR  +L  LAN+   P+S+PIN+L+ + G+ FE    +DP+  VR
Sbjct: 189 KVCSGGIVGMGEQASDRAGLLQQLANMEQHPDSVPINMLVKVAGTPFENIDDLDPLVFVR 248

Query: 258 IISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTILF 317
            I+VARILMP SR+RL+AGR  MSDE+QA+CFF+GANSIF G  LLT  NP  N D  LF
Sbjct: 249 TIAVARILMPYSRVRLSAGREKMSDEMQAMCFFAGANSIFYGCKLLTTNNPEENDDMTLF 308

Query: 318 NRLGLIPDL 326
            RLGL P+ 
Sbjct: 309 KRLGLHPEQ 317


>gi|66047911|ref|YP_237752.1| biotin synthase [Pseudomonas syringae pv. syringae B728a]
 gi|75500299|sp|Q4ZMA8|BIOB_PSEU2 RecName: Full=Biotin synthase
 gi|63258618|gb|AAY39714.1| Biotin synthase [Pseudomonas syringae pv. syringae B728a]
 gi|330954915|gb|EGH55175.1| biotin synthase [Pseudomonas syringae Cit 7]
 gi|330970892|gb|EGH70958.1| biotin synthase [Pseudomonas syringae pv. aceris str. M302273PT]
          Length = 352

 Score =  321 bits (822), Expect = 1e-85,   Method: Composition-based stats.
 Identities = 168/310 (54%), Positives = 230/310 (74%)

Query: 16  PKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQS 75
              WT  EV  ++  PFNDLLF + TVHR +F+ N +Q+S LL+IKTG CPE+C YC QS
Sbjct: 10  RHDWTLAEVRALFVQPFNDLLFQAQTVHRAHFDANRVQVSTLLSIKTGACPEDCKYCPQS 69

Query: 76  VHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSL 135
            H  + L+  KL+ V +VL+EA  AK  G+TR+CMGAAW+ P  +D+  +++M+KGVK++
Sbjct: 70  GHYNTGLEKEKLLEVQKVLEEAARAKAIGSTRFCMGAAWKHPSAKDMPYVLEMVKGVKAM 129

Query: 136 GLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKS 195
           G+ETCMTLG L  EQ + L+ AGLDYYNHN+DTS  FY  + TT T+ +RLQTL  VR +
Sbjct: 130 GMETCMTLGRLDQEQTEALATAGLDYYNHNLDTSPEFYGSIITTRTYSERLQTLAYVRDA 189

Query: 196 GIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEH 255
           G+K+C GGILG+GE +DDR  +L+ LANL   PES+PIN+L+ + G+  E  + VDP + 
Sbjct: 190 GMKICSGGILGMGESLDDRAGLLIQLANLPEHPESVPINMLVKVAGTPLENAEDVDPFDF 249

Query: 256 VRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTI 315
           +R+++VARILMPKS +RL+AGR  M++++QAL FF+GANSIF GD LLT  NP  +KD +
Sbjct: 250 IRMLAVARILMPKSHVRLSAGREAMNEQMQALAFFAGANSIFYGDKLLTTANPQADKDML 309

Query: 316 LFNRLGLIPD 325
           LF+RLG+ P+
Sbjct: 310 LFSRLGIKPE 319


>gi|260061535|ref|YP_003194615.1| Biotin synthase [Robiginitalea biformata HTCC2501]
 gi|88785667|gb|EAR16836.1| Biotin synthase [Robiginitalea biformata HTCC2501]
          Length = 362

 Score =  321 bits (822), Expect = 1e-85,   Method: Composition-based stats.
 Identities = 152/314 (48%), Positives = 218/314 (69%), Gaps = 1/314 (0%)

Query: 13  TKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYC 72
           +     WT +EV +IYN P  +LL+ +  VHR++ +PN +Q+S LL+IKTGGCPE+CGYC
Sbjct: 2   SAIRHDWTREEVLEIYNRPVMELLYQAAGVHRQHHDPNTVQVSTLLSIKTGGCPEDCGYC 61

Query: 73  NQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKER-DLSIIVDMIKG 131
            Q+    + ++ + L+ V QV  +A  AK +G++R CMGAAWR  K+  +   +++M++ 
Sbjct: 62  PQAARYHTDIEGNDLMTVSQVKAQALRAKASGSSRVCMGAAWRNVKDGPEFESVLEMVRT 121

Query: 132 VKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLEN 191
           +  L +E C TLGM++  QAQ L++AGL  YNHN+DTSE +Y  V +T  FEDRL+T+ N
Sbjct: 122 INKLDMEVCCTLGMITENQAQRLAEAGLYAYNHNLDTSEDYYKDVISTRAFEDRLETIGN 181

Query: 192 VRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVD 251
           VRK+ + VC GGI+G+GE  +DR  ML+ L+ LS  PES+PIN L+ +PG+  E+ + V 
Sbjct: 182 VRKTNVTVCSGGIIGMGESPEDRAGMLVALSTLSPQPESVPINALVAVPGTPMEDMEPVS 241

Query: 252 PIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYN 311
             E VR+++  RI+MP++++RL+AGR  MS E QALCFF+GANSIF GD LLT  NP   
Sbjct: 242 IWEMVRMVATTRIVMPETQVRLSAGRTQMSQEGQALCFFAGANSIFAGDKLLTTPNPDVA 301

Query: 312 KDTILFNRLGLIPD 325
           +D  LF +LGL P 
Sbjct: 302 EDMELFRQLGLQPQ 315


>gi|289674354|ref|ZP_06495244.1| biotin synthase [Pseudomonas syringae pv. syringae FF5]
          Length = 350

 Score =  321 bits (822), Expect = 1e-85,   Method: Composition-based stats.
 Identities = 168/310 (54%), Positives = 230/310 (74%)

Query: 16  PKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQS 75
              WT  EV  ++  PFNDLLF + TVHR +F+ N +Q+S LL+IKTG CPE+C YC QS
Sbjct: 8   RHDWTLAEVRALFVQPFNDLLFQAQTVHRAHFDANRVQVSTLLSIKTGACPEDCKYCPQS 67

Query: 76  VHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSL 135
            H  + L+  KL+ V +VL+EA  AK  G+TR+CMGAAW+ P  +D+  +++M+KGVK++
Sbjct: 68  GHYNTGLEKEKLLEVQKVLEEAARAKAIGSTRFCMGAAWKHPSAKDMPYVLEMVKGVKAM 127

Query: 136 GLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKS 195
           G+ETCMTLG L  EQ + L+ AGLDYYNHN+DTS  FY  + TT T+ +RLQTL  VR +
Sbjct: 128 GMETCMTLGRLDQEQTEALATAGLDYYNHNLDTSPEFYGSIITTRTYGERLQTLAYVRDA 187

Query: 196 GIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEH 255
           G+K+C GGILG+GE +DDR  +L+ LANL   PES+PIN+L+ + G+  E  + VDP + 
Sbjct: 188 GMKICSGGILGMGESLDDRAGLLIQLANLPEHPESVPINMLVKVAGTPLENAEDVDPFDF 247

Query: 256 VRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTI 315
           +R+++VARILMPKS +RL+AGR  M++++QAL FF+GANSIF GD LLT  NP  +KD +
Sbjct: 248 IRMLAVARILMPKSHVRLSAGREAMNEQMQALAFFAGANSIFYGDKLLTTANPQADKDML 307

Query: 316 LFNRLGLIPD 325
           LF+RLG+ P+
Sbjct: 308 LFSRLGIKPE 317


>gi|224826044|ref|ZP_03699147.1| biotin synthase [Lutiella nitroferrum 2002]
 gi|224601681|gb|EEG07861.1| biotin synthase [Lutiella nitroferrum 2002]
          Length = 327

 Score =  321 bits (822), Expect = 1e-85,   Method: Composition-based stats.
 Identities = 159/326 (48%), Positives = 219/326 (67%), Gaps = 2/326 (0%)

Query: 1   MSRSTVVPEENPTKKPK--VWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLL 58
           M  ST+  +   T  P+   WT  E+  +  +PF +L+F +  +HR+ F+P  +QLS L+
Sbjct: 1   MQPSTIAFQRPATPHPESAAWTVDEIEALLALPFMELVFRAAEIHRQFFDPTKVQLSTLV 60

Query: 59  NIKTGGCPENCGYCNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPK 118
           +IKTGGCPE+CGYC QSVH+ + ++   ++ VD+V++ A+ AK+NGA R+CMGAAWR PK
Sbjct: 61  SIKTGGCPEDCGYCPQSVHHDTPVENQPMMTVDEVVEAARLAKQNGAGRFCMGAAWRGPK 120

Query: 119 ERDLSIIVDMIKGVKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTT 178
           + DL   +DM+K VK+LGLETC T G+L   QA+ L  AGLDYYNHN+DT+   Y  +  
Sbjct: 121 DADLDKTLDMVKRVKALGLETCATFGLLKDGQAEKLKDAGLDYYNHNLDTAPEKYADIIQ 180

Query: 179 THTFEDRLQTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIP 238
           T  +EDRL TL  VR +G+ VCCGGI+G+ E   DR  ++  LANL   PES+P+N L+ 
Sbjct: 181 TREYEDRLDTLGKVRGAGLSVCCGGIVGMNETRTDRAGLIAQLANLDPQPESVPVNNLVK 240

Query: 239 IPGSKFEENKKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFV 298
           + G+  +  + +D  E VR I+VARI MPKS +RL+AGR  M + +QALCF +GANSIF 
Sbjct: 241 VTGTPLDGAEPLDWTEFVRTIAVARITMPKSYVRLSAGRREMPEAMQALCFMAGANSIFY 300

Query: 299 GDTLLTAKNPSYNKDTILFNRLGLIP 324
           GD LLT  NP  + D  L  +L L P
Sbjct: 301 GDKLLTTGNPDVDADRALMEKLDLAP 326


>gi|169796196|ref|YP_001713989.1| biotin synthetase [Acinetobacter baumannii AYE]
 gi|332850547|ref|ZP_08432823.1| biotin synthase [Acinetobacter baumannii 6013150]
 gi|332865757|ref|ZP_08436552.1| biotin synthase [Acinetobacter baumannii 6013113]
 gi|332872516|ref|ZP_08440486.1| biotin synthase [Acinetobacter baumannii 6014059]
 gi|169149123|emb|CAM87000.1| biotin synthetase [Acinetobacter baumannii AYE]
 gi|322508191|gb|ADX03645.1| Biotin synthetase [Acinetobacter baumannii 1656-2]
 gi|323517279|gb|ADX91660.1| biotin synthetase [Acinetobacter baumannii TCDC-AB0715]
 gi|323517791|gb|ADX92172.1| biotin synthetase [Acinetobacter baumannii TCDC-AB0715]
 gi|332730609|gb|EGJ61923.1| biotin synthase [Acinetobacter baumannii 6013150]
 gi|332735098|gb|EGJ66182.1| biotin synthase [Acinetobacter baumannii 6013113]
 gi|332739322|gb|EGJ70179.1| biotin synthase [Acinetobacter baumannii 6014059]
          Length = 333

 Score =  320 bits (821), Expect = 1e-85,   Method: Composition-based stats.
 Identities = 170/310 (54%), Positives = 229/310 (73%)

Query: 16  PKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQS 75
              WT +E+  +Y  PF DL+F +  VHR++F  N IQ+S LL+IKTG CPE+C YC+QS
Sbjct: 8   RNDWTREEIQALYEQPFLDLVFKAQQVHREHFTANTIQVSTLLSIKTGKCPEDCKYCSQS 67

Query: 76  VHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSL 135
            H  SKL+A K I V++V+ EAK AK++G++R+CMGAAWR P ERD+  +++M++ VK+L
Sbjct: 68  AHYDSKLEAEKRIAVEKVISEAKAAKDSGSSRFCMGAAWRNPHERDMPYVLEMVREVKAL 127

Query: 136 GLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKS 195
           G+ETCMTLGML+  QA+ L  AGLDYYNHN+DTS  +Y H+ +T TF+DRL TL+ VR++
Sbjct: 128 GMETCMTLGMLNQSQAERLKDAGLDYYNHNLDTSREYYSHIISTRTFDDRLNTLDYVRQA 187

Query: 196 GIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEH 255
           G+KVC GGI+GLGE  +DRI +L  LA L   PES+PIN+L+PI G+   + +K+D IE 
Sbjct: 188 GMKVCSGGIVGLGESREDRIGLLHELATLPIHPESVPINMLVPIEGTPLADVEKLDVIEW 247

Query: 256 VRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTI 315
           +R I+VARI+MP S +RL+AGR  +SD  QAL F +GANS+F GD LLT  N    KD  
Sbjct: 248 IRTIAVARIIMPHSYIRLSAGRESLSDSDQALAFMAGANSLFSGDKLLTTPNAGEGKDQA 307

Query: 316 LFNRLGLIPD 325
           LFN+LGL  +
Sbjct: 308 LFNKLGLTAE 317


>gi|157375911|ref|YP_001474511.1| biotin synthase [Shewanella sediminis HAW-EB3]
 gi|254811580|sp|A8FX10|BIOB_SHESH RecName: Full=Biotin synthase
 gi|157318285|gb|ABV37383.1| Biotin synthase [Shewanella sediminis HAW-EB3]
          Length = 354

 Score =  320 bits (821), Expect = 1e-85,   Method: Composition-based stats.
 Identities = 167/313 (53%), Positives = 230/313 (73%)

Query: 14  KKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCN 73
           +    W   E+  ++ +P NDLLF +H++HR+ F+PN +Q+S+LL+IKTG CPE+C YC 
Sbjct: 5   QLRHDWKHDEIEALFALPMNDLLFKAHSLHRQVFDPNEVQISRLLSIKTGACPEDCKYCP 64

Query: 74  QSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVK 133
           QS    + L+  +LI +++VL EA++AK  GA+R+CMGAAWR P  RD+  + DM+  VK
Sbjct: 65  QSARYDTGLEKERLIEIEKVLTEARSAKAAGASRFCMGAAWRNPHARDMPYLKDMVSEVK 124

Query: 134 SLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVR 193
           ++G+ETCMTLGMLS  QA+ L++AGLDYYNHN+DTS  +Y  + TT T++DRL TL NVR
Sbjct: 125 AMGMETCMTLGMLSGTQAEELAEAGLDYYNHNLDTSPEYYGEIITTRTYQDRLDTLSNVR 184

Query: 194 KSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPI 253
            +G+KVC GGI+G+GE   DR  +L  LAN+   P+S+PIN+L+ + G+ FE    +DP+
Sbjct: 185 SAGMKVCSGGIVGMGEQASDRAGLLQQLANMEQHPDSVPINMLVKVAGTPFENLDDLDPL 244

Query: 254 EHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKD 313
           E VR I+VARI+MP SR+RL+AGR  M+DE+QA+CFF+GANSIF G  LLT  NP  N+D
Sbjct: 245 EFVRTIAVARIIMPHSRVRLSAGREKMTDEMQAMCFFAGANSIFYGCKLLTTNNPEENED 304

Query: 314 TILFNRLGLIPDL 326
             LF RLGL P+ 
Sbjct: 305 MTLFKRLGLHPEQ 317


>gi|260550049|ref|ZP_05824263.1| biotin synthetase [Acinetobacter sp. RUH2624]
 gi|260406804|gb|EEX00283.1| biotin synthetase [Acinetobacter sp. RUH2624]
          Length = 333

 Score =  320 bits (821), Expect = 1e-85,   Method: Composition-based stats.
 Identities = 170/310 (54%), Positives = 229/310 (73%)

Query: 16  PKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQS 75
              WT +E+  +Y  PF DL+F +  VHR++F  N IQ+S LL+IKTG CPE+C YC+QS
Sbjct: 8   RNDWTREEIQALYEQPFLDLVFKAQQVHREHFTANTIQVSTLLSIKTGKCPEDCKYCSQS 67

Query: 76  VHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSL 135
            H  SKL+A K I V++V+ EAK AK++G++R+CMGAAWR P ERD+  +++M++ VK+L
Sbjct: 68  AHYDSKLEAEKRIAVEKVISEAKAAKDSGSSRFCMGAAWRNPHERDMPYVLEMVREVKAL 127

Query: 136 GLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKS 195
           G+ETCMTLGML+  QA+ L  AGLDYYNHN+DTS  +Y H+ +T TF+DRL TL+ VR++
Sbjct: 128 GMETCMTLGMLNQSQAERLKDAGLDYYNHNLDTSREYYSHIISTRTFDDRLNTLDYVRQA 187

Query: 196 GIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEH 255
           G+KVC GGI+GLGE  +DRI +L  LA L   PES+PIN+L+PI G+   + +K+D IE 
Sbjct: 188 GMKVCSGGIVGLGESREDRIGLLHELATLPIHPESVPINMLVPIEGTPLADVEKLDVIEW 247

Query: 256 VRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTI 315
           +R I+VARI+MP S +RL+AGR  +SD  QAL F +GANS+F GD LLT  N    KD  
Sbjct: 248 IRTIAVARIVMPHSYIRLSAGRESLSDSDQALAFMAGANSLFSGDKLLTTPNAGEGKDQA 307

Query: 316 LFNRLGLIPD 325
           LFN+LGL  +
Sbjct: 308 LFNKLGLTAE 317


>gi|187927225|ref|YP_001897712.1| biotin synthase [Ralstonia pickettii 12J]
 gi|309780076|ref|ZP_07674828.1| biotin synthase [Ralstonia sp. 5_7_47FAA]
 gi|254810854|sp|B2UDA1|BIOB_RALPJ RecName: Full=Biotin synthase
 gi|187724115|gb|ACD25280.1| biotin synthase [Ralstonia pickettii 12J]
 gi|308921108|gb|EFP66753.1| biotin synthase [Ralstonia sp. 5_7_47FAA]
          Length = 359

 Score =  320 bits (821), Expect = 1e-85,   Method: Composition-based stats.
 Identities = 167/324 (51%), Positives = 229/324 (70%), Gaps = 3/324 (0%)

Query: 2   SRSTVVPEENPTKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIK 61
           +++ V P + P      W+ + +  ++ +PFNDLLF +  VHR NF+ N +QLS LL+IK
Sbjct: 13  AKAPVTPGQAP---DARWSREAIEALFALPFNDLLFQAQQVHRANFDANAVQLSTLLSIK 69

Query: 62  TGGCPENCGYCNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERD 121
           TGGCPE+C YC QS    + ++A KL+ +D VL+ A  AK+NGA+R+CMGAAWR PK   
Sbjct: 70  TGGCPEDCSYCPQSARYDTGVEAEKLMPIDAVLEAASRAKQNGASRFCMGAAWRNPKPHQ 129

Query: 122 LSIIVDMIKGVKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHT 181
           L  + DM++GVK++GLETC+TLGML  EQA  L +AGLDYYNHN+DT+  FY  + TT T
Sbjct: 130 LDAVADMVRGVKAMGLETCVTLGMLKQEQAAQLKEAGLDYYNHNLDTAPEFYGEIITTRT 189

Query: 182 FEDRLQTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPG 241
           ++DRL TLE+VR +GI VCCGGI+GLGE + +R  ++  LAN+   P+S+PIN L+ + G
Sbjct: 190 YQDRLDTLEHVRDAGINVCCGGIVGLGESVHERAGLIAELANMEPYPDSVPINNLVKVEG 249

Query: 242 SKFEENKKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDT 301
           +    N+++DP + VR I+VARI MPK+ +RL+AGR  M D LQALCF +GANSIF G+ 
Sbjct: 250 TPLAGNEELDPFDFVRTIAVARITMPKAMVRLSAGREAMDDALQALCFMAGANSIFYGEK 309

Query: 302 LLTAKNPSYNKDTILFNRLGLIPD 325
           LLT  NP  + D  L  RLG+  +
Sbjct: 310 LLTTDNPEADADRKLLARLGMRVE 333


>gi|330956966|gb|EGH57226.1| biotin synthase [Pseudomonas syringae pv. maculicola str. ES4326]
          Length = 352

 Score =  320 bits (821), Expect = 1e-85,   Method: Composition-based stats.
 Identities = 169/310 (54%), Positives = 230/310 (74%)

Query: 16  PKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQS 75
              WT  EV  ++  PFNDLLF + TVHR +F+ N +Q+S LL+IKTG CPE+C YC QS
Sbjct: 10  RHDWTLAEVRALFVQPFNDLLFQAQTVHRAHFDANRVQVSTLLSIKTGACPEDCKYCPQS 69

Query: 76  VHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSL 135
            H  + L+  KL+ V +VL+EA  AK  G+TR+CMGAAW+ P  +D+  +++M+KGVK++
Sbjct: 70  GHYNTGLEKEKLLEVQKVLEEAARAKAIGSTRFCMGAAWKHPSAKDMPYVLEMVKGVKAM 129

Query: 136 GLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKS 195
           GLETCMTLG L  EQ + L+ AGLDYYNHN+DTS  FY  + TT T+ +RLQTL  VR +
Sbjct: 130 GLETCMTLGRLDQEQTEALATAGLDYYNHNLDTSPEFYGSIITTRTYSERLQTLAYVRDA 189

Query: 196 GIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEH 255
           G+K+C GGILG+GE +DDR  +L+ LANL   PES+PIN+L+ + G+  E  + VDP + 
Sbjct: 190 GMKICSGGILGMGESLDDRAGLLIQLANLPEHPESVPINMLVKVAGTPLENAEDVDPFDF 249

Query: 256 VRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTI 315
           +R+++VARILMPKS +RL+AGR  M++++QAL FF+GANSIF GD LLT  NP  +KD +
Sbjct: 250 IRMLAVARILMPKSHVRLSAGREAMNEQMQALAFFAGANSIFYGDKLLTTANPQADKDML 309

Query: 316 LFNRLGLIPD 325
           LF+RLG+ P+
Sbjct: 310 LFSRLGIKPE 319


>gi|207727704|ref|YP_002256098.1| biotin synthase protein [Ralstonia solanacearum MolK2]
 gi|206590945|emb|CAQ56557.1| biotin synthase protein [Ralstonia solanacearum MolK2]
          Length = 359

 Score =  320 bits (821), Expect = 1e-85,   Method: Composition-based stats.
 Identities = 168/324 (51%), Positives = 226/324 (69%), Gaps = 3/324 (0%)

Query: 2   SRSTVVPEENPTKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIK 61
           ++   VP +NP      W+ + +  ++ +PFNDLLF +  VHR NF+ N +QLS LL+IK
Sbjct: 13  AKVPPVPGQNP---NARWSREAIEALFALPFNDLLFQAQQVHRANFDANAVQLSTLLSIK 69

Query: 62  TGGCPENCGYCNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERD 121
           TGGCPE+C YC QS    + ++A KL+ +D VL+ A  A++NGA+R+CMGAAWR PK   
Sbjct: 70  TGGCPEDCSYCPQSARYDTGVEAEKLMPIDAVLEAAARARQNGASRFCMGAAWRNPKPHQ 129

Query: 122 LSIIVDMIKGVKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHT 181
           L  + DM++GVK++GLETC+TLGML  EQAQ L  AGLDYYNHN+DT+  FY  + TT T
Sbjct: 130 LDAVADMVRGVKAMGLETCVTLGMLKQEQAQQLKDAGLDYYNHNLDTAPEFYGEIITTRT 189

Query: 182 FEDRLQTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPG 241
           ++DRL TL +VR +GI VCCGGI+GLGE   +R  ++  LAN+   P+S+PIN L+ + G
Sbjct: 190 YQDRLDTLGHVRDAGINVCCGGIVGLGESRHERAGLVAELANMEPYPDSVPINNLVKVEG 249

Query: 242 SKFEENKKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDT 301
           +    N+ +DP E VR I+VARI MPK+ +RL+AGR  M D LQALCF +GANSIF G+ 
Sbjct: 250 TPLAGNEALDPFEFVRTIAVARITMPKAMVRLSAGREAMDDALQALCFMAGANSIFYGEK 309

Query: 302 LLTAKNPSYNKDTILFNRLGLIPD 325
           LLT  NP  + D  L  RLG+  +
Sbjct: 310 LLTTDNPEADADRKLLARLGMRVE 333


>gi|221134207|ref|ZP_03560512.1| biotin synthase [Glaciecola sp. HTCC2999]
          Length = 378

 Score =  320 bits (821), Expect = 1e-85,   Method: Composition-based stats.
 Identities = 165/308 (53%), Positives = 233/308 (75%)

Query: 16  PKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQS 75
              WT +EV  +YNMPFNDL+F + TVHR +F+PN++Q+S LL+IKTG CPE+C YC QS
Sbjct: 23  RHDWTLEEVKALYNMPFNDLMFKAQTVHRTHFDPNYVQVSTLLSIKTGACPEDCKYCPQS 82

Query: 76  VHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSL 135
               + L+  +L+ +++V++ AK A+  G+TR+CMGAAWR P+ERD+  +VDM+K VKSL
Sbjct: 83  ARYDTGLEKERLMEIEKVIQRAKEARATGSTRFCMGAAWRNPRERDMPYVVDMVKQVKSL 142

Query: 136 GLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKS 195
           GLETCMTLGML+ EQA  L +AGLDYYNHN+DTS  +Y  + TT T++DRL TL+NVR +
Sbjct: 143 GLETCMTLGMLTREQAIALKQAGLDYYNHNLDTSPEYYGDIITTRTYQDRLDTLQNVRDA 202

Query: 196 GIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEH 255
           G+ VC GGI+G+GE  DDR  +L+ L+NL   PES+PIN+L+ + G+  ++   +DP E 
Sbjct: 203 GMHVCSGGIVGMGEKGDDRAGLLIALSNLERHPESVPINMLVKVKGTPLDKVDDLDPFEF 262

Query: 256 VRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTI 315
           +R I++ARI+MP+S +RL+AGR  M++++QA+CF +GANSIF G  LLT  NP  ++D +
Sbjct: 263 IRTIAIARIMMPQSFVRLSAGREAMNEQMQAMCFMAGANSIFYGCKLLTTSNPETHEDVM 322

Query: 316 LFNRLGLI 323
           LF +LG+ 
Sbjct: 323 LFKKLGIN 330


>gi|149926727|ref|ZP_01914987.1| probable biotin synthase protein [Limnobacter sp. MED105]
 gi|149824656|gb|EDM83872.1| probable biotin synthase protein [Limnobacter sp. MED105]
          Length = 333

 Score =  320 bits (821), Expect = 1e-85,   Method: Composition-based stats.
 Identities = 162/312 (51%), Positives = 228/312 (73%)

Query: 12  PTKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGY 71
           PT   + W+ + +  ++ +PFNDL+F +  VHR++F+ N +QLS LL+IKTGGCPE+CGY
Sbjct: 18  PTVDTQRWSVEAIEALFALPFNDLIFKAQQVHREHFDANTVQLSTLLSIKTGGCPEDCGY 77

Query: 72  CNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKG 131
           C QS    + ++A KL+ +++VLK A+ AK+ GATR+CMGAAWR PK+  +  + +M+  
Sbjct: 78  CPQSAKYNTGVEAEKLMPIEEVLKAAQAAKDKGATRFCMGAAWRSPKDHQVDAVGEMVTA 137

Query: 132 VKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLEN 191
           VK++GLETC+TLGML   QA+ L +AGLDYYNHN+DTS  FY  + +T T++DRL TL+ 
Sbjct: 138 VKAMGLETCVTLGMLKEHQAKQLQEAGLDYYNHNLDTSPDFYGDIISTRTYQDRLDTLDR 197

Query: 192 VRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVD 251
           VR +GIKVCCGGI+GLGE +  R  ++  LAN++ PPES+PIN L+ + G+   +N ++D
Sbjct: 198 VRDAGIKVCCGGIVGLGETVTQRAGLIAQLANMAEPPESVPINNLVKVEGTPLADNAEID 257

Query: 252 PIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYN 311
           P++ VR I+VARI MP S +RL+AGR  M++  QALCF +GANSIF G+ LL   NP   
Sbjct: 258 PLDFVRTIAVARITMPTSFVRLSAGRESMNESTQALCFLAGANSIFYGEKLLVTDNPELE 317

Query: 312 KDTILFNRLGLI 323
           +DT LF +LGL 
Sbjct: 318 RDTKLFEKLGLK 329


>gi|71736758|ref|YP_276822.1| biotin synthase [Pseudomonas syringae pv. phaseolicola 1448A]
 gi|123747532|sp|Q48CS1|BIOB_PSE14 RecName: Full=Biotin synthase
 gi|71557311|gb|AAZ36522.1| biotin synthase [Pseudomonas syringae pv. phaseolicola 1448A]
          Length = 352

 Score =  320 bits (821), Expect = 1e-85,   Method: Composition-based stats.
 Identities = 167/310 (53%), Positives = 230/310 (74%)

Query: 16  PKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQS 75
              WT  EV  ++  PFNDLLF + TVHR +F+ N +Q+S LL+IKTG CPE+C YC QS
Sbjct: 10  RHDWTLAEVRALFVQPFNDLLFQAQTVHRAHFDANRVQVSTLLSIKTGACPEDCKYCPQS 69

Query: 76  VHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSL 135
            H  + L+  KL+ V +VL+EA  AK  G+TR+CMGAAW+ P  +D+  +++M+KGVK++
Sbjct: 70  GHYNTGLEKEKLLEVQKVLEEAARAKAIGSTRFCMGAAWKHPSAKDMPYVLEMVKGVKAM 129

Query: 136 GLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKS 195
           G+ETCMTLG L  EQ + L+ AGLDYYNHN+DTS  FY  + TT T+ +RLQTL  VR +
Sbjct: 130 GMETCMTLGRLDQEQTEALATAGLDYYNHNLDTSPEFYGSIITTRTYSERLQTLAYVRDA 189

Query: 196 GIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEH 255
           G+K+C GGILG+GE +DDR  +L+ LANL   PES+PIN+L+ + G+  E  + VDP + 
Sbjct: 190 GMKICSGGILGMGESLDDRAGLLIQLANLPEHPESVPINMLVKVAGTPLENAEDVDPFDF 249

Query: 256 VRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTI 315
           +R+++VARILMP+S +RL+AGR  M++++QAL FF+GANSIF GD LLT  NP  +KD +
Sbjct: 250 IRMLAVARILMPQSHVRLSAGREAMNEQMQALAFFAGANSIFYGDKLLTTANPQADKDML 309

Query: 316 LFNRLGLIPD 325
           LF+RLG+ P+
Sbjct: 310 LFSRLGIKPE 319


>gi|299068209|emb|CBJ39428.1| biotin synthetase [Ralstonia solanacearum CMR15]
          Length = 359

 Score =  320 bits (821), Expect = 1e-85,   Method: Composition-based stats.
 Identities = 165/308 (53%), Positives = 220/308 (71%)

Query: 18  VWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQSVH 77
            W+ + +  ++ +PFNDLLF +  VHR +F+ N +QLS LL+IKTGGCPE+C YC QS  
Sbjct: 26  RWSREAIEALFALPFNDLLFQAQQVHRAHFDANAVQLSTLLSIKTGGCPEDCSYCPQSAR 85

Query: 78  NKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLGL 137
             + ++A KL+ +D VL+ A  AK+NGA+R+CMGAAWR PK   L  + DM++GVK++GL
Sbjct: 86  YDTGVEAEKLMPIDTVLEAASRAKQNGASRFCMGAAWRNPKPHQLDAVADMVRGVKAMGL 145

Query: 138 ETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSGI 197
           ETC+TLGML  EQAQ L  AGLDYYNHN+DT+  FY  + TT T++DRL TLE+VR +GI
Sbjct: 146 ETCVTLGMLKQEQAQQLKNAGLDYYNHNLDTAPEFYGEIITTRTYQDRLDTLEHVRDAGI 205

Query: 198 KVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEHVR 257
            VCCGGI+GLGE   +R  ++  LAN+   P+S+PIN L+ + G+    N+ +DP E VR
Sbjct: 206 NVCCGGIVGLGESRHERAGLVAELANMEPYPDSVPINNLVKVEGTPLAGNEALDPFEFVR 265

Query: 258 IISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTILF 317
            I+VARI MPK+ +RL+AGR  M D LQALCF +GANSIF G+ LLT  NP  + D  L 
Sbjct: 266 TIAVARITMPKAMVRLSAGREAMDDALQALCFMAGANSIFYGEKLLTTDNPEADADRKLL 325

Query: 318 NRLGLIPD 325
            RLG+  +
Sbjct: 326 ARLGMRVE 333


>gi|257483058|ref|ZP_05637099.1| biotin synthase [Pseudomonas syringae pv. tabaci ATCC 11528]
 gi|289624782|ref|ZP_06457736.1| biotin synthase [Pseudomonas syringae pv. aesculi str. NCPPB3681]
 gi|298489184|ref|ZP_07007203.1| Biotin synthase [Pseudomonas savastanoi pv. savastanoi NCPPB 3335]
 gi|298156266|gb|EFH97367.1| Biotin synthase [Pseudomonas savastanoi pv. savastanoi NCPPB 3335]
 gi|320326430|gb|EFW82483.1| biotin synthase [Pseudomonas syringae pv. glycinea str. B076]
 gi|320331598|gb|EFW87536.1| biotin synthase [Pseudomonas syringae pv. glycinea str. race 4]
 gi|330871187|gb|EGH05896.1| biotin synthase [Pseudomonas syringae pv. aesculi str. 0893_23]
 gi|330985849|gb|EGH83952.1| biotin synthase [Pseudomonas syringae pv. lachrymans str. M301315]
 gi|331011708|gb|EGH91764.1| biotin synthase [Pseudomonas syringae pv. tabaci ATCC 11528]
          Length = 352

 Score =  320 bits (821), Expect = 1e-85,   Method: Composition-based stats.
 Identities = 167/310 (53%), Positives = 230/310 (74%)

Query: 16  PKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQS 75
              WT  EV  ++  PFNDLLF + TVHR +F+ N +Q+S LL+IKTG CPE+C YC QS
Sbjct: 10  RHDWTLAEVRALFVQPFNDLLFQAQTVHRAHFDANRVQVSTLLSIKTGACPEDCKYCPQS 69

Query: 76  VHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSL 135
            H  + L+  KL+ V +VL+EA  AK  G+TR+CMGAAW+ P  +D+  +++M+KGVK++
Sbjct: 70  GHYNTGLEKEKLLEVQKVLEEAARAKAIGSTRFCMGAAWKHPSAKDMPYVLEMVKGVKAM 129

Query: 136 GLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKS 195
           G+ETCMTLG L  EQ + L+ AGLDYYNHN+DTS  FY  + TT T+ +RLQTL  VR +
Sbjct: 130 GMETCMTLGRLDQEQTEALATAGLDYYNHNLDTSPEFYGSIITTRTYSERLQTLAYVRDA 189

Query: 196 GIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEH 255
           G+K+C GGILG+GE +DDR  +L+ LANL   PES+PIN+L+ + G+  E  + VDP + 
Sbjct: 190 GMKICSGGILGMGESLDDRAGLLIQLANLPEHPESVPINMLVKVAGTPLENAEDVDPFDF 249

Query: 256 VRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTI 315
           +R+++VARILMP+S +RL+AGR  M++++QAL FF+GANSIF GD LLT  NP  +KD +
Sbjct: 250 IRMLAVARILMPQSHVRLSAGREAMNEQMQALAFFAGANSIFYGDKLLTTANPQADKDML 309

Query: 316 LFNRLGLIPD 325
           LF+RLG+ P+
Sbjct: 310 LFSRLGIKPE 319


>gi|260555247|ref|ZP_05827468.1| biotin synthase [Acinetobacter baumannii ATCC 19606]
 gi|260411789|gb|EEX05086.1| biotin synthase [Acinetobacter baumannii ATCC 19606]
          Length = 333

 Score =  320 bits (821), Expect = 1e-85,   Method: Composition-based stats.
 Identities = 170/310 (54%), Positives = 229/310 (73%)

Query: 16  PKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQS 75
              WT +E+  +Y  PF DL+F +  VHR++F  N IQ+S LL+IKTG CPE+C YC+QS
Sbjct: 8   RNDWTREEIQALYEQPFLDLVFKAQQVHREHFTANTIQVSTLLSIKTGKCPEDCKYCSQS 67

Query: 76  VHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSL 135
            H  SKL+A K I V++V+ EAK AK++G++R+CMGAAWR P ERD+  +++M++ VK+L
Sbjct: 68  AHYDSKLEAEKRIAVEKVISEAKAAKDSGSSRFCMGAAWRNPHERDMPYVLEMVREVKAL 127

Query: 136 GLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKS 195
           G+ETCMTLGML+  QA+ L  AGLDYYNHN+DTS  +Y H+ +T TF+DRL TL+ VR++
Sbjct: 128 GMETCMTLGMLNQSQAERLKDAGLDYYNHNLDTSREYYSHIISTRTFDDRLNTLDYVRQA 187

Query: 196 GIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEH 255
           G+KVC GGI+GLGE  +DRI +L  LA L   PES+PIN+L+PI G+   + +K+D IE 
Sbjct: 188 GMKVCSGGIVGLGESREDRIGLLHELATLPIHPESVPINMLVPIEGTPLADVEKLDVIEW 247

Query: 256 VRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTI 315
           +R I+VARI+MP S +RL+AGR  +SD  QAL F +GANS+F GD LLT  N    KD  
Sbjct: 248 IRTIAVARIIMPHSYIRLSAGRESLSDSDQALAFMAGANSLFSGDKLLTTPNTGEGKDQA 307

Query: 316 LFNRLGLIPD 325
           LFN+LGL  +
Sbjct: 308 LFNKLGLTAE 317


>gi|126173985|ref|YP_001050134.1| biotin synthase [Shewanella baltica OS155]
 gi|153000276|ref|YP_001365957.1| biotin synthase [Shewanella baltica OS185]
 gi|160874910|ref|YP_001554226.1| biotin synthase [Shewanella baltica OS195]
 gi|217973693|ref|YP_002358444.1| biotin synthase [Shewanella baltica OS223]
 gi|304411464|ref|ZP_07393078.1| biotin synthase [Shewanella baltica OS183]
 gi|307305214|ref|ZP_07584962.1| biotin synthase [Shewanella baltica BA175]
 gi|254811570|sp|B8EAJ2|BIOB_SHEB2 RecName: Full=Biotin synthase
 gi|254811571|sp|A3D3F2|BIOB_SHEB5 RecName: Full=Biotin synthase
 gi|254811572|sp|A6WM55|BIOB_SHEB8 RecName: Full=Biotin synthase
 gi|254811573|sp|A9KY60|BIOB_SHEB9 RecName: Full=Biotin synthase
 gi|125997190|gb|ABN61265.1| biotin synthase [Shewanella baltica OS155]
 gi|151364894|gb|ABS07894.1| biotin synthase [Shewanella baltica OS185]
 gi|160860432|gb|ABX48966.1| biotin synthase [Shewanella baltica OS195]
 gi|217498828|gb|ACK47021.1| biotin synthase [Shewanella baltica OS223]
 gi|304350319|gb|EFM14723.1| biotin synthase [Shewanella baltica OS183]
 gi|306911517|gb|EFN41942.1| biotin synthase [Shewanella baltica BA175]
 gi|315267147|gb|ADT94000.1| biotin synthase [Shewanella baltica OS678]
          Length = 350

 Score =  320 bits (821), Expect = 1e-85,   Method: Composition-based stats.
 Identities = 171/316 (54%), Positives = 232/316 (73%)

Query: 13  TKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYC 72
            +    W  +E+  ++ +P NDLLF +H++HR+ ++PN +Q+S+LL+IKTG CPE+C YC
Sbjct: 4   LQVRHDWKREEIEALFALPMNDLLFKAHSIHREVYDPNEVQISRLLSIKTGACPEDCKYC 63

Query: 73  NQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGV 132
            QS    + L+  +L+ ++ VL EA++AK  GA+R+CMGAAWR PKE+D+  +  M++ V
Sbjct: 64  PQSARYDTGLEKERLLAMETVLTEARSAKAAGASRFCMGAAWRNPKEKDMPYLKQMVQEV 123

Query: 133 KSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENV 192
           K+LG+ETCMTLGMLS +QA  L+ AGLDYYNHN+DTS  +Y  V TT T+++RL TL NV
Sbjct: 124 KALGMETCMTLGMLSEDQANDLASAGLDYYNHNLDTSPEYYGDVITTRTYQNRLDTLTNV 183

Query: 193 RKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDP 252
           R SG+KVC GGI+G+GE   DR  +L  LANL   P+S+PIN+L+ + G+ FE+   +DP
Sbjct: 184 RASGMKVCSGGIVGMGEKATDRAGLLQQLANLPQHPDSVPINMLVKVAGTPFEKLDDLDP 243

Query: 253 IEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNK 312
           +E VR I+VARILMP SR+RL+AGR  MSDELQA+CFF+GANSIF G  LLT  NP  + 
Sbjct: 244 LEFVRTIAVARILMPLSRVRLSAGRENMSDELQAMCFFAGANSIFYGCKLLTTPNPEESD 303

Query: 313 DTILFNRLGLIPDLSA 328
           D  LF RLGL P+  A
Sbjct: 304 DMGLFRRLGLRPEQGA 319


>gi|167561307|ref|ZP_02354223.1| biotin synthase [Burkholderia oklahomensis EO147]
 gi|167568537|ref|ZP_02361411.1| biotin synthase [Burkholderia oklahomensis C6786]
          Length = 339

 Score =  320 bits (821), Expect = 1e-85,   Method: Composition-based stats.
 Identities = 176/321 (54%), Positives = 229/321 (71%), Gaps = 2/321 (0%)

Query: 2   SRSTVVPEENPTKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIK 61
           S +T  P   P      W   +V  +Y +PFNDLLF +  VHR++F+ N IQLS LL+IK
Sbjct: 11  SATTETPVAAPVAP--RWRVADVIALYELPFNDLLFRAQQVHREHFDANAIQLSTLLSIK 68

Query: 62  TGGCPENCGYCNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERD 121
           TGGC E+CGYC+QS H+ + LKA KL+ VD VL  A+ AK+NGATR+CMGAAWR PK+R 
Sbjct: 69  TGGCEEDCGYCSQSAHHDTGLKAEKLMEVDAVLAAARTAKDNGATRFCMGAAWRNPKDRH 128

Query: 122 LSIIVDMIKGVKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHT 181
           +  I +MI+GVK +GLETC+TLGML   QA+ L++AGLDYYNHN+DTS  FY  V +T T
Sbjct: 129 IEPIKEMIRGVKEMGLETCVTLGMLEEHQAKALAEAGLDYYNHNLDTSPEFYGQVISTRT 188

Query: 182 FEDRLQTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPG 241
           ++DRL TLE VR +GI VCCGGI+G+GE   +R  ++  LAN++  PES+PIN L+ I G
Sbjct: 189 YQDRLDTLERVRDAGINVCCGGIIGMGESRRERAGLITQLANMNPYPESVPINNLVAIEG 248

Query: 242 SKFEENKKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDT 301
           +  E  + +DP+E VR I+VARI MPK+ +RL+AGR  + D +QALCF +GANS+F GD 
Sbjct: 249 TPLENAEPLDPLEFVRTIAVARITMPKAMVRLSAGREQLDDSMQALCFLAGANSMFYGDV 308

Query: 302 LLTAKNPSYNKDTILFNRLGL 322
           LLT  NP    D  L  RLG+
Sbjct: 309 LLTTGNPRAEADRKLLARLGM 329


>gi|242239865|ref|YP_002988046.1| biotin synthase [Dickeya dadantii Ech703]
 gi|242131922|gb|ACS86224.1| biotin synthase [Dickeya dadantii Ech703]
          Length = 346

 Score =  320 bits (821), Expect = 1e-85,   Method: Composition-based stats.
 Identities = 159/313 (50%), Positives = 229/313 (73%)

Query: 15  KPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQ 74
           + K WT ++   +++ PF  L+F +  VHR++F+P  +Q+S LL+IKTG CPE+C YC Q
Sbjct: 4   ERKHWTLEQAQALFDKPFLALMFEAQQVHRQHFDPQLVQVSTLLSIKTGACPEDCKYCPQ 63

Query: 75  SVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKS 134
           S   ++ ++  +L+ V+QVL  A+ AKE G+TR+CMGAAW+ P  RD+  +  M++GVK+
Sbjct: 64  SARYRTGIENERLMQVEQVLDSARQAKEAGSTRFCMGAAWKNPHARDMPYLEAMVRGVKA 123

Query: 135 LGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRK 194
           +G+ETCMTLG L  +QA+ L+ AGLD+YNHN+DTS  FY ++ TT T+++RL TL+ VR 
Sbjct: 124 MGMETCMTLGTLHGDQAERLAAAGLDFYNHNLDTSPEFYGNIITTRTYQERLDTLDKVRD 183

Query: 195 SGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIE 254
           +GIKVC GGI+GLGE + DR  +L+ LANL  PPES+PIN+L+ + G+  E N++VD  +
Sbjct: 184 AGIKVCSGGIVGLGETVRDRAGLLVQLANLPKPPESVPINMLVKVKGTPLENNEEVDAFD 243

Query: 255 HVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDT 314
            +R I+VARI+MP S +RL+AGR  MS++ QA+CF +GANSIF G  LLT  NP  +KD 
Sbjct: 244 FIRTIAVARIMMPTSYVRLSAGREQMSEQTQAMCFMAGANSIFYGCKLLTTPNPHEDKDR 303

Query: 315 ILFNRLGLIPDLS 327
           +LF +LGL P  +
Sbjct: 304 LLFRKLGLNPQQT 316


>gi|24374281|ref|NP_718324.1| biotin synthase [Shewanella oneidensis MR-1]
 gi|81589182|sp|Q8EDK6|BIOB_SHEON RecName: Full=Biotin synthase
 gi|24348816|gb|AAN55768.1|AE015713_1 biotin synthase [Shewanella oneidensis MR-1]
          Length = 350

 Score =  320 bits (821), Expect = 1e-85,   Method: Composition-based stats.
 Identities = 170/316 (53%), Positives = 233/316 (73%)

Query: 13  TKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYC 72
            +    W  +E+  ++ +P NDLLF +H++HR+ ++PN +Q+S+LL+IKTG CPE+C YC
Sbjct: 4   LQVRHDWKREEIEALFALPMNDLLFKAHSIHREEYDPNEVQISRLLSIKTGACPEDCKYC 63

Query: 73  NQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGV 132
            QS    + L+  +L+ ++ VL EA++AK  GA+R+CMGAAWR PK++D+  +  M++ V
Sbjct: 64  PQSARYDTGLEKERLLAMETVLTEARSAKAAGASRFCMGAAWRNPKDKDMPYLKQMVQEV 123

Query: 133 KSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENV 192
           K+LG+ETCMTLGMLS EQA  L++AGLDYYNHN+DTS  +Y  V TT T+++RL TL +V
Sbjct: 124 KALGMETCMTLGMLSAEQANELAEAGLDYYNHNLDTSPEYYGDVITTRTYQNRLDTLSHV 183

Query: 193 RKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDP 252
           R SG+KVC GGI+G+GE   DR  +L  LANL   P+S+PIN+L+ + G+ FE+   +DP
Sbjct: 184 RASGMKVCSGGIVGMGEKATDRAGLLQQLANLPQHPDSVPINMLVKVAGTPFEKLDDLDP 243

Query: 253 IEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNK 312
           +E VR I+VARILMP SR+RL+AGR  MSDELQA+CFF+GANSIF G  LLT  NP  + 
Sbjct: 244 LEFVRTIAVARILMPLSRVRLSAGRENMSDELQAMCFFAGANSIFYGCKLLTTPNPEESD 303

Query: 313 DTILFNRLGLIPDLSA 328
           D  LF RLGL P+  A
Sbjct: 304 DMGLFRRLGLRPEQGA 319


>gi|207742104|ref|YP_002258496.1| biotin synthase protein [Ralstonia solanacearum IPO1609]
 gi|206593491|emb|CAQ60418.1| biotin synthase protein [Ralstonia solanacearum IPO1609]
          Length = 359

 Score =  320 bits (820), Expect = 2e-85,   Method: Composition-based stats.
 Identities = 168/324 (51%), Positives = 225/324 (69%), Gaps = 3/324 (0%)

Query: 2   SRSTVVPEENPTKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIK 61
           ++   VP +NP      W+ + +  ++ +PFNDLLF +  VHR NF+ N +QLS LL+IK
Sbjct: 13  AKVPPVPGQNP---NARWSREAIEALFALPFNDLLFQAQQVHRANFDANAVQLSTLLSIK 69

Query: 62  TGGCPENCGYCNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERD 121
           TGGCPE+C YC QS    + ++A KL+ +D VL  A  A++NGA+R+CMGAAWR PK   
Sbjct: 70  TGGCPEDCSYCPQSARYDTGVEAEKLMPIDAVLDAAARARQNGASRFCMGAAWRNPKPHQ 129

Query: 122 LSIIVDMIKGVKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHT 181
           L  + DM++GVK++GLETC+TLGML  EQAQ L  AGLDYYNHN+DT+  FY  + TT T
Sbjct: 130 LDAVADMVRGVKAMGLETCVTLGMLKQEQAQQLKDAGLDYYNHNLDTAPEFYGEIITTRT 189

Query: 182 FEDRLQTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPG 241
           ++DRL TL +VR +GI VCCGGI+GLGE   +R  ++  LAN+   P+S+PIN L+ + G
Sbjct: 190 YQDRLDTLGHVRDAGINVCCGGIVGLGESRHERAGLVAELANMEPYPDSVPINNLVKVEG 249

Query: 242 SKFEENKKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDT 301
           +    N+ +DP E VR I+VARI MPK+ +RL+AGR  M D LQALCF +GANSIF G+ 
Sbjct: 250 TPLAGNEALDPFEFVRTIAVARITMPKAMVRLSAGREAMDDALQALCFMAGANSIFYGEK 309

Query: 302 LLTAKNPSYNKDTILFNRLGLIPD 325
           LLT  NP  + D  L  RLG+  +
Sbjct: 310 LLTTDNPEADADRKLLARLGMRVE 333


>gi|330898836|gb|EGH30255.1| biotin synthase [Pseudomonas syringae pv. japonica str. M301072PT]
 gi|330938547|gb|EGH42130.1| biotin synthase [Pseudomonas syringae pv. pisi str. 1704B]
 gi|330979908|gb|EGH78208.1| biotin synthase [Pseudomonas syringae pv. aptata str. DSM 50252]
          Length = 352

 Score =  320 bits (820), Expect = 2e-85,   Method: Composition-based stats.
 Identities = 168/310 (54%), Positives = 230/310 (74%)

Query: 16  PKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQS 75
              WT  EV  ++  PFNDLLF + TVHR +F+ N +Q+S LL+IKTG CPE+C YC QS
Sbjct: 10  RHDWTLAEVRALFVQPFNDLLFQAQTVHRAHFDANRVQVSTLLSIKTGACPEDCKYCPQS 69

Query: 76  VHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSL 135
            H  + L+  KL+ V +VL+EA  AK  G+TR+CMGAAW+ P  +D+  +++M+KGVK++
Sbjct: 70  GHYNTGLEKEKLLEVQKVLEEAARAKAIGSTRFCMGAAWKHPSAKDMPYVLEMVKGVKAM 129

Query: 136 GLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKS 195
           G+ETCMTLG L  EQ + L+ AGLDYYNHN+DTS  FY  + TT T+ +RLQTL  VR +
Sbjct: 130 GMETCMTLGRLDQEQTEALATAGLDYYNHNLDTSPEFYGSIITTRTYAERLQTLAYVRDA 189

Query: 196 GIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEH 255
           G+K+C GGILG+GE +DDR  +L+ LANL   PES+PIN+L+ + G+  E  + VDP + 
Sbjct: 190 GMKICSGGILGMGESLDDRAGLLIQLANLPEHPESVPINMLVKVAGTPLENAEDVDPFDF 249

Query: 256 VRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTI 315
           +R+++VARILMPKS +RL+AGR  M++++QAL FF+GANSIF GD LLT  NP  +KD +
Sbjct: 250 IRMLAVARILMPKSHVRLSAGREAMNEQMQALAFFAGANSIFYGDKLLTTANPQADKDML 309

Query: 316 LFNRLGLIPD 325
           LF+RLG+ P+
Sbjct: 310 LFSRLGIKPE 319


>gi|85058881|ref|YP_454583.1| biotin synthase BioB [Sodalis glossinidius str. 'morsitans']
 gi|123725422|sp|Q2NUJ7|BIOB_SODGM RecName: Full=Biotin synthase
 gi|84779401|dbj|BAE74178.1| biotin synthase BioB [Sodalis glossinidius str. 'morsitans']
          Length = 345

 Score =  320 bits (820), Expect = 2e-85,   Method: Composition-based stats.
 Identities = 159/309 (51%), Positives = 229/309 (74%)

Query: 17  KVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQSV 76
           + WT  +   +++ PF +LLF +  VHR++F P  +Q+S LL+IKTG CPE+C YC QS 
Sbjct: 5   QRWTQAQARALFDKPFLELLFEAQQVHRQHFTPGEVQVSTLLSIKTGACPEDCKYCPQSA 64

Query: 77  HNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLG 136
              + L++ +L+ V QVL  A+ A++ G+TR+CMGAAW+ P +RD+ ++  M++GVK++G
Sbjct: 65  RYSTGLESERLMQVQQVLDAARKARDAGSTRFCMGAAWKNPHDRDMPLLEQMVQGVKAMG 124

Query: 137 LETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSG 196
           LETCMTLGML+  Q Q L++AGLD+YNHN+DTS  FY  + TT +++DRL TL  VR++G
Sbjct: 125 LETCMTLGMLNDRQVQRLAEAGLDFYNHNLDTSPEFYGSIVTTRSYQDRLDTLSKVRQAG 184

Query: 197 IKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEHV 256
           IKVC GGI+GLGE I DR  +L+ LANL TPPES+PIN+L+ + G+   +N+ VDP E +
Sbjct: 185 IKVCSGGIVGLGEDIRDRAGLLVQLANLPTPPESVPINMLVKVKGTPLADNEDVDPFEFI 244

Query: 257 RIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTIL 316
           R I+VARI+MP+S +RL+AGR  M+++ QALCF +GANS+F G  LLT  NP  ++D  L
Sbjct: 245 RTIAVARIMMPRSHVRLSAGREQMNEQTQALCFMAGANSVFYGCKLLTTPNPGEDRDMAL 304

Query: 317 FNRLGLIPD 325
           F++LG+  +
Sbjct: 305 FHKLGINIE 313


>gi|284007137|emb|CBA72414.1| biotin synthase [Arsenophonus nasoniae]
          Length = 375

 Score =  320 bits (820), Expect = 2e-85,   Method: Composition-based stats.
 Identities = 170/321 (52%), Positives = 234/321 (72%)

Query: 7   VPEENPTKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCP 66
           V  E   K  K WT  +   ++++PF +LLF +  VHR +F+P  IQ+S LL+IKTG CP
Sbjct: 25  VSRERMVKMEKPWTLSQAQALFDLPFFELLFQAQQVHRLHFDPQQIQISTLLSIKTGACP 84

Query: 67  ENCGYCNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIV 126
           E+C YC QS   K+ LKA +L+ V++V++ AK AK+ G+TR+CMGAAWR P ERD+  + 
Sbjct: 85  EDCKYCPQSARYKTGLKAERLLEVERVIESAKQAKKAGSTRFCMGAAWRNPHERDMPYLE 144

Query: 127 DMIKGVKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRL 186
            M+K VK LGLETCMTLG L+ +QA+ L+ AGLDYYNHN+DTS  FY  + TT T++DRL
Sbjct: 145 TMVKEVKVLGLETCMTLGKLTDQQARRLADAGLDYYNHNLDTSPEFYGSIITTRTYQDRL 204

Query: 187 QTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEE 246
            T++ VR++G+KVC GGI+GLGE + DR  +L+ LANLS  PES+PIN+LI I G+  E+
Sbjct: 205 DTIDTVRQAGMKVCSGGIVGLGEKVTDRAALLVQLANLSQVPESVPINMLIKIKGTPLED 264

Query: 247 NKKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAK 306
           N+ VD  + +R I+VARI+MP S +RL+AGR  M++++QALCF +GANS+F G  LLTA 
Sbjct: 265 NEDVDAFDFIRTIAVARIMMPTSFVRLSAGREQMNEQMQALCFMAGANSLFYGCKLLTAA 324

Query: 307 NPSYNKDTILFNRLGLIPDLS 327
           NP+ +KD  LF +L + P  +
Sbjct: 325 NPNQDKDQQLFRKLNINPQAT 345


>gi|254491902|ref|ZP_05105081.1| biotin synthase [Methylophaga thiooxidans DMS010]
 gi|224463380|gb|EEF79650.1| biotin synthase [Methylophaga thiooxydans DMS010]
          Length = 335

 Score =  320 bits (820), Expect = 2e-85,   Method: Composition-based stats.
 Identities = 176/316 (55%), Positives = 230/316 (72%)

Query: 9   EENPTKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPEN 68
            E  T     W  +EV  ++ +PFNDLLF + TVHR++F+ N +Q+S LL+IKTGGC E+
Sbjct: 6   AETQTTIRNDWKQEEVETLFALPFNDLLFQAQTVHRQHFDANSVQISTLLSIKTGGCAED 65

Query: 69  CGYCNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDM 128
           CGYC QS H+ S +KA  L+ +D+V+K A  AK+ GA+R+CMGAAWR  K+RDL  + DM
Sbjct: 66  CGYCPQSAHHPSAVKAEPLMPLDEVMKSANEAKQAGASRFCMGAAWRSLKDRDLERVADM 125

Query: 129 IKGVKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQT 188
           ++GVK LGLETC+TLGML   QA+ L  AGLDYYNHN+DTS  FY  + TT T+EDRL T
Sbjct: 126 VEGVKGLGLETCVTLGMLEEHQAKRLKDAGLDYYNHNLDTSPEFYGDIITTRTYEDRLNT 185

Query: 189 LENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENK 248
           L +VR +GI VC GGI+G+GE   DR  +L++LANL T P+S+PINLL+ + G+     +
Sbjct: 186 LGHVRDAGINVCSGGIVGMGEERGDRAGLLISLANLPTQPQSVPINLLVQVEGTPLNGIE 245

Query: 249 KVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNP 308
            +D +E VR I+VARI+MPKS +RL+AGR  MSDE+QA+CF +GANSIF G+ LLT  NP
Sbjct: 246 NLDALEFVRTIAVARIMMPKSFVRLSAGRENMSDEMQAMCFLAGANSIFYGEKLLTTDNP 305

Query: 309 SYNKDTILFNRLGLIP 324
             N D  LF RLG+ P
Sbjct: 306 DTNHDQQLFKRLGITP 321


>gi|77360550|ref|YP_340125.1| biotin synthase; contains an iron-sulfur cluster and PLP
           [Pseudoalteromonas haloplanktis TAC125]
 gi|123771584|sp|Q3IGS6|BIOB_PSEHT RecName: Full=Biotin synthase
 gi|76875461|emb|CAI86682.1| biotin synthase; contains an iron-sulfur cluster and PLP
           [Pseudoalteromonas haloplanktis TAC125]
          Length = 346

 Score =  320 bits (820), Expect = 2e-85,   Method: Composition-based stats.
 Identities = 166/310 (53%), Positives = 226/310 (72%)

Query: 16  PKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQS 75
              WT  EV  I+ MPFNDLLF + +VHR NF PN +Q+S LL+IKTG CPE+C YC QS
Sbjct: 7   RHNWTHSEVKAIFEMPFNDLLFKAASVHRANFNPNEVQISTLLSIKTGACPEDCKYCPQS 66

Query: 76  VHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSL 135
            H ++ L+  +LI V++V+++A+ AK+ GATR+CMGAAW +PK+RD+  I  M+K VK L
Sbjct: 67  GHYRTDLERERLIEVEKVVEQARLAKQKGATRFCMGAAWSDPKDRDMPYISQMVKEVKEL 126

Query: 136 GLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKS 195
           GLETCMTLGML+ E+A  L  AGLDYYNHN+DTS  +Y  + +T TF+DRL T+ NVR +
Sbjct: 127 GLETCMTLGMLNNEKAHELRNAGLDYYNHNLDTSPEYYEQIISTRTFQDRLDTIGNVRDA 186

Query: 196 GIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEH 255
           G+KVC GGI+G+GE   DR  +L+ LANL   PES+PIN+L+ + G+  E    +D  E 
Sbjct: 187 GMKVCSGGIVGMGEQAADRYGLLMQLANLDQQPESVPINMLVKVKGTPLENVDDLDHFEF 246

Query: 256 VRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTI 315
           +R I+ ARI+MP S +RL+AGR  M++++Q++CFF+GANSIF GD LLT +NP  + D  
Sbjct: 247 IRTIATARIMMPHSYVRLSAGRNAMNEQMQSMCFFAGANSIFYGDKLLTTENPDADADMA 306

Query: 316 LFNRLGLIPD 325
           L  +LG+ P+
Sbjct: 307 LIKKLGMNPE 316


>gi|323524540|ref|YP_004226693.1| biotin synthase [Burkholderia sp. CCGE1001]
 gi|323381542|gb|ADX53633.1| biotin synthase [Burkholderia sp. CCGE1001]
          Length = 352

 Score =  320 bits (820), Expect = 2e-85,   Method: Composition-based stats.
 Identities = 171/324 (52%), Positives = 228/324 (70%)

Query: 2   SRSTVVPEENPTKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIK 61
           S  T +  +  T++   W   ++  +Y +PFNDL+F +   HR++F+ N +QLS LL+IK
Sbjct: 10  SAGTAINADAATQQLARWRVADIVALYELPFNDLMFRAQQTHREHFDANTVQLSTLLSIK 69

Query: 62  TGGCPENCGYCNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERD 121
           TGGC E+C YC QSVH+ + L+A KL+ VD+VL  AK AKENGATR+CMGAAWR PK+R 
Sbjct: 70  TGGCEEDCAYCPQSVHHDTGLQADKLMPVDEVLAAAKAAKENGATRFCMGAAWRNPKDRH 129

Query: 122 LSIIVDMIKGVKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHT 181
           L  I +MI+GVK++GLETC+TLGML   QAQ L +AGLDYYNHN+DTS  FY  + +T T
Sbjct: 130 LEPIKEMIRGVKAMGLETCVTLGMLETHQAQALREAGLDYYNHNLDTSPEFYGQIISTRT 189

Query: 182 FEDRLQTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPG 241
           ++DRL TLE VR +GI VCCGGI+GLGE   +R  ++  LAN+   PES+PIN L+ + G
Sbjct: 190 YQDRLDTLERVRDAGINVCCGGIVGLGESRRERAGLIAQLANMDPYPESVPINNLVQVEG 249

Query: 242 SKFEENKKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDT 301
           +     + +DP E VR I++ARI MP++ +RL+AGR  M + LQA+CF +GANSIF GD 
Sbjct: 250 TPLTGTESIDPFEFVRTIAIARITMPRAMVRLSAGREQMDEALQAMCFLAGANSIFYGDQ 309

Query: 302 LLTAKNPSYNKDTILFNRLGLIPD 325
           LLT  NP    D  L  RLG+  +
Sbjct: 310 LLTTSNPQAEADRQLLARLGIRAE 333


>gi|169633698|ref|YP_001707434.1| biotin synthetase [Acinetobacter baumannii SDF]
 gi|169152490|emb|CAP01460.1| biotin synthetase [Acinetobacter baumannii]
          Length = 333

 Score =  320 bits (820), Expect = 2e-85,   Method: Composition-based stats.
 Identities = 170/310 (54%), Positives = 230/310 (74%)

Query: 16  PKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQS 75
              WT +E+  +Y  PF DL+F +  VHR++F  N IQ+S LL+IKTG CPE+C YC+QS
Sbjct: 8   RNDWTREEIQALYEQPFLDLVFKAQQVHREHFTANTIQVSTLLSIKTGKCPEDCKYCSQS 67

Query: 76  VHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSL 135
            H  SKL+A K I V++V+ EAK AK++G++R+CMGAAWR P ERD+  +++M++ VK+L
Sbjct: 68  AHYDSKLEAEKRIAVEKVISEAKAAKDSGSSRFCMGAAWRNPHERDMPYVLEMVREVKAL 127

Query: 136 GLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKS 195
           G+ETCMTLGML+  QA+ L  AGLDYYNHN+DTS ++Y H+ +T TF+DRL TL+ VR++
Sbjct: 128 GMETCMTLGMLNQSQAERLKDAGLDYYNHNLDTSRKYYSHIISTRTFDDRLNTLDYVRQA 187

Query: 196 GIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEH 255
           G+KVC GGI+GLGE  +DRI +L  LA L   PES+PIN+L+PI G+   + +K+D IE 
Sbjct: 188 GMKVCSGGIVGLGESREDRIGLLHELATLPIHPESVPINMLVPIEGTPLADVEKLDVIEW 247

Query: 256 VRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTI 315
           +R I+VARI+MP S +RL+AGR  +SD  QAL F +GANS+F GD LLT  N    KD  
Sbjct: 248 IRTIAVARIIMPHSYIRLSAGRESLSDSDQALAFMAGANSLFSGDKLLTTPNAGEGKDQA 307

Query: 316 LFNRLGLIPD 325
           LFN+LGL  +
Sbjct: 308 LFNKLGLTAE 317


>gi|330891280|gb|EGH23941.1| biotin synthase [Pseudomonas syringae pv. mori str. 301020]
          Length = 346

 Score =  320 bits (820), Expect = 2e-85,   Method: Composition-based stats.
 Identities = 167/310 (53%), Positives = 230/310 (74%)

Query: 16  PKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQS 75
              WT  EV  ++  PFNDLLF + TVHR +F+ N +Q+S LL+IKTG CPE+C YC QS
Sbjct: 4   RHDWTLAEVRALFVQPFNDLLFQAQTVHRAHFDANRVQVSTLLSIKTGACPEDCKYCPQS 63

Query: 76  VHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSL 135
            H  + L+  KL+ V +VL+EA  AK  G+TR+CMGAAW+ P  +D+  +++M+KGVK++
Sbjct: 64  GHYNTGLEKEKLLEVQKVLEEAARAKAIGSTRFCMGAAWKHPSAKDMPYVLEMVKGVKAM 123

Query: 136 GLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKS 195
           G+ETCMTLG L  EQ + L+ AGLDYYNHN+DTS  FY  + TT T+ +RLQTL  VR +
Sbjct: 124 GMETCMTLGRLDQEQTEALATAGLDYYNHNLDTSPEFYGSIITTRTYSERLQTLAYVRDA 183

Query: 196 GIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEH 255
           G+K+C GGILG+GE +DDR  +L+ LANL   PES+PIN+L+ + G+  E  + VDP + 
Sbjct: 184 GMKICSGGILGMGESLDDRAGLLIQLANLPEHPESVPINMLVKVAGTPLENAEDVDPFDF 243

Query: 256 VRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTI 315
           +R+++VARILMP+S +RL+AGR  M++++QAL FF+GANSIF GD LLT  NP  +KD +
Sbjct: 244 IRMLAVARILMPQSHVRLSAGREAMNEQMQALAFFAGANSIFYGDKLLTTANPQADKDML 303

Query: 316 LFNRLGLIPD 325
           LF+RLG+ P+
Sbjct: 304 LFSRLGIKPE 313


>gi|289209446|ref|YP_003461512.1| biotin synthase [Thioalkalivibrio sp. K90mix]
 gi|288945077|gb|ADC72776.1| biotin synthase [Thioalkalivibrio sp. K90mix]
          Length = 331

 Score =  320 bits (819), Expect = 2e-85,   Method: Composition-based stats.
 Identities = 172/313 (54%), Positives = 233/313 (74%)

Query: 13  TKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYC 72
           +     W + EV  + ++P NDL+F + TVHR++F+PN +Q+S LL+IKTG CPE+C YC
Sbjct: 2   STPRHDWNTDEVEALLDLPLNDLIFRAQTVHREHFDPNAVQVSTLLSIKTGACPEDCAYC 61

Query: 73  NQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGV 132
            QS H++ +L+  +L+ +D+VL+ A+NA+  GATR+CMGAAWR P +++L  +++M++ V
Sbjct: 62  PQSAHHEVELERERLLPLDEVLEAARNARAQGATRFCMGAAWRNPTDKNLERVIEMVRAV 121

Query: 133 KSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENV 192
           K  GLETCMTLGML  EQA+ LS+AGLDYYNHN+DTS  FY H+ +T T+EDRL+TLE+V
Sbjct: 122 KDEGLETCMTLGMLKAEQAKRLSEAGLDYYNHNLDTSPEFYGHIISTRTYEDRLETLEHV 181

Query: 193 RKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDP 252
           R++G+ VCCGGILG+GE   DR  +L  +ANL   PES+PIN LI + G+     + +DP
Sbjct: 182 REAGMNVCCGGILGMGESRRDRARLLQQMANLPKHPESVPINQLIQVEGTPLHGIEDLDP 241

Query: 253 IEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNK 312
           +E VR I+  RILMP S +RL+AGR  MSDE+QALCF +GANS+F GDTLLT  NP  N 
Sbjct: 242 LEFVRTIAATRILMPASYVRLSAGRTEMSDEMQALCFLAGANSLFYGDTLLTTPNPGENH 301

Query: 313 DTILFNRLGLIPD 325
           D  LF RLGL P+
Sbjct: 302 DLALFERLGLHPE 314


>gi|302185791|ref|ZP_07262464.1| biotin synthase [Pseudomonas syringae pv. syringae 642]
          Length = 352

 Score =  320 bits (819), Expect = 2e-85,   Method: Composition-based stats.
 Identities = 167/310 (53%), Positives = 230/310 (74%)

Query: 16  PKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQS 75
              WT  EV  ++  PFNDLLF + TVHR +F+ N +Q+S LL+IKTG CPE+C YC QS
Sbjct: 10  RHDWTLAEVRALFVQPFNDLLFQAQTVHRAHFDANRVQVSTLLSIKTGACPEDCKYCPQS 69

Query: 76  VHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSL 135
            H  + L+  KL+ V +VL+EA  AK  G+TR+CMGAAW+ P  +D+  +++M+KGVK++
Sbjct: 70  GHYNTGLEKEKLLEVQKVLEEAARAKAIGSTRFCMGAAWKHPSAKDMPYVLEMVKGVKAM 129

Query: 136 GLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKS 195
           G+ETCMTLG L  EQ + L+ AGLDYYNHN+DTS  FY  + TT T+ +RLQTL  VR +
Sbjct: 130 GMETCMTLGRLDQEQTEALATAGLDYYNHNLDTSPEFYGSIITTRTYAERLQTLAYVRDA 189

Query: 196 GIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEH 255
           G+K+C GGILG+GE +DDR  +L+ LANL   PES+PIN+L+ + G+  E  + VDP + 
Sbjct: 190 GMKICSGGILGMGESLDDRAGLLIQLANLPEHPESVPINMLVKVAGTPLENAEDVDPFDF 249

Query: 256 VRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTI 315
           +R+++VARILMP+S +RL+AGR  M++++QAL FF+GANSIF GD LLT  NP  +KD +
Sbjct: 250 IRMLAVARILMPQSHVRLSAGREAMNEQMQALAFFAGANSIFYGDKLLTTANPQADKDML 309

Query: 316 LFNRLGLIPD 325
           LF+RLG+ P+
Sbjct: 310 LFSRLGIKPE 319


>gi|37525436|ref|NP_928780.1| biotin synthetase (biotin synthase) [Photorhabdus luminescens
           subsp. laumondii TTO1]
 gi|81572609|sp|Q7N6Q7|BIOB_PHOLL RecName: Full=Biotin synthase
 gi|36784864|emb|CAE13778.1| biotin synthetase (biotin synthase) [Photorhabdus luminescens
           subsp. laumondii TTO1]
          Length = 345

 Score =  320 bits (819), Expect = 2e-85,   Method: Composition-based stats.
 Identities = 166/313 (53%), Positives = 229/313 (73%)

Query: 15  KPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQ 74
           + K WT K+  ++++ PF +LLF +  VHR  F+P  +Q+S LL+IKTG CPE+C YC Q
Sbjct: 3   ERKQWTIKQAQELFDKPFFELLFQAQQVHRIYFDPQQVQVSTLLSIKTGACPEDCKYCPQ 62

Query: 75  SVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKS 134
           S   K+ L+  +L+ V+QV+  A+ AK  G+TR+CMGAAW+ P ERD+  +  M+K VK+
Sbjct: 63  SSRYKTGLEKERLMEVEQVIDSARKAKNAGSTRFCMGAAWKNPHERDMPYLEKMVKEVKA 122

Query: 135 LGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRK 194
           LG+ETCMTLGML+  QAQ L+ AGLDYYNHN+DTS  FY ++ TT T++DRL TL+ VR+
Sbjct: 123 LGMETCMTLGMLNGLQAQRLADAGLDYYNHNLDTSPEFYGNIITTRTYQDRLDTLDKVRE 182

Query: 195 SGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIE 254
           +GIKVC GGI+GLGE I DR  +L+ LANL  PPES+PIN+L+ + G+   EN+ VDP +
Sbjct: 183 AGIKVCSGGIVGLGEAIRDRAALLVQLANLPKPPESVPINMLVKVKGTPLAENEDVDPFD 242

Query: 255 HVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDT 314
            +R I+VARI+MP S +RL+AGR  M+++ QA+CF +GANSIF G  LLT  NP+ +KD 
Sbjct: 243 FIRTIAVARIMMPSSHVRLSAGREQMNEQTQAMCFMAGANSIFYGCKLLTTPNPAEDKDL 302

Query: 315 ILFNRLGLIPDLS 327
            LF +LG+    +
Sbjct: 303 QLFRKLGINLQQT 315


>gi|183598210|ref|ZP_02959703.1| hypothetical protein PROSTU_01592 [Providencia stuartii ATCC 25827]
 gi|188020377|gb|EDU58417.1| hypothetical protein PROSTU_01592 [Providencia stuartii ATCC 25827]
          Length = 345

 Score =  320 bits (819), Expect = 2e-85,   Method: Composition-based stats.
 Identities = 171/309 (55%), Positives = 235/309 (76%)

Query: 17  KVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQSV 76
           K WT+K+  ++++MPF +LLF +  VHR++F+P  +Q+S LL+IKTG CPE+C YC QS 
Sbjct: 5   KKWTTKQANELFSMPFFELLFQAQQVHRQHFDPQQVQVSTLLSIKTGACPEDCKYCAQSA 64

Query: 77  HNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLG 136
             K+ L+  +L+ V QVL+ AK AK+ G+TR+CMGAAWR P+ERD+  +  M++ VKSLG
Sbjct: 65  RYKTGLETERLMEVQQVLESAKKAKQAGSTRFCMGAAWRNPRERDMPYLEMMVREVKSLG 124

Query: 137 LETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSG 196
           +ETCMTLGM+   QAQ L++AGLDYYNHN+DTS  +Y ++ TT T++DRL TL+NVR +G
Sbjct: 125 METCMTLGMIDDSQAQRLAEAGLDYYNHNLDTSPEYYGNIITTRTYQDRLDTLDNVRNAG 184

Query: 197 IKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEHV 256
           IKVC GGILGLGE I DR  +L+ LANL  PPES+PIN+L+ + G+   +N+ VDP + +
Sbjct: 185 IKVCSGGILGLGEKISDRAALLVQLANLPKPPESVPINMLMKMEGTPMADNEDVDPFDFI 244

Query: 257 RIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTIL 316
           R I+VARI+MP S +RL+AGR  M+++ QALCF +GANS+F G  LLTA NP+ NKD  L
Sbjct: 245 RTIAVARIMMPTSYVRLSAGREYMNEQTQALCFMAGANSVFYGCKLLTAPNPNENKDISL 304

Query: 317 FNRLGLIPD 325
           F +L + P+
Sbjct: 305 FKKLNINPE 313


>gi|21241162|ref|NP_640744.1| biotin synthase [Xanthomonas axonopodis pv. citri str. 306]
 gi|81805497|sp|Q8PQD7|BIOB_XANAC RecName: Full=Biotin synthase
 gi|21106467|gb|AAM35280.1| biotin synthase [Xanthomonas axonopodis pv. citri str. 306]
          Length = 344

 Score =  320 bits (819), Expect = 2e-85,   Method: Composition-based stats.
 Identities = 161/314 (51%), Positives = 220/314 (70%)

Query: 13  TKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYC 72
                 W  KE+  ++++PF +LL  + +VHR +F+P  +Q+S LL++KTGGCPE+C YC
Sbjct: 3   VVLRHDWDRKELQALFDLPFPELLHRAASVHRAHFDPAQVQVSTLLSVKTGGCPEDCAYC 62

Query: 73  NQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGV 132
            Q+    + + A KL+  ++V+ +A+ AK  GA+R+CMGAAWR PKERD+  +  MI+ V
Sbjct: 63  PQAQRYDTGVSAQKLMETEEVVAKARQAKAAGASRFCMGAAWRSPKERDIPKVAAMIREV 122

Query: 133 KSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENV 192
           K++GLETC TLGML   QA+ L  AGLDYYNHN+DT+  +Y  +  T  ++DRL TLE+V
Sbjct: 123 KAMGLETCATLGMLDAGQARALKDAGLDYYNHNLDTAPDYYDSIIHTRQYQDRLNTLEHV 182

Query: 193 RKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDP 252
           R  G+K CCGGI+G+GE  + RI +LL LA L   P+S+PIN L+ +PG+     +++DP
Sbjct: 183 RDVGLKTCCGGIVGMGETREHRIGLLLALATLPAHPDSVPINQLVQVPGTPLHGTQQLDP 242

Query: 253 IEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNK 312
            E VR+I+VARI MPKS +RL+AGR  MSDELQALCF +GANSIF G+ LLT  NP   +
Sbjct: 243 FEFVRMIAVARIAMPKSMVRLSAGRETMSDELQALCFLAGANSIFYGEKLLTTGNPDTER 302

Query: 313 DTILFNRLGLIPDL 326
           D  LF RLGL P  
Sbjct: 303 DQALFQRLGLRPMQ 316


>gi|212635716|ref|YP_002312241.1| biotin synthase [Shewanella piezotolerans WP3]
 gi|254811578|sp|B8CQY2|BIOB_SHEPW RecName: Full=Biotin synthase
 gi|212557200|gb|ACJ29654.1| Biotin synthase [Shewanella piezotolerans WP3]
          Length = 350

 Score =  320 bits (819), Expect = 2e-85,   Method: Composition-based stats.
 Identities = 174/314 (55%), Positives = 231/314 (73%)

Query: 13  TKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYC 72
            +    W   E+  ++ +P NDLLF +H+VHR+ F+PN +Q+S+LL+IKTG CPE+C YC
Sbjct: 4   VQVRNNWKRDEIETLFALPMNDLLFQAHSVHRQEFDPNEVQISRLLSIKTGACPEDCKYC 63

Query: 73  NQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGV 132
            QS    + L+  +L+ ++ VL EA++AK  GA+R+CMGAAWR PKERD+  +  M++ V
Sbjct: 64  PQSARYDTGLEKERLLAMETVLTEARSAKAAGASRFCMGAAWRNPKERDMPYLKTMVEEV 123

Query: 133 KSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENV 192
           KSLG+ETCMTLGMLS +QA  L+ AGLDYYNHN+DTS  +Y  V TT T+++RL TL NV
Sbjct: 124 KSLGMETCMTLGMLSADQASELADAGLDYYNHNLDTSPEYYGDVITTRTYQNRLDTLSNV 183

Query: 193 RKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDP 252
           R SG+KVC GGI+G+GE   DR  +L  LANL   P+S+PIN+L+ + G+ FE+   +DP
Sbjct: 184 RASGMKVCSGGIVGMGEKATDRAGLLQQLANLDKHPDSVPINMLVKVEGTPFEKIDDLDP 243

Query: 253 IEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNK 312
           +E VR I+VARI+MPKSR+RL+AGR  M+DELQA+CFF+GANSIF G  LLT  NP  N 
Sbjct: 244 LEFVRTIAVARIIMPKSRVRLSAGRENMTDELQAMCFFAGANSIFYGCKLLTTPNPEEND 303

Query: 313 DTILFNRLGLIPDL 326
           D  LF RLGL P+ 
Sbjct: 304 DMSLFRRLGLHPEQ 317


>gi|330874794|gb|EGH08943.1| biotin synthase [Pseudomonas syringae pv. morsprunorum str.
           M302280PT]
          Length = 352

 Score =  320 bits (819), Expect = 3e-85,   Method: Composition-based stats.
 Identities = 168/310 (54%), Positives = 230/310 (74%)

Query: 16  PKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQS 75
              WT  EV  ++  PFNDLLF + TVHR +F+ N +Q+S LL+IKTG CPE+C YC QS
Sbjct: 10  RHDWTLAEVRALFVQPFNDLLFQAQTVHRAHFDANRVQVSTLLSIKTGACPEDCKYCPQS 69

Query: 76  VHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSL 135
            H  + L+  KL+ V +VL+EA  AK  G+TR+CMGAAW+ P  +D+  +++M+KGVK++
Sbjct: 70  GHYNTGLEKEKLLEVQKVLEEAARAKSIGSTRFCMGAAWKHPSAKDMPYVLEMVKGVKAM 129

Query: 136 GLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKS 195
           GLETCMTLG L  EQ + L+ AGLDYYNHN+DTS  FY  + TT T+ +RLQTL  VR +
Sbjct: 130 GLETCMTLGRLDQEQTEALATAGLDYYNHNLDTSPEFYGSIITTRTYGERLQTLAYVRDA 189

Query: 196 GIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEH 255
           G+K+C GGILG+GE +DDR  +L+ LANL   PES+PIN+L+ + G+  E  + VDP + 
Sbjct: 190 GMKICSGGILGMGESLDDRAGLLIQLANLPEHPESVPINMLVKVAGTPLENAEDVDPFDF 249

Query: 256 VRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTI 315
           +R+++VARILMP+S +RL+AGR  M++++QAL FF+GANSIF GD LLT  NP  +KD +
Sbjct: 250 IRMLAVARILMPQSHVRLSAGREAMNEQMQALAFFAGANSIFYGDKLLTTANPQADKDML 309

Query: 316 LFNRLGLIPD 325
           LF+RLG+ P+
Sbjct: 310 LFSRLGIKPE 319


>gi|213967735|ref|ZP_03395882.1| biotin synthetase [Pseudomonas syringae pv. tomato T1]
 gi|301382372|ref|ZP_07230790.1| biotin synthase [Pseudomonas syringae pv. tomato Max13]
 gi|302062357|ref|ZP_07253898.1| biotin synthase [Pseudomonas syringae pv. tomato K40]
 gi|302130675|ref|ZP_07256665.1| biotin synthase [Pseudomonas syringae pv. tomato NCPPB 1108]
 gi|213927511|gb|EEB61059.1| biotin synthetase [Pseudomonas syringae pv. tomato T1]
          Length = 352

 Score =  320 bits (819), Expect = 3e-85,   Method: Composition-based stats.
 Identities = 168/310 (54%), Positives = 230/310 (74%)

Query: 16  PKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQS 75
              WT  EV  ++  PFNDLLF + TVHR +F+ N +Q+S LL+IKTG CPE+C YC QS
Sbjct: 10  RHDWTLAEVRALFVQPFNDLLFQAQTVHRAHFDANRVQVSTLLSIKTGACPEDCKYCPQS 69

Query: 76  VHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSL 135
            H  + L+  KL+ V +VL+EA  AK  G+TR+CMGAAW+ P  +D+  +++M+KGVK++
Sbjct: 70  GHYNTGLEKEKLLEVQKVLEEAARAKSIGSTRFCMGAAWKHPSAKDMPYVLEMVKGVKAM 129

Query: 136 GLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKS 195
           GLETCMTLG L  EQ + L+ AGLDYYNHN+DTS  FY  + TT T+ +RLQTL  VR +
Sbjct: 130 GLETCMTLGRLDQEQTEALATAGLDYYNHNLDTSPEFYGSIITTRTYGERLQTLAYVRDA 189

Query: 196 GIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEH 255
           G+K+C GGILG+GE +DDR  +L+ LANL   PES+PIN+L+ + G+  E  + VDP + 
Sbjct: 190 GMKICSGGILGMGESLDDRAGLLIQLANLPEHPESVPINMLVKVAGTPLENAEDVDPFDF 249

Query: 256 VRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTI 315
           +R+++VARILMP+S +RL+AGR  M++++QAL FF+GANSIF GD LLT  NP  +KD +
Sbjct: 250 IRMLAVARILMPQSHVRLSAGREAMNEQMQALAFFAGANSIFYGDKLLTTANPQADKDML 309

Query: 316 LFNRLGLIPD 325
           LF+RLG+ P+
Sbjct: 310 LFSRLGIKPE 319


>gi|120598480|ref|YP_963054.1| biotin synthase [Shewanella sp. W3-18-1]
 gi|146293441|ref|YP_001183865.1| biotin synthase [Shewanella putrefaciens CN-32]
 gi|254811577|sp|A4Y7Y3|BIOB_SHEPC RecName: Full=Biotin synthase
 gi|254811581|sp|A1RIK5|BIOB_SHESW RecName: Full=Biotin synthase
 gi|120558573|gb|ABM24500.1| biotin synthase [Shewanella sp. W3-18-1]
 gi|145565131|gb|ABP76066.1| biotin synthase [Shewanella putrefaciens CN-32]
 gi|319426744|gb|ADV54818.1| biotin synthase [Shewanella putrefaciens 200]
          Length = 350

 Score =  319 bits (818), Expect = 3e-85,   Method: Composition-based stats.
 Identities = 171/316 (54%), Positives = 232/316 (73%)

Query: 13  TKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYC 72
            +    W  +E+  ++ +P NDLLF +H++HR+ ++PN +Q+S+LL+IKTG CPE+C YC
Sbjct: 4   LQVRHDWKREEIEALFALPMNDLLFKAHSIHREVYDPNEVQISRLLSIKTGACPEDCKYC 63

Query: 73  NQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGV 132
            QS    + L+  +L+ ++ VL EA++AK  GA+R+CMGAAWR PKE+D+  +  M++ V
Sbjct: 64  PQSARYDTGLEKERLLAMETVLTEARSAKAAGASRFCMGAAWRNPKEKDMPYLKQMVQEV 123

Query: 133 KSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENV 192
           K+LG+ETCMTLGMLS EQA  L+ AGLDYYNHN+DTS  +Y  V TT T+++RL TL +V
Sbjct: 124 KALGMETCMTLGMLSAEQANELADAGLDYYNHNLDTSPEYYGDVITTRTYQNRLDTLTHV 183

Query: 193 RKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDP 252
           R SG+KVC GGI+G+GE   DR  +L  LANL   P+S+PIN+L+ + G+ FE+   +DP
Sbjct: 184 RASGMKVCSGGIVGMGEKATDRAGLLQQLANLPQHPDSVPINMLVKVAGTPFEKLDDLDP 243

Query: 253 IEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNK 312
           +E VR I+VARILMP SR+RL+AGR  MSDELQA+CFF+GANSIF G  LLT  NP  + 
Sbjct: 244 LEFVRTIAVARILMPLSRVRLSAGRENMSDELQAMCFFAGANSIFYGCKLLTTPNPEESD 303

Query: 313 DTILFNRLGLIPDLSA 328
           D  LF RLGL P+  A
Sbjct: 304 DMGLFRRLGLRPEQGA 319


>gi|312963456|ref|ZP_07777938.1| biotin synthase [Pseudomonas fluorescens WH6]
 gi|311282262|gb|EFQ60861.1| biotin synthase [Pseudomonas fluorescens WH6]
          Length = 351

 Score =  319 bits (818), Expect = 3e-85,   Method: Composition-based stats.
 Identities = 166/310 (53%), Positives = 231/310 (74%)

Query: 16  PKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQS 75
              W+  EV  ++  PFNDLLF + TVHR +F+ N +Q+S LL+IKTG CPE+C YC QS
Sbjct: 10  RHDWSLAEVKALFVQPFNDLLFQAQTVHRAHFDANRVQVSTLLSIKTGACPEDCKYCPQS 69

Query: 76  VHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSL 135
            H  + L+  KL+ V +VL+EA  AK  G+TR+CMGAAW+ P  +D+  ++ M+KGVK++
Sbjct: 70  GHYNTGLEKEKLMEVQKVLEEAARAKAIGSTRFCMGAAWKHPSAKDMPYVLQMVKGVKAM 129

Query: 136 GLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKS 195
           GLETCMTLG L  +Q + L++AGLDYYNHN+DTS  FY  + TT T+ +RLQTL  VR+S
Sbjct: 130 GLETCMTLGRLDQDQTEALAQAGLDYYNHNLDTSPEFYGSIITTRTYGERLQTLAYVRES 189

Query: 196 GIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEH 255
           G+K+C GGILG+GE +DDR ++L+ LANL   PES+PIN+L+ + G+  E  + +DP + 
Sbjct: 190 GMKICSGGILGMGESLDDRANLLIQLANLPEHPESVPINMLVKVAGTPLENAEDIDPFDF 249

Query: 256 VRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTI 315
           +R+++VARILMP+S +RL+AGR  M++++QAL FF+GANSIF GD LLT  NP  +KD  
Sbjct: 250 IRMLAVARILMPQSHVRLSAGREAMNEQMQALAFFAGANSIFYGDKLLTTANPQADKDMQ 309

Query: 316 LFNRLGLIPD 325
           LF RLG++P+
Sbjct: 310 LFARLGILPE 319


>gi|254810650|sp|Q6FAP9|BIOB_ACIAD RecName: Full=Biotin synthase
          Length = 329

 Score =  319 bits (818), Expect = 3e-85,   Method: Composition-based stats.
 Identities = 170/310 (54%), Positives = 229/310 (73%)

Query: 16  PKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQS 75
              WT  E+  +Y+ PF DL+F +  VHR++F  N IQ+S LL+IKTG CPE+C YC+QS
Sbjct: 4   RNDWTRDEIQALYDQPFLDLVFQAQQVHREHFSANTIQVSTLLSIKTGKCPEDCKYCSQS 63

Query: 76  VHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSL 135
            H  SKL+A K I VD+V+ EAK AK++G++R+CMGAAWR P ERD+  +++M++ VK+L
Sbjct: 64  AHYDSKLEAEKRIAVDKVISEAKAAKDSGSSRFCMGAAWRNPHERDMPYVLEMVREVKAL 123

Query: 136 GLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKS 195
           GLETCMTLGML+  QA+ LS AGLDYYNHN+DTS  +Y ++ +T TF+DRL TL++VR +
Sbjct: 124 GLETCMTLGMLNQSQAERLSDAGLDYYNHNLDTSREYYNNIISTRTFDDRLNTLDHVRSA 183

Query: 196 GIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEH 255
           G+KVC GGI+GLGE   DRI +L  LA L   PES+PIN+L+PI G+   + +K+D  E 
Sbjct: 184 GMKVCSGGIVGLGEQKQDRIGLLHELATLPIHPESVPINMLVPIEGTPLADVEKLDVTEW 243

Query: 256 VRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTI 315
           +R I+VARI+MP S +RL+AGR  +SD  QAL F +GANS+F GD LLT  N    KD +
Sbjct: 244 IRTIAVARIIMPYSYIRLSAGRESLSDSDQALAFMAGANSLFSGDKLLTTPNAGEGKDQV 303

Query: 316 LFNRLGLIPD 325
           LF +LGL+ +
Sbjct: 304 LFAKLGLVAE 313


>gi|170726219|ref|YP_001760245.1| biotin synthase [Shewanella woodyi ATCC 51908]
 gi|254811582|sp|B1KPJ7|BIOB_SHEWM RecName: Full=Biotin synthase
 gi|169811566|gb|ACA86150.1| biotin synthase [Shewanella woodyi ATCC 51908]
          Length = 354

 Score =  319 bits (818), Expect = 3e-85,   Method: Composition-based stats.
 Identities = 168/313 (53%), Positives = 231/313 (73%)

Query: 14  KKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCN 73
           +    W   E+  ++ +P NDLLF +H++HR+ ++PN +Q+S+LL+IKTG CPE+C YC 
Sbjct: 5   QLRHDWKRDEIEALFALPMNDLLFEAHSIHRQVYDPNEVQISRLLSIKTGACPEDCKYCP 64

Query: 74  QSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVK 133
           QS    + L+  +LI +++VL EA++AK  GA+R+CMGAAWR P  RD+  + DM++ VK
Sbjct: 65  QSARYDTGLEKERLIEIEKVLTEARSAKAAGASRFCMGAAWRNPHARDMPYLKDMVREVK 124

Query: 134 SLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVR 193
           S+G+ETCMTLGMLS +QA  L++AGLDYYNHN+DTS  +Y  + TT T++DRL TL NVR
Sbjct: 125 SMGMETCMTLGMLSPDQAGELAEAGLDYYNHNLDTSPEYYGDIITTRTYQDRLDTLSNVR 184

Query: 194 KSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPI 253
            +G+KVC GGI+G+GE   DR  +L  LAN+   P+S+PIN+L+ + G+ FE  + +DP+
Sbjct: 185 AAGMKVCSGGIVGMGEQATDRSGLLQQLANMEQHPDSVPINMLVKVAGTPFENLEDLDPL 244

Query: 254 EHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKD 313
             VR I+VARILMP SR+RL+AGR  MSDE+QA+CFF+GANSIF G  LLT  NP  N+D
Sbjct: 245 VFVRTIAVARILMPHSRVRLSAGREKMSDEMQAMCFFAGANSIFYGCKLLTTNNPEENED 304

Query: 314 TILFNRLGLIPDL 326
             LF RLGL P+ 
Sbjct: 305 MTLFKRLGLHPEQ 317


>gi|325929419|ref|ZP_08190547.1| biotin synthase [Xanthomonas perforans 91-118]
 gi|325540194|gb|EGD11808.1| biotin synthase [Xanthomonas perforans 91-118]
          Length = 344

 Score =  319 bits (818), Expect = 3e-85,   Method: Composition-based stats.
 Identities = 161/311 (51%), Positives = 220/311 (70%)

Query: 16  PKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQS 75
              W  KE+  ++++PF +LL  + +VHR +F+P  +Q+S LL++KTGGCPE+C YC Q+
Sbjct: 6   RHDWDRKELQALFDLPFPELLHRAASVHRAHFDPAQVQVSTLLSVKTGGCPEDCAYCPQA 65

Query: 76  VHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSL 135
               + + A KL+  ++V+ +A+ AK  GA+R+CMGAAWR PKERD+  +  MI+ VK++
Sbjct: 66  QRYDTGVSAQKLMETEEVVAKARQAKAAGASRFCMGAAWRSPKERDIPKVAAMIREVKAM 125

Query: 136 GLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKS 195
           GLETC TLGML   QA+ L  AGLDYYNHN+DT+  +Y  +  T  ++DRL TLE+VR  
Sbjct: 126 GLETCATLGMLDAGQARALKDAGLDYYNHNLDTAPDYYDSIIHTRQYQDRLNTLEHVRDV 185

Query: 196 GIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEH 255
           G+K CCGGI+G+GE  + RI +LL LA L   P+S+PIN L+ +PG+     +++DP E 
Sbjct: 186 GLKTCCGGIVGMGETREHRIGLLLALATLPAHPDSVPINQLVQVPGTPLHGTQQLDPFEF 245

Query: 256 VRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTI 315
           VR+I+VARI MPKS +RL+AGR  MSDELQALCF +GANSIF G+ LLT  NP   +D  
Sbjct: 246 VRMIAVARIAMPKSMVRLSAGREAMSDELQALCFLAGANSIFYGEKLLTTGNPDTERDQA 305

Query: 316 LFNRLGLIPDL 326
           LF RLGL P  
Sbjct: 306 LFKRLGLRPMQ 316


>gi|50085176|ref|YP_046686.1| biotin synthetase [Acinetobacter sp. ADP1]
 gi|49531152|emb|CAG68864.1| biotin synthetase [Acinetobacter sp. ADP1]
          Length = 337

 Score =  319 bits (818), Expect = 3e-85,   Method: Composition-based stats.
 Identities = 170/310 (54%), Positives = 229/310 (73%)

Query: 16  PKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQS 75
              WT  E+  +Y+ PF DL+F +  VHR++F  N IQ+S LL+IKTG CPE+C YC+QS
Sbjct: 12  RNDWTRDEIQALYDQPFLDLVFQAQQVHREHFSANTIQVSTLLSIKTGKCPEDCKYCSQS 71

Query: 76  VHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSL 135
            H  SKL+A K I VD+V+ EAK AK++G++R+CMGAAWR P ERD+  +++M++ VK+L
Sbjct: 72  AHYDSKLEAEKRIAVDKVISEAKAAKDSGSSRFCMGAAWRNPHERDMPYVLEMVREVKAL 131

Query: 136 GLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKS 195
           GLETCMTLGML+  QA+ LS AGLDYYNHN+DTS  +Y ++ +T TF+DRL TL++VR +
Sbjct: 132 GLETCMTLGMLNQSQAERLSDAGLDYYNHNLDTSREYYNNIISTRTFDDRLNTLDHVRSA 191

Query: 196 GIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEH 255
           G+KVC GGI+GLGE   DRI +L  LA L   PES+PIN+L+PI G+   + +K+D  E 
Sbjct: 192 GMKVCSGGIVGLGEQKQDRIGLLHELATLPIHPESVPINMLVPIEGTPLADVEKLDVTEW 251

Query: 256 VRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTI 315
           +R I+VARI+MP S +RL+AGR  +SD  QAL F +GANS+F GD LLT  N    KD +
Sbjct: 252 IRTIAVARIIMPYSYIRLSAGRESLSDSDQALAFMAGANSLFSGDKLLTTPNAGEGKDQV 311

Query: 316 LFNRLGLIPD 325
           LF +LGL+ +
Sbjct: 312 LFAKLGLVAE 321


>gi|239946498|ref|ZP_04698253.1| biotin synthase [Rickettsia endosymbiont of Ixodes scapularis]
 gi|239946517|ref|ZP_04698272.1| biotin synthase [Rickettsia endosymbiont of Ixodes scapularis]
 gi|239920774|gb|EER20800.1| biotin synthase [Rickettsia endosymbiont of Ixodes scapularis]
 gi|239920793|gb|EER20819.1| biotin synthase [Rickettsia endosymbiont of Ixodes scapularis]
          Length = 311

 Score =  319 bits (817), Expect = 3e-85,   Method: Composition-based stats.
 Identities = 176/307 (57%), Positives = 222/307 (72%)

Query: 17  KVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQSV 76
           K WT ++  +I+N+   +LL+ +  +HR  F P  IQ+S LLNIKTG CPENC YC QS 
Sbjct: 3   KKWTLQQAKEIFNLSLIELLYEAQKIHRDYFIPATIQISTLLNIKTGSCPENCSYCPQSA 62

Query: 77  HNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLG 136
           H  + LK   L+  ++V+  AK AK+ G++R+C+GAAWR P++ DL I+ +MI  VK LG
Sbjct: 63  HYNTGLKKEPLMKKEEVVAAAKRAKDAGSSRFCIGAAWRGPRDEDLKIVCEMITEVKKLG 122

Query: 137 LETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSG 196
           LETC+TLG+L   Q  +L ++GLD+YNHNIDTS  FY  + TT TFEDRL TLE VRKSG
Sbjct: 123 LETCVTLGLLKDSQVLMLKESGLDFYNHNIDTSPEFYDQIITTRTFEDRLNTLELVRKSG 182

Query: 197 IKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEHV 256
           IKVCCGGI+G+GE  +DRI ML  LANL   PES+PIN LI IPG+  E  + +DP + V
Sbjct: 183 IKVCCGGIIGMGETNEDRIKMLTLLANLEESPESVPINKLIKIPGTPLENQEDIDPFDFV 242

Query: 257 RIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTIL 316
           R I++ARILMPKS +RL+AGR  MSDELQALCF +GANSIF G+ LLTA NP   +D  L
Sbjct: 243 RTIALARILMPKSYVRLSAGREQMSDELQALCFMAGANSIFYGEKLLTAGNPIPEQDNQL 302

Query: 317 FNRLGLI 323
           F RLGL 
Sbjct: 303 FERLGLK 309


>gi|90416821|ref|ZP_01224751.1| biotin synthetase [marine gamma proteobacterium HTCC2207]
 gi|90331574|gb|EAS46810.1| biotin synthetase [marine gamma proteobacterium HTCC2207]
          Length = 372

 Score =  319 bits (817), Expect = 4e-85,   Method: Composition-based stats.
 Identities = 164/321 (51%), Positives = 230/321 (71%), Gaps = 1/321 (0%)

Query: 5   TVVPEENPTKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGG 64
            +   ++ T +   W  +EV  ++N PFNDLLF +  +HR++F PN +QLS LL+IKTG 
Sbjct: 21  AMTASQDKTIRN-NWQREEVLALFNQPFNDLLFDAQVMHRRHFNPNQVQLSTLLSIKTGA 79

Query: 65  CPENCGYCNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSI 124
           CPE+C YC QS    + L+  KL+ ++ V++ AK AK +G++R+CMGAAWR P +RD+  
Sbjct: 80  CPEDCKYCPQSARYDTGLEKEKLLEIEAVIEAAKVAKASGSSRFCMGAAWRSPHDRDIPK 139

Query: 125 IVDMIKGVKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFED 184
           +  MI+ VK+LGLETCMTLGMLS EQ++ L+ AGLDYYNHN+DTS+ FY  V TT T++D
Sbjct: 140 VAHMIREVKALGLETCMTLGMLSEEQSEKLASAGLDYYNHNLDTSKEFYGEVITTRTYQD 199

Query: 185 RLQTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKF 244
           R+ TL NVR SG+KVC GGI+G+GE   DR  +L+ LANL   PES+PIN+L+ + G+  
Sbjct: 200 RINTLANVRNSGMKVCAGGIVGMGEEQQDRAGLLMELANLPRHPESVPINMLVKVAGTPM 259

Query: 245 EENKKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLT 304
            +   +DP E +R I++AR++MPKS +RL+AGR  M++++QA+ F +GANSIF  + LLT
Sbjct: 260 ADQADLDPFEFIRTIAIARLMMPKSYVRLSAGREDMNEQMQAMAFMAGANSIFYCEKLLT 319

Query: 305 AKNPSYNKDTILFNRLGLIPD 325
             NP  N D  LF RLG+ P+
Sbjct: 320 TPNPKANTDMQLFERLGISPE 340


>gi|121606914|ref|YP_984243.1| biotin synthase [Polaromonas naphthalenivorans CJ2]
 gi|254810770|sp|A1VUJ4|BIOB_POLNA RecName: Full=Biotin synthase
 gi|120595883|gb|ABM39322.1| biotin synthase [Polaromonas naphthalenivorans CJ2]
          Length = 345

 Score =  319 bits (817), Expect = 4e-85,   Method: Composition-based stats.
 Identities = 173/323 (53%), Positives = 228/323 (70%)

Query: 3   RSTVVPEENPTKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKT 62
           RS++    +    P+ W   ++  +Y +PF DLLF +  VHR NF+ N +QLS LL+IKT
Sbjct: 13  RSSLPARPDAAAAPQRWRVADIEALYALPFMDLLFRAQQVHRANFDANQVQLSTLLSIKT 72

Query: 63  GGCPENCGYCNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDL 122
           GGC E+CGYC QS H ++++KASKL+ +D+V+  A+ AK+ GATR+CMGAAW  PKERD+
Sbjct: 73  GGCAEDCGYCPQSSHFETEVKASKLMALDEVMAAAQAAKDQGATRFCMGAAWSRPKERDM 132

Query: 123 SIIVDMIKGVKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTF 182
             + +M++ V+ LGLETCMTLGML  EQAQ L  AGLDYYNHN+D+S  FY  + +T T+
Sbjct: 133 ERVTEMVREVRGLGLETCMTLGMLEAEQAQALKDAGLDYYNHNLDSSPEFYGSIISTRTY 192

Query: 183 EDRLQTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGS 242
           +DRL TLENVR +GI VCCGGI+G+GE    R  ++  LANL   PES+PIN L+ + G+
Sbjct: 193 QDRLDTLENVRGAGINVCCGGIVGMGESRAQRAGLVAQLANLEPYPESVPINNLVAVEGT 252

Query: 243 KFEENKKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTL 302
              +   +DP E VR I+VARI MP++ +RL+AGR  M + LQALCF +GANSIF GD L
Sbjct: 253 PLADTPPLDPFEFVRTIAVARITMPRTMVRLSAGREQMDEALQALCFMAGANSIFYGDRL 312

Query: 303 LTAKNPSYNKDTILFNRLGLIPD 325
           LT  NP  +KD  LF RLGL   
Sbjct: 313 LTTSNPQADKDRQLFARLGLKVQ 335


>gi|12620099|gb|AAG60559.1| BioB-like protein [uncultured bacterium pCosFS1]
          Length = 346

 Score =  319 bits (817), Expect = 4e-85,   Method: Composition-based stats.
 Identities = 161/309 (52%), Positives = 226/309 (73%)

Query: 19  WTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQSVHN 78
           WT      +++ P  +LLF + TVHR++F+P  +Q+S LL+IKTG CPE+C YC QS   
Sbjct: 8   WTVGLAQTLFDKPLLELLFEAQTVHRQHFDPRQVQVSTLLSIKTGACPEDCKYCPQSSRY 67

Query: 79  KSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLGLE 138
           K+ L++ +L+ V+QVL+ A+ AK NG+TR+CMGAAW+ P ERD+  +  M++GVK++G+E
Sbjct: 68  KTGLESERLMQVEQVLESARKAKANGSTRFCMGAAWKNPHERDMPYLQQMVQGVKAMGME 127

Query: 139 TCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSGIK 198
           TCMTLG L   QA+ L++AGLDYYNHN+DTS  FY ++ TT ++++RL TL  VR +GIK
Sbjct: 128 TCMTLGTLDGSQAERLAEAGLDYYNHNLDTSPEFYGNIITTRSYQERLDTLGKVRGAGIK 187

Query: 199 VCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEHVRI 258
           VC GGI+GLGE +  R  +L+ LANL TPPES+PIN+L+ + G+   +N  VDP + +R 
Sbjct: 188 VCSGGIVGLGETVXXRAGLLVQLANLPTPPESVPINMLVKVKGTPLADNDDVDPFDFIRT 247

Query: 259 ISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTILFN 318
           I+VARI+MP S +RL+AGR  M+++ QA+CF +GANSIF G  LLT  NP  +KD  LF 
Sbjct: 248 IAVARIMMPSSYVRLSAGREQMNEQTQAMCFMAGANSIFYGCKLLTTPNPEEDKDLQLFR 307

Query: 319 RLGLIPDLS 327
           +LGL P  +
Sbjct: 308 KLGLNPQQT 316


>gi|330872323|gb|EGH06472.1| biotin synthase [Pseudomonas syringae pv. glycinea str. race 4]
          Length = 344

 Score =  319 bits (817), Expect = 4e-85,   Method: Composition-based stats.
 Identities = 167/310 (53%), Positives = 230/310 (74%)

Query: 16  PKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQS 75
              WT  EV  ++  PFNDLLF + TVHR +F+ N +Q+S LL+IKTG CPE+C YC QS
Sbjct: 2   RHDWTLAEVRALFVQPFNDLLFQAQTVHRAHFDANRVQVSTLLSIKTGACPEDCKYCPQS 61

Query: 76  VHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSL 135
            H  + L+  KL+ V +VL+EA  AK  G+TR+CMGAAW+ P  +D+  +++M+KGVK++
Sbjct: 62  GHYNTGLEKEKLLEVQKVLEEAARAKAIGSTRFCMGAAWKHPSAKDMPYVLEMVKGVKAM 121

Query: 136 GLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKS 195
           G+ETCMTLG L  EQ + L+ AGLDYYNHN+DTS  FY  + TT T+ +RLQTL  VR +
Sbjct: 122 GMETCMTLGRLDQEQTEALATAGLDYYNHNLDTSPEFYGSIITTRTYSERLQTLAYVRDA 181

Query: 196 GIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEH 255
           G+K+C GGILG+GE +DDR  +L+ LANL   PES+PIN+L+ + G+  E  + VDP + 
Sbjct: 182 GMKICSGGILGMGESLDDRAGLLIQLANLPEHPESVPINMLVKVAGTPLENAEDVDPFDF 241

Query: 256 VRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTI 315
           +R+++VARILMP+S +RL+AGR  M++++QAL FF+GANSIF GD LLT  NP  +KD +
Sbjct: 242 IRMLAVARILMPQSHVRLSAGREAMNEQMQALAFFAGANSIFYGDKLLTTANPQADKDML 301

Query: 316 LFNRLGLIPD 325
           LF+RLG+ P+
Sbjct: 302 LFSRLGIKPE 311


>gi|289650641|ref|ZP_06481984.1| biotin synthase [Pseudomonas syringae pv. aesculi str. 2250]
          Length = 352

 Score =  319 bits (817), Expect = 4e-85,   Method: Composition-based stats.
 Identities = 168/310 (54%), Positives = 230/310 (74%)

Query: 16  PKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQS 75
              WT  EV  ++  PFNDLLF + TVHR +FE N +Q+S LL+IKTG CPE+C YC QS
Sbjct: 10  RHDWTLAEVRALFVQPFNDLLFQAQTVHRAHFEANRVQVSTLLSIKTGACPEDCKYCPQS 69

Query: 76  VHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSL 135
            H  + L+  KL+ V +VL+EA  AK  G+TR+CMGAAW+ P  +D+  +++M+KGVK++
Sbjct: 70  GHYNTGLEKEKLLEVQKVLEEAARAKAIGSTRFCMGAAWKHPSAKDMPYVLEMVKGVKAM 129

Query: 136 GLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKS 195
           G+ETCMTLG L  EQ + L+ AGLDYYNHN+DTS  FY  + TT T+ +RLQTL  VR +
Sbjct: 130 GMETCMTLGRLDQEQTEALATAGLDYYNHNLDTSPEFYGSIITTRTYSERLQTLAYVRDA 189

Query: 196 GIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEH 255
           G+K+C GGILG+GE +DDR  +L+ LANL   PES+PIN+L+ + G+  E  + VDP + 
Sbjct: 190 GMKICSGGILGMGESLDDRAGLLIQLANLPEHPESVPINMLVKVAGTPLENAEDVDPFDF 249

Query: 256 VRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTI 315
           +R+++VARILMP+S +RL+AGR  M++++QAL FF+GANSIF GD LLT  NP  +KD +
Sbjct: 250 IRMLAVARILMPQSHVRLSAGREAMNEQMQALAFFAGANSIFYGDKLLTTANPQADKDML 309

Query: 316 LFNRLGLIPD 325
           LF+RLG+ P+
Sbjct: 310 LFSRLGIKPE 319


>gi|78045959|ref|YP_362134.1| biotin synthase BioB [Xanthomonas campestris pv. vesicatoria str.
           85-10]
 gi|123730441|sp|Q3BYM9|BIOB_XANC5 RecName: Full=Biotin synthase
 gi|78034389|emb|CAJ22034.1| biotin synthase BioB [Xanthomonas campestris pv. vesicatoria str.
           85-10]
          Length = 344

 Score =  319 bits (817), Expect = 4e-85,   Method: Composition-based stats.
 Identities = 160/311 (51%), Positives = 220/311 (70%)

Query: 16  PKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQS 75
              W  KE+  ++++PF +LL  + +VHR +F+P  +Q+S LL++KTGGCPE+C YC Q+
Sbjct: 6   RHDWDRKELQALFDLPFPELLHRAASVHRAHFDPAQVQVSTLLSVKTGGCPEDCAYCPQA 65

Query: 76  VHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSL 135
               + + A KL+  ++V+ +A+ AK  GA+R+CMGAAWR PKERD+  +  MI+ VK++
Sbjct: 66  QRYDTGVSAQKLMETEEVVAKARQAKAAGASRFCMGAAWRSPKERDIPKVAAMIREVKAM 125

Query: 136 GLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKS 195
           GLETC TLGML   QA+ L  AGLDYYNHN+DT+  +Y  +  T  ++DRL TLE+VR  
Sbjct: 126 GLETCATLGMLDAGQARALKDAGLDYYNHNLDTAPDYYDSIIHTRQYQDRLNTLEHVRDV 185

Query: 196 GIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEH 255
           G+K CCGGI+G+GE  + R+ +LL LA L   P+S+PIN L+ +PG+     +++DP E 
Sbjct: 186 GLKTCCGGIVGMGETREHRVGLLLALATLPAHPDSVPINQLVQVPGTPLHGTQQLDPFEF 245

Query: 256 VRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTI 315
           VR+I+VARI MPKS +RL+AGR  MSDELQALCF +GANSIF G+ LLT  NP   +D  
Sbjct: 246 VRMIAVARIAMPKSMVRLSAGREAMSDELQALCFLAGANSIFYGEKLLTTGNPDTERDQA 305

Query: 316 LFNRLGLIPDL 326
           LF RLGL P  
Sbjct: 306 LFQRLGLRPMQ 316


>gi|325981844|ref|YP_004294246.1| biotin synthase [Nitrosomonas sp. AL212]
 gi|325531363|gb|ADZ26084.1| biotin synthase [Nitrosomonas sp. AL212]
          Length = 336

 Score =  319 bits (816), Expect = 5e-85,   Method: Composition-based stats.
 Identities = 152/315 (48%), Positives = 218/315 (69%)

Query: 9   EENPTKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPEN 68
                +  + W+  EV  + N  FNDL+F + TVHR++ +PN +QLS L+++KTGGCPE+
Sbjct: 19  ITEELQNSEFWSVTEVESLLNASFNDLIFRAQTVHRQHHDPNGVQLSTLISVKTGGCPED 78

Query: 69  CGYCNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDM 128
           CGYC Q+    + ++   ++++D+V+  A  AK+ GA+R+CMGAAWR PK+RD+  + +M
Sbjct: 79  CGYCPQAARYHTGVENQDMLSLDEVVSAATAAKDKGASRFCMGAAWRGPKQRDIEKMTEM 138

Query: 129 IKGVKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQT 188
           ++ VKSLGLETC TLG+L   QA+ L +AGLDYYNHN+DT+  +Y  + TT  ++DRL T
Sbjct: 139 VRAVKSLGLETCATLGLLKPGQARQLGEAGLDYYNHNLDTAPEYYEEIITTRQYQDRLDT 198

Query: 189 LENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENK 248
           L  VR++GI VCCGGI+G+GE    R  ++  LAN++  PES+PIN L+ + G+      
Sbjct: 199 LHQVREAGINVCCGGIVGMGETRRSRAGLIAQLANMNPYPESVPINHLVQVEGTPLYGTA 258

Query: 249 KVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNP 308
            +DP E VR I+ ARI MPK+ +RL+AGR  MS+ +Q+LCF +GANSIF GD LLT  NP
Sbjct: 259 ALDPFEFVRTIAAARITMPKAMVRLSAGRQEMSEAIQSLCFLAGANSIFYGDKLLTTGNP 318

Query: 309 SYNKDTILFNRLGLI 323
             ++D  L  +LGL 
Sbjct: 319 ETDRDRALMEKLGLH 333


>gi|187922451|ref|YP_001894093.1| biotin synthase [Burkholderia phytofirmans PsJN]
 gi|254810621|sp|B2SWS5|BIOB_BURPP RecName: Full=Biotin synthase
 gi|187713645|gb|ACD14869.1| biotin synthase [Burkholderia phytofirmans PsJN]
          Length = 361

 Score =  319 bits (816), Expect = 5e-85,   Method: Composition-based stats.
 Identities = 170/308 (55%), Positives = 221/308 (71%)

Query: 18  VWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQSVH 77
            W   ++  +Y +PFNDL+F +   HR++F+ N +QLS LL+IKTGGC E+C YC QSVH
Sbjct: 31  RWRVADIVALYELPFNDLMFKAQQTHREHFDANTVQLSTLLSIKTGGCEEDCAYCPQSVH 90

Query: 78  NKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLGL 137
           + + L+A KL+ VD+VL  AK AKENGATR+CMGAAWR PK+R L  I DMI+GVK++GL
Sbjct: 91  HDTGLQADKLMPVDEVLAAAKVAKENGATRFCMGAAWRNPKDRHLEPIKDMIRGVKAMGL 150

Query: 138 ETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSGI 197
           ETC+TLGML   QAQ L +AGLDYYNHN+DTS  FY  + +T T++DRL TLE VR +GI
Sbjct: 151 ETCVTLGMLETHQAQGLREAGLDYYNHNLDTSPEFYGQIISTRTYQDRLDTLERVRDAGI 210

Query: 198 KVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEHVR 257
            VCCGGI+GLGE   +R  ++  LAN+   PES+PIN L+ + G+     + +DP E VR
Sbjct: 211 NVCCGGIVGLGESRRERAGLIAQLANMEPYPESVPINNLVQVEGTPLTGTEAIDPFEFVR 270

Query: 258 IISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTILF 317
            I++ARI MP++ +RL+AGR  M + LQALCF +GANSIF GD LLT  NP    D  L 
Sbjct: 271 TIAIARITMPRAMVRLSAGREQMDEALQALCFLAGANSIFYGDQLLTTSNPQAEADRKLL 330

Query: 318 NRLGLIPD 325
            RLG+  +
Sbjct: 331 ERLGIRAE 338


>gi|229592991|ref|YP_002875110.1| biotin synthase [Pseudomonas fluorescens SBW25]
 gi|229364857|emb|CAY52910.1| biotin synthase [Pseudomonas fluorescens SBW25]
          Length = 351

 Score =  319 bits (816), Expect = 5e-85,   Method: Composition-based stats.
 Identities = 166/310 (53%), Positives = 231/310 (74%)

Query: 16  PKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQS 75
              W+  EV  ++  PFNDLLF + TVHR +F+ N +Q+S LL+IKTG CPE+C YC QS
Sbjct: 10  RHDWSLAEVKALFVQPFNDLLFQAQTVHRAHFDANRVQVSTLLSIKTGACPEDCKYCPQS 69

Query: 76  VHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSL 135
            H  + L+  KL+ V +VL+EA  AK  G+TR+CMGAAW+ P  +D+  ++ M+KGVK++
Sbjct: 70  GHYNTGLEKEKLMEVQKVLEEAARAKAIGSTRFCMGAAWKHPSAKDMPYVLQMVKGVKAM 129

Query: 136 GLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKS 195
           GLETCMTLG L  +Q + L++AGLDYYNHN+DTS  FY  + TT T+ +RLQTL  VR S
Sbjct: 130 GLETCMTLGRLDQDQTEALAQAGLDYYNHNLDTSPEFYGSIITTRTYGERLQTLAYVRDS 189

Query: 196 GIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEH 255
           G+K+C GGILG+GE +DDR ++L+ LANL   PES+PIN+L+ + G+  E  + +DP + 
Sbjct: 190 GMKICSGGILGMGESLDDRANLLIQLANLPEHPESVPINMLVKVAGTPLENAEDIDPFDF 249

Query: 256 VRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTI 315
           +R+++VARILMP+S +RL+AGR  M++++QAL FF+GANSIF GD LLT  NP  +KD  
Sbjct: 250 IRMLAVARILMPRSHVRLSAGREAMNEQMQALAFFAGANSIFYGDKLLTTANPQADKDMQ 309

Query: 316 LFNRLGLIPD 325
           LF+RLG++P+
Sbjct: 310 LFSRLGILPE 319


>gi|91776516|ref|YP_546272.1| biotin synthase [Methylobacillus flagellatus KT]
 gi|123380372|sp|Q1GZA6|BIOB_METFK RecName: Full=Biotin synthase
 gi|91710503|gb|ABE50431.1| biotin synthase [Methylobacillus flagellatus KT]
          Length = 335

 Score =  318 bits (815), Expect = 6e-85,   Method: Composition-based stats.
 Identities = 160/324 (49%), Positives = 225/324 (69%)

Query: 1   MSRSTVVPEENPTKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNI 60
           + R      +   + PK W+  ++  ++ +PF+DL+  + +VHR+NF+PN +Q+S LL+I
Sbjct: 11  LDRVQRARVQAKEEAPKRWSVDDIVALFELPFSDLMHRAQSVHRENFDPNGVQVSTLLSI 70

Query: 61  KTGGCPENCGYCNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKER 120
           KTGGC E+CGYC Q+    + ++   L+ +++VL  A+ AKENGA+R+CMGAAWR PK+R
Sbjct: 71  KTGGCSEDCGYCPQAARYHTDVEKQDLMQLEEVLAAARAAKENGASRFCMGAAWRSPKQR 130

Query: 121 DLSIIVDMIKGVKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTH 180
           DL  ++ MI+ VK++GLETC TLGML   QA+ L +AGLDYYNHN+DT+  +Y  V TT 
Sbjct: 131 DLEPVLAMIREVKAMGLETCATLGMLKDGQAEQLKEAGLDYYNHNLDTAPEYYGEVITTR 190

Query: 181 TFEDRLQTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIP 240
           T++DRL TL+ VR+  I VCCGGI+G+GE    R  +L  LAN+  PPES+PINLL  + 
Sbjct: 191 TYQDRLDTLDRVREQDINVCCGGIIGMGESRVQRAGLLAQLANMERPPESVPINLLTQVE 250

Query: 241 GSKFEENKKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGD 300
           G+      ++DP E VR I+ ARI MP+S +RL+AGR  M + +QALCF +GANSIF G+
Sbjct: 251 GTPMYGMDELDPFEFVRTIAAARITMPQSFVRLSAGRQSMHEGIQALCFLAGANSIFYGE 310

Query: 301 TLLTAKNPSYNKDTILFNRLGLIP 324
            LLT  NP    D  LF++LG+ P
Sbjct: 311 KLLTTGNPEAEADRKLFDKLGIHP 334


>gi|28867724|ref|NP_790343.1| biotin synthetase [Pseudomonas syringae pv. tomato str. DC3000]
 gi|81732729|sp|Q88A98|BIOB_PSESM RecName: Full=Biotin synthase
 gi|28850959|gb|AAO54038.1| biotin synthetase [Pseudomonas syringae pv. tomato str. DC3000]
 gi|331015041|gb|EGH95097.1| biotin synthase [Pseudomonas syringae pv. lachrymans str.
           M302278PT]
          Length = 352

 Score =  318 bits (815), Expect = 6e-85,   Method: Composition-based stats.
 Identities = 167/310 (53%), Positives = 230/310 (74%)

Query: 16  PKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQS 75
              WT  EV  ++  PFNDLLF + T+HR +F+ N +Q+S LL+IKTG CPE+C YC QS
Sbjct: 10  RHDWTLAEVRALFVQPFNDLLFQAQTLHRAHFDANRVQVSTLLSIKTGACPEDCKYCPQS 69

Query: 76  VHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSL 135
            H  + L+  KL+ V +VL+EA  AK  G+TR+CMGAAW+ P  +D+  +++M+KGVK++
Sbjct: 70  GHYNTGLEKEKLLEVQKVLEEAARAKSIGSTRFCMGAAWKHPSAKDMPYVLEMVKGVKAM 129

Query: 136 GLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKS 195
           GLETCMTLG L  EQ + L+ AGLDYYNHN+DTS  FY  + TT T+ +RLQTL  VR +
Sbjct: 130 GLETCMTLGRLDQEQTEALATAGLDYYNHNLDTSPEFYGSIITTRTYGERLQTLAYVRDA 189

Query: 196 GIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEH 255
           G+K+C GGILG+GE +DDR  +L+ LANL   PES+PIN+L+ + G+  E  + VDP + 
Sbjct: 190 GMKICSGGILGMGESLDDRAGLLIQLANLPEHPESVPINMLVKVAGTPLENAEDVDPFDF 249

Query: 256 VRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTI 315
           +R+++VARILMP+S +RL+AGR  M++++QAL FF+GANSIF GD LLT  NP  +KD +
Sbjct: 250 IRMLAVARILMPQSHVRLSAGREAMNEQMQALAFFAGANSIFYGDKLLTTANPQADKDML 309

Query: 316 LFNRLGLIPD 325
           LF+RLG+ P+
Sbjct: 310 LFSRLGIKPE 319


>gi|186474939|ref|YP_001856409.1| biotin synthase [Burkholderia phymatum STM815]
 gi|254810620|sp|B2JKH4|BIOB_BURP8 RecName: Full=Biotin synthase
 gi|184191398|gb|ACC69363.1| biotin synthase [Burkholderia phymatum STM815]
          Length = 351

 Score =  318 bits (815), Expect = 6e-85,   Method: Composition-based stats.
 Identities = 173/308 (56%), Positives = 224/308 (72%)

Query: 18  VWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQSVH 77
            W   +V  +Y +PFNDLLF +  VHR++F+ N +QLS LL+IKTGGC E+C YC QSVH
Sbjct: 26  RWKVADVAALYELPFNDLLFRAQQVHREHFDANTVQLSTLLSIKTGGCEEDCAYCPQSVH 85

Query: 78  NKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLGL 137
           +++ LKA KL+ V++VL  A+ AKENGATR+CMGAAWR PK+R L  I DMI+GVKS+GL
Sbjct: 86  HETGLKAEKLMEVEEVLAAARVAKENGATRFCMGAAWRNPKDRHLEPIKDMIRGVKSMGL 145

Query: 138 ETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSGI 197
           ETC+TLGML   QAQ L +AGLDYYNHN+DTS  FY  + +T T++DRL TLE+VR +GI
Sbjct: 146 ETCVTLGMLEAHQAQALREAGLDYYNHNLDTSPEFYGQIISTRTYQDRLDTLEHVRDAGI 205

Query: 198 KVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEHVR 257
            VCCGGI+GLGE   +R  ++  LAN+   PES+PIN L+ + G+     + +DP E VR
Sbjct: 206 NVCCGGIVGLGESRRERAGLIAQLANMEPYPESVPINNLVQVEGTPLTGTEALDPFEFVR 265

Query: 258 IISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTILF 317
            I+VARI MP++ +RL+AGR  M + LQA+CF +GANSIF GD LLT  NP    D  L 
Sbjct: 266 TIAVARITMPRAMVRLSAGREQMDEALQAMCFLAGANSIFYGDQLLTTSNPQAEADRKLL 325

Query: 318 NRLGLIPD 325
            RLG+  +
Sbjct: 326 ARLGIRAE 333


>gi|120437885|ref|YP_863571.1| biotin synthase [Gramella forsetii KT0803]
 gi|254810709|sp|A0M7A9|BIOB_GRAFK RecName: Full=Biotin synthase
 gi|117580035|emb|CAL68504.1| biotin synthase [Gramella forsetii KT0803]
          Length = 363

 Score =  318 bits (815), Expect = 6e-85,   Method: Composition-based stats.
 Identities = 148/312 (47%), Positives = 220/312 (70%), Gaps = 1/312 (0%)

Query: 17  KVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQSV 76
             WT +E+ +IYN PF +LL+ + T+HR++ +PN +Q+S LL+IKTGGCPE+CGYC Q+ 
Sbjct: 5   HDWTKEEILEIYNKPFMELLYDAATIHREHHDPNTVQVSTLLSIKTGGCPEDCGYCPQAA 64

Query: 77  HNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKE-RDLSIIVDMIKGVKSL 135
              + L+ + L++V+QV  +A  AK +G++R CMGAAWR  K+  +   +++M++ +  L
Sbjct: 65  RYHTDLEGNDLMSVNQVKAQALRAKASGSSRVCMGAAWRNVKDGEEFDNVLEMVRSINKL 124

Query: 136 GLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKS 195
            +E C TLGML+  QAQ L++AGL  YNHN+D+SE +Y  V +T  ++DRL T+ NVRK+
Sbjct: 125 DMEVCCTLGMLTENQAQRLAEAGLYAYNHNLDSSEEYYKEVISTRGYQDRLDTIGNVRKT 184

Query: 196 GIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEH 255
            + VC GGI+G+GE   DR  ML+ L+ L+  PES+PIN L+P+ G+  EE + V   E 
Sbjct: 185 NVTVCSGGIIGMGESEADRAGMLVALSTLNPQPESVPINALVPVEGTPMEEQEPVPIWEM 244

Query: 256 VRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTI 315
           +R+++  RI+MP++++RL+AGR  MS E QA+CFF+GANSIF GD LLT  NP  ++D  
Sbjct: 245 IRMVATTRIVMPETQVRLSAGRTQMSREGQAMCFFAGANSIFAGDKLLTTPNPDVSEDME 304

Query: 316 LFNRLGLIPDLS 327
           +F  LGL P  +
Sbjct: 305 MFKMLGLNPQKA 316


>gi|91217974|ref|ZP_01254926.1| Biotin synthase [Psychroflexus torquis ATCC 700755]
 gi|91183832|gb|EAS70223.1| Biotin synthase [Psychroflexus torquis ATCC 700755]
          Length = 362

 Score =  318 bits (815), Expect = 6e-85,   Method: Composition-based stats.
 Identities = 148/315 (46%), Positives = 219/315 (69%), Gaps = 1/315 (0%)

Query: 14  KKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCN 73
                WT +E+  IYN P  +LL+ + TVHR + +PN +Q+S LL+IKTGGCPE+CGYC 
Sbjct: 1   MTRNDWTKEEILAIYNKPLMELLYEAATVHRIHHDPNKVQVSTLLSIKTGGCPEDCGYCP 60

Query: 74  QSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKE-RDLSIIVDMIKGV 132
           Q+    + ++ + L++V QV  +A  AK +G++R CMGAAWR  K+ ++   +++M++ +
Sbjct: 61  QAARYHTDIEGNDLMSVSQVKAQALRAKSSGSSRVCMGAAWRNVKDGKEFDNVLEMVRTI 120

Query: 133 KSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENV 192
             L +E C TLGM++  QA+ L++AGL  YNHN+D+SE +Y  V +T  ++DRL T+ NV
Sbjct: 121 NKLDMEVCCTLGMVTENQAKRLAEAGLYAYNHNLDSSEEYYKEVISTRGYQDRLDTISNV 180

Query: 193 RKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDP 252
           RKS + VC GGI+G+GE ++DR  ML+ LA L+  PES PIN L+P+ G+  EE +K+  
Sbjct: 181 RKSKVTVCSGGIIGMGESLEDRAGMLVALATLNPQPESTPINALVPVEGTPLEEQQKISI 240

Query: 253 IEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNK 312
            E +R+I+  RI+MP++++RL+AGR  MS E QA+CFF+GANSIF GD LLT  NP+ + 
Sbjct: 241 WEMLRMIATTRIVMPETQVRLSAGRTDMSREGQAMCFFAGANSIFAGDKLLTTPNPNVDD 300

Query: 313 DTILFNRLGLIPDLS 327
           D  +F  LGL P  +
Sbjct: 301 DMEMFKLLGLKPQKA 315


>gi|269139899|ref|YP_003296600.1| biotin synthase [Edwardsiella tarda EIB202]
 gi|267985560|gb|ACY85389.1| biotin synthase [Edwardsiella tarda EIB202]
 gi|304559734|gb|ADM42398.1| Biotin synthase [Edwardsiella tarda FL6-60]
          Length = 348

 Score =  318 bits (815), Expect = 6e-85,   Method: Composition-based stats.
 Identities = 158/310 (50%), Positives = 224/310 (72%)

Query: 18  VWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQSVH 77
            WT  +   ++  P  +L+F +  VHR++F+P  +Q+S LL+IKTG CPE+C YC QS  
Sbjct: 9   RWTQAQAQALFEQPLLELMFQAQQVHRQHFDPRQVQVSTLLSIKTGACPEDCKYCPQSAR 68

Query: 78  NKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLGL 137
            K+ L A +L+ V+QVL  A+ A+  G+TR+CMGAAW+ P ERD+  +  M++GVK+LG+
Sbjct: 69  YKTGLAAERLMEVEQVLDSARRARAAGSTRFCMGAAWKNPHERDMPYLEQMVRGVKALGM 128

Query: 138 ETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSGI 197
           ETCMTLG L+ EQAQ L++AGLDYYNHN+DTS  +Y ++ TT  ++DRL TL  VR++GI
Sbjct: 129 ETCMTLGALNAEQAQRLAQAGLDYYNHNLDTSPAYYANIITTRRYQDRLDTLARVREAGI 188

Query: 198 KVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEHVR 257
           KVC GGI+GLGE + DR  +L+ LANL TPPES+PIN+L+ + G+   E   VDP + +R
Sbjct: 189 KVCSGGIVGLGEAVGDRAALLVELANLPTPPESVPINMLVKVAGTPLAEAPDVDPFDFIR 248

Query: 258 IISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTILF 317
            I+ ARI+MP + +RL+AGR  M+++ QA+CF +GAN+IF G  LLT  NP+ ++D  LF
Sbjct: 249 TIAAARIMMPTAYVRLSAGREQMNEQTQAMCFMAGANAIFYGCRLLTTPNPAEDRDLQLF 308

Query: 318 NRLGLIPDLS 327
            +LGL P  +
Sbjct: 309 RKLGLNPQQT 318


>gi|91781580|ref|YP_556786.1| biotin synthase [Burkholderia xenovorans LB400]
 gi|122970762|sp|Q146K5|BIOB_BURXL RecName: Full=Biotin synthase
 gi|91685534|gb|ABE28734.1| Biotin synthase [Burkholderia xenovorans LB400]
          Length = 360

 Score =  318 bits (815), Expect = 6e-85,   Method: Composition-based stats.
 Identities = 169/308 (54%), Positives = 222/308 (72%)

Query: 18  VWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQSVH 77
            W   ++  +Y +PFNDL+F +   HR++F+ N +QLS LL+IKTGGC E+C YC QSVH
Sbjct: 30  RWRVADIVSLYELPFNDLMFQAQQTHREHFDANTVQLSTLLSIKTGGCEEDCAYCPQSVH 89

Query: 78  NKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLGL 137
           + + L+A KL+ VD+VL  AK AKENGATR+CMGAAWR PK+R L  I DMI+GVK++GL
Sbjct: 90  HDTGLQADKLMPVDEVLAAAKVAKENGATRFCMGAAWRNPKDRHLEPIKDMIRGVKAMGL 149

Query: 138 ETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSGI 197
           ETC+TLGML   QAQ L +AGLDYYNHN+DTS  FY  + +T T++DRL TLE VR +GI
Sbjct: 150 ETCVTLGMLETHQAQGLREAGLDYYNHNLDTSPEFYGQIISTRTYQDRLDTLERVRDAGI 209

Query: 198 KVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEHVR 257
            VCCGGI+GLGE   +R  ++  LAN+   PES+PIN L+ + G+     + +DP E VR
Sbjct: 210 NVCCGGIVGLGESRRERAGLIAQLANMDPYPESVPINNLVQVEGTPLTGTEAIDPFEFVR 269

Query: 258 IISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTILF 317
            I++ARI MP++ +RL+AGR  M++ LQA+CF +GANSIF GD LLT  NP    D  L 
Sbjct: 270 TIAIARITMPRAMVRLSAGREQMNEALQAMCFLAGANSIFYGDQLLTTSNPQAEADRKLL 329

Query: 318 NRLGLIPD 325
            RLG+  +
Sbjct: 330 ERLGIRAE 337


>gi|296160877|ref|ZP_06843690.1| biotin synthase [Burkholderia sp. Ch1-1]
 gi|295888969|gb|EFG68774.1| biotin synthase [Burkholderia sp. Ch1-1]
          Length = 359

 Score =  318 bits (815), Expect = 7e-85,   Method: Composition-based stats.
 Identities = 169/308 (54%), Positives = 222/308 (72%)

Query: 18  VWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQSVH 77
            W   ++  +Y +PFNDL+F +   HR++F+ N +QLS LL+IKTGGC E+C YC QSVH
Sbjct: 29  RWRVADIVALYELPFNDLMFQAQQTHREHFDANTVQLSTLLSIKTGGCEEDCAYCPQSVH 88

Query: 78  NKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLGL 137
           + + L+A KL+ VD+VL  AK AKENGATR+CMGAAWR PK+R L  I DMI+GVK++GL
Sbjct: 89  HDTGLQADKLMPVDEVLAAAKVAKENGATRFCMGAAWRNPKDRHLEPIKDMIRGVKAMGL 148

Query: 138 ETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSGI 197
           ETC+TLGML   QAQ L +AGLDYYNHN+DTS  FY  + +T T++DRL TLE VR +GI
Sbjct: 149 ETCVTLGMLETHQAQGLREAGLDYYNHNLDTSPEFYGQIISTRTYQDRLDTLERVRDAGI 208

Query: 198 KVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEHVR 257
            VCCGGI+GLGE   +R  ++  LAN+   PES+PIN L+ + G+     + +DP E VR
Sbjct: 209 NVCCGGIVGLGESRRERAGLIAQLANMDPYPESVPINNLVQVEGTPLTGTEAIDPFEFVR 268

Query: 258 IISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTILF 317
            I++ARI MP++ +RL+AGR  M++ LQA+CF +GANSIF GD LLT  NP    D  L 
Sbjct: 269 TIAIARITMPRAMVRLSAGREQMNEALQAMCFLAGANSIFYGDQLLTTSNPQAEADRKLL 328

Query: 318 NRLGLIPD 325
            RLG+  +
Sbjct: 329 ERLGIRAE 336


>gi|87119499|ref|ZP_01075396.1| biotin synthase [Marinomonas sp. MED121]
 gi|86164975|gb|EAQ66243.1| biotin synthase [Marinomonas sp. MED121]
          Length = 352

 Score =  318 bits (814), Expect = 8e-85,   Method: Composition-based stats.
 Identities = 164/312 (52%), Positives = 235/312 (75%)

Query: 14  KKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCN 73
           +    WT  EV  ++++PF DLLF + TVHR+NF+PN +Q+S LL+IKTG CPE+C YC 
Sbjct: 8   EAKHNWTHAEVQALFDLPFMDLLFQAQTVHRQNFKPNEVQVSTLLSIKTGACPEDCKYCP 67

Query: 74  QSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVK 133
           QS H  ++L+  KL+ V++VL+EA  AK+ GATR+CMGAAW+ P E+D   +++MIKGVK
Sbjct: 68  QSGHYNTELEKEKLMEVEKVLQEANLAKDKGATRFCMGAAWKHPSEKDFPYVLEMIKGVK 127

Query: 134 SLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVR 193
           +LGLE+C+TLG L+ +QA +LS+ GLDYYNHN+DTS  FY  + TT +++DRL TL+ VR
Sbjct: 128 ALGLESCVTLGTLNDKQAAMLSEVGLDYYNHNLDTSAEFYNSIITTRSYQDRLDTLDRVR 187

Query: 194 KSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPI 253
            SGIK+CCGGI+G+GE  +DRI +L  L+ +   PES+PIN+L+ + G+  E  + +D  
Sbjct: 188 DSGIKLCCGGIMGMGEEQNDRISLLRQLSEMKPHPESVPINMLVKVEGTPMENVEDLDSF 247

Query: 254 EHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKD 313
           E +R +++ARI+MPKS +RL+AGR  M++++QALCF +GANSIF G+ LLT  NP  +KD
Sbjct: 248 EFIRTVAIARIMMPKSHVRLSAGREGMNEQMQALCFMAGANSIFYGEKLLTTPNPEAHKD 307

Query: 314 TILFNRLGLIPD 325
             LF++LG+  +
Sbjct: 308 MQLFSKLGINTE 319


>gi|220933322|ref|YP_002512221.1| biotin synthase [Thioalkalivibrio sp. HL-EbGR7]
 gi|254811602|sp|B8GTH4|BIOB_THISH RecName: Full=Biotin synthase
 gi|219994632|gb|ACL71234.1| biotin synthase [Thioalkalivibrio sp. HL-EbGR7]
          Length = 340

 Score =  318 bits (814), Expect = 8e-85,   Method: Composition-based stats.
 Identities = 175/319 (54%), Positives = 232/319 (72%)

Query: 6   VVPEENPTKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGC 65
           + P    ++    W   E+ ++   PFNDLLF +HTVHR +F+PN +Q+S LL+IKTG C
Sbjct: 1   MSPASPMSEIRHDWQVDEILELMGRPFNDLLFAAHTVHRAHFDPNAVQVSTLLSIKTGAC 60

Query: 66  PENCGYCNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSII 125
           PE+CGYC QS H++ +L+  +L+ +++VL+ A+NA+ +GA+R+CMGAAWR P +R+L  +
Sbjct: 61  PEDCGYCPQSAHHEVELERERLLPLEEVLEAARNARSHGASRFCMGAAWRNPTDRNLERV 120

Query: 126 VDMIKGVKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDR 185
           ++M++GVK LGLETCMTLGML+  QA+ L  AGLDYYNHN+DTS  FY  V TT T++DR
Sbjct: 121 IEMVEGVKQLGLETCMTLGMLTDAQARRLKDAGLDYYNHNLDTSPEFYGQVITTRTYQDR 180

Query: 186 LQTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFE 245
           L+TL +VR++GI VC GGILG+GE   DR  +L  LANL   PES+PIN L+ + G+   
Sbjct: 181 LETLAHVREAGINVCSGGILGMGESRRDRARLLQQLANLPRHPESVPINNLVQVEGTPLA 240

Query: 246 ENKKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTA 305
             + +DP E VR I+ ARILMP S +RL+AGR  M DELQALCFF+GANSIF GD LLT 
Sbjct: 241 GTEALDPFEFVRTIATARILMPASYVRLSAGRTEMHDELQALCFFAGANSIFYGDKLLTT 300

Query: 306 KNPSYNKDTILFNRLGLIP 324
            NP  N D  LF RLG+ P
Sbjct: 301 PNPGENHDRALFERLGIHP 319


>gi|288550075|ref|ZP_05969218.2| biotin synthase [Enterobacter cancerogenus ATCC 35316]
 gi|288316668|gb|EFC55606.1| biotin synthase [Enterobacter cancerogenus ATCC 35316]
          Length = 338

 Score =  318 bits (814), Expect = 1e-84,   Method: Composition-based stats.
 Identities = 164/301 (54%), Positives = 223/301 (74%)

Query: 23  EVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQSVHNKSKL 82
           +V +++N PF +L+F +  VHR++F+P H+Q+S LL+IKTG CPE+C YC QS   K+ L
Sbjct: 3   QVTELFNKPFLELMFEAQQVHRQHFDPRHVQVSTLLSIKTGACPEDCKYCPQSARYKTGL 62

Query: 83  KASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLGLETCMT 142
           +  +L+ V+QVL  A+ AK  G+TR+CMGAAW+ P +RD+  +  M+KGVK +GLE CMT
Sbjct: 63  ETERLMEVEQVLDSARKAKNAGSTRFCMGAAWKNPHDRDMPYLEQMVKGVKEMGLEACMT 122

Query: 143 LGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSGIKVCCG 202
           LG L+ EQAQ LS AGLDYYNHN+DTS  FY ++ TT T+++RL TL+ VR +GIKVC G
Sbjct: 123 LGTLNDEQAQRLSAAGLDYYNHNLDTSPEFYGNIITTRTYQERLDTLDKVRDAGIKVCSG 182

Query: 203 GILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEHVRIISVA 262
           GI+GLGE + DR  +LL LANL TPPES+PIN+L+ + G+   +N  VD  + +R I+VA
Sbjct: 183 GIVGLGETVKDRAGLLLQLANLPTPPESVPINMLVKVKGTPLADNDDVDAFDFIRTIAVA 242

Query: 263 RILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTILFNRLGL 322
           RI+MP S +RL+AGR  M+++ QA+CF +GANSIF G  LLT  NP  +KD  LF +LGL
Sbjct: 243 RIMMPTSYVRLSAGREQMNEQTQAMCFMAGANSIFYGCKLLTTPNPEEDKDVQLFRKLGL 302

Query: 323 I 323
            
Sbjct: 303 R 303


>gi|88799646|ref|ZP_01115221.1| biotin synthetase [Reinekea sp. MED297]
 gi|88777540|gb|EAR08740.1| biotin synthetase [Reinekea sp. MED297]
          Length = 350

 Score =  317 bits (813), Expect = 1e-84,   Method: Composition-based stats.
 Identities = 169/310 (54%), Positives = 232/310 (74%)

Query: 16  PKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQS 75
              WT+ EV Q++  PFNDLLF + TVHR  F+PN +Q+S LL+IKTG CPE+C YC QS
Sbjct: 10  RHDWTTAEVVQLFERPFNDLLFQAATVHRAYFDPNEVQVSTLLSIKTGACPEDCKYCPQS 69

Query: 76  VHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSL 135
            H  + L+  KL+ V +V+ +AK AK  GA+R+CMGAA+R P E+D   I++M++ VK L
Sbjct: 70  GHYNTGLEKEKLMEVQKVIDQAKAAKAAGASRFCMGAAYRSPTEKDFPAILEMVRSVKDL 129

Query: 136 GLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKS 195
           GLETCMTLGML  EQA  L+ AGLDYYNHN+DTS  +Y  + TT T+ DRL+TL+NVR +
Sbjct: 130 GLETCMTLGMLEGEQAAKLADAGLDYYNHNLDTSPEYYGEIITTRTYGDRLETLQNVRDA 189

Query: 196 GIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEH 255
           G+K+C GGILG+GE ++DR  + + LAN++  PES+P+N+L+ + G+ F EN+ +DPI+ 
Sbjct: 190 GMKICSGGILGMGEGVEDRAGLFIQLANMNPHPESVPVNMLVKVEGTPFAENEDLDPIDF 249

Query: 256 VRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTI 315
           +R I+VARI+MP S +RL+AGR  MS+E+QA+ FF+GANSIF G+ LLT  NP  N+D  
Sbjct: 250 IRAIAVARIMMPTSHVRLSAGREEMSEEMQAMAFFAGANSIFYGEKLLTTANPEANRDRE 309

Query: 316 LFNRLGLIPD 325
           LF +LG+ P+
Sbjct: 310 LFTKLGINPE 319


>gi|262275952|ref|ZP_06053761.1| biotin synthase [Grimontia hollisae CIP 101886]
 gi|262219760|gb|EEY71076.1| biotin synthase [Grimontia hollisae CIP 101886]
          Length = 350

 Score =  317 bits (813), Expect = 1e-84,   Method: Composition-based stats.
 Identities = 164/313 (52%), Positives = 223/313 (71%)

Query: 16  PKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQS 75
              WT  EV  ++  PF DL+F +  VHRK    N +Q+S LL+IKTG CPE+C YC QS
Sbjct: 4   RHNWTVGEVQALFEKPFMDLMFEAQQVHRKYQPANQVQVSTLLSIKTGACPEDCKYCPQS 63

Query: 76  VHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSL 135
            H ++ ++  +L++V++VL  A+ AK  GATR+CMGAAW+ PK RD+  +  MI GVK +
Sbjct: 64  AHYRTDVEKERLLDVERVLDAAQKAKSAGATRFCMGAAWKNPKSRDMPYLKAMISGVKDM 123

Query: 136 GLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKS 195
           GLETCMTLGML+ EQA  L+ AGLDYYNHN+DTS   Y ++ TT TF+DRL TL +VR++
Sbjct: 124 GLETCMTLGMLTPEQANELAGAGLDYYNHNLDTSREHYSNIITTRTFQDRLDTLSHVREA 183

Query: 196 GIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEH 255
           G+KVC GGI+GLGE   DR  +L+ LANL   PES+PIN+L+ + G+  E    VDP + 
Sbjct: 184 GMKVCSGGIIGLGESASDRAGLLVELANLPHHPESVPINMLVKVKGTPLESVDDVDPFDF 243

Query: 256 VRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTI 315
           +RII+V RI+MPKS +RL+AGR  M++++QA+CF +GANSIF G  LLT  NP+ + D  
Sbjct: 244 IRIIAVTRIMMPKSAVRLSAGRENMNEQMQAMCFMAGANSIFYGCKLLTTPNPNEDADMQ 303

Query: 316 LFNRLGLIPDLSA 328
           LF +LG+  + +A
Sbjct: 304 LFRKLGINSEQAA 316


>gi|83746446|ref|ZP_00943498.1| Biotin synthase [Ralstonia solanacearum UW551]
 gi|83726987|gb|EAP74113.1| Biotin synthase [Ralstonia solanacearum UW551]
          Length = 450

 Score =  317 bits (813), Expect = 1e-84,   Method: Composition-based stats.
 Identities = 168/324 (51%), Positives = 225/324 (69%), Gaps = 3/324 (0%)

Query: 2   SRSTVVPEENPTKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIK 61
           ++   VP +NP      W+ + +  ++ +PFNDLLF +  VHR NF+ N +QLS LL+IK
Sbjct: 104 AKVPPVPGQNP---NARWSREAIEALFALPFNDLLFQAQQVHRANFDANAVQLSTLLSIK 160

Query: 62  TGGCPENCGYCNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERD 121
           TGGCPE+C YC QS    + ++A KL+ +D VL  A  A++NGA+R+CMGAAWR PK   
Sbjct: 161 TGGCPEDCSYCPQSARYDTGVEAEKLMPIDAVLDAAARARQNGASRFCMGAAWRNPKPHQ 220

Query: 122 LSIIVDMIKGVKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHT 181
           L  + DM++GVK++GLETC+TLGML  EQAQ L  AGLDYYNHN+DT+  FY  + TT T
Sbjct: 221 LDAVADMVRGVKAMGLETCVTLGMLKQEQAQQLKDAGLDYYNHNLDTAPEFYGEIITTRT 280

Query: 182 FEDRLQTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPG 241
           ++DRL TL +VR +GI VCCGGI+GLGE   +R  ++  LAN+   P+S+PIN L+ + G
Sbjct: 281 YQDRLDTLGHVRDAGINVCCGGIVGLGESRHERAGLVAELANMEPYPDSVPINNLVKVEG 340

Query: 242 SKFEENKKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDT 301
           +    N+ +DP E VR I+VARI MPK+ +RL+AGR  M D LQALCF +GANSIF G+ 
Sbjct: 341 TPLAGNEALDPFEFVRTIAVARITMPKAMVRLSAGREAMDDALQALCFMAGANSIFYGEK 400

Query: 302 LLTAKNPSYNKDTILFNRLGLIPD 325
           LLT  NP  + D  L  RLG+  +
Sbjct: 401 LLTTDNPEADADRKLLARLGMRVE 424


>gi|332530671|ref|ZP_08406602.1| biotin synthase [Hylemonella gracilis ATCC 19624]
 gi|332039839|gb|EGI76234.1| biotin synthase [Hylemonella gracilis ATCC 19624]
          Length = 347

 Score =  317 bits (813), Expect = 1e-84,   Method: Composition-based stats.
 Identities = 155/310 (50%), Positives = 217/310 (70%)

Query: 14  KKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCN 73
            K + W+   +  + ++PF +LL  + TVHR +F+P  ++ + LL++KTGGCPE+CGYC 
Sbjct: 29  PKTERWSLDAIEALLHLPFPELLHRAQTVHRAHFDPTQVEFATLLSVKTGGCPEDCGYCP 88

Query: 74  QSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVK 133
           QS   ++ +KASKL+ + +VL  A+ AK+ GATR+CMGAAWR PK+RD+  I ++++GVK
Sbjct: 89  QSASYETGVKASKLMELQEVLFAAQRAKDAGATRFCMGAAWRAPKDRDVEKIAELVRGVK 148

Query: 134 SLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVR 193
            LGLETC TLGML    A+ L  AGLDYYNHN+DT+  FY  + +T  ++DRL TL  VR
Sbjct: 149 DLGLETCATLGMLDEGHAEQLRDAGLDYYNHNLDTAPDFYGDIISTRDYQDRLDTLARVR 208

Query: 194 KSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPI 253
           ++G+K+C GGI+G+GE +  R  ++  LANL   PES+PIN L+ + G+   +   +DP 
Sbjct: 209 QAGVKICSGGIVGMGETVRHRAGLIAELANLDPYPESVPINNLVRVEGTPLADQDPLDPF 268

Query: 254 EHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKD 313
           + VR I+VARI MPK+R+RL+AGR  M D +QALCF +GANSIF GD LL   NP  + D
Sbjct: 269 DFVRTIAVARITMPKARVRLSAGRQQMGDGIQALCFLAGANSIFYGDKLLVTGNPDTDAD 328

Query: 314 TILFNRLGLI 323
             L NRLG+ 
Sbjct: 329 LQLLNRLGMR 338


>gi|254810622|sp|Q2T1Q4|BIOB_BURTA RecName: Full=Biotin synthase
          Length = 336

 Score =  317 bits (813), Expect = 1e-84,   Method: Composition-based stats.
 Identities = 174/319 (54%), Positives = 226/319 (70%), Gaps = 2/319 (0%)

Query: 4   STVVPEENPTKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTG 63
           +T  P   P      W   +V  +Y +PFNDLLF +   HR++F+ N IQLS LL+IKTG
Sbjct: 10  TTETPVAAPVAP--RWRVADVIALYELPFNDLLFRAQQTHREHFDANAIQLSTLLSIKTG 67

Query: 64  GCPENCGYCNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLS 123
           GC E+CGYC+QS H+ + LKA KL+ VD VL  A+ AKENGATR+CMGAAWR PK+R + 
Sbjct: 68  GCEEDCGYCSQSAHHDTGLKAEKLMEVDAVLAAARTAKENGATRFCMGAAWRNPKDRHIE 127

Query: 124 IIVDMIKGVKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFE 183
            I +MI+GVK +GLETC+TLGML   QA+ L++AGLDYYNHN+DTS  FY  + +T T++
Sbjct: 128 PIKEMIRGVKDMGLETCVTLGMLEEHQAKALAEAGLDYYNHNLDTSPEFYGQIISTRTYQ 187

Query: 184 DRLQTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSK 243
           DRL TLE VR +GI VCCGGI+G+GE   +R  ++  LAN++  PES+PIN L+ I G+ 
Sbjct: 188 DRLDTLERVRDAGINVCCGGIIGMGESRRERAGLIAQLANMNPYPESVPINNLVAIEGTP 247

Query: 244 FEENKKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLL 303
            E  + +DP E VR I+VARI MPK+ +RL+AGR  + D +QALCF +GANS+F GD LL
Sbjct: 248 LENAQALDPFEFVRTIAVARITMPKAMVRLSAGREQLDDSMQALCFLAGANSMFYGDVLL 307

Query: 304 TAKNPSYNKDTILFNRLGL 322
           T  NP    D  L  RLG+
Sbjct: 308 TTGNPRAEADRKLLARLGM 326


>gi|71278955|ref|YP_269309.1| biotin synthase [Colwellia psychrerythraea 34H]
 gi|71144695|gb|AAZ25168.1| biotin synthase [Colwellia psychrerythraea 34H]
          Length = 367

 Score =  317 bits (813), Expect = 1e-84,   Method: Composition-based stats.
 Identities = 170/317 (53%), Positives = 233/317 (73%)

Query: 12  PTKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGY 71
            +     W  KEV  ++ MPFNDL+F + T+HR+NF PN +Q+S LL+IKTG CPE+C Y
Sbjct: 23  NSILRHNWNLKEVEALFAMPFNDLMFKAQTIHRENFNPNEVQVSTLLSIKTGACPEDCKY 82

Query: 72  CNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKG 131
           C+QS  NK+ L+   L+ V++VL+ A+ AKE G+TR+CMGAAWR PKERD+  ++DM+K 
Sbjct: 83  CSQSARNKTDLEKESLLAVEKVLEAAQRAKEMGSTRFCMGAAWRNPKERDMPYVLDMVKS 142

Query: 132 VKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLEN 191
           VK+LG+ETCMTLGMLS +QA  L+ AGLDYYNHN+DTS   Y  + TT TF+DRL TL N
Sbjct: 143 VKALGMETCMTLGMLSGDQADQLNGAGLDYYNHNLDTSPEHYNQIITTRTFQDRLDTLSN 202

Query: 192 VRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVD 251
           VR +G+KVC GGI+GLGE   DR  +L+ LANL+  PES+PIN+L+ + G+   +   ++
Sbjct: 203 VRSAGMKVCSGGIVGLGEKAVDRSSLLIQLANLNPQPESVPINMLVKVEGTPLADIDDLE 262

Query: 252 PIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYN 311
             + +R I+VARI+MP S +RL+AGR  M++++QA+CF +GANSIF G  LLTA+NP  N
Sbjct: 263 SFDFIRCIAVARIMMPHSHVRLSAGRTAMNEQMQAMCFLAGANSIFYGCKLLTAENPETN 322

Query: 312 KDTILFNRLGLIPDLSA 328
           +D  LF +LG+  +  A
Sbjct: 323 QDIALFEKLGINTETVA 339


>gi|86143780|ref|ZP_01062156.1| Biotin synthase [Leeuwenhoekiella blandensis MED217]
 gi|85829823|gb|EAQ48285.1| Biotin synthase [Leeuwenhoekiella blandensis MED217]
          Length = 359

 Score =  317 bits (813), Expect = 1e-84,   Method: Composition-based stats.
 Identities = 148/311 (47%), Positives = 214/311 (68%), Gaps = 1/311 (0%)

Query: 16  PKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQS 75
              WT +E+ +IYN P  +LL+ + TVHR+  +PN +Q+S LL+IKTGGCPE+CGYC Q+
Sbjct: 2   RHNWTREEILEIYNKPLMELLYEAATVHREFHDPNTVQVSTLLSIKTGGCPEDCGYCPQA 61

Query: 76  VHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKE-RDLSIIVDMIKGVKS 134
               + ++ + L+ V QV  +A  AK  G++R CMGAAWR  K+  +   +++M++ +  
Sbjct: 62  ARYHTDIEGNDLMGVQQVKAQALRAKAAGSSRVCMGAAWRNVKDGEEFDQVLEMVRTINK 121

Query: 135 LGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRK 194
           L +E C TLGM++  QAQ L++AGL  YNHN+DTSE +Y  V +T  F+DRL T+ NVRK
Sbjct: 122 LDMEVCCTLGMITENQAQRLAEAGLYAYNHNLDTSEDYYKDVISTRAFQDRLDTIGNVRK 181

Query: 195 SGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIE 254
           + + VC GGI+G+GE ++DR  ML+ LA L   PES+PIN L+ + G+  E+ + +   E
Sbjct: 182 TNVTVCSGGIIGMGEKVEDRAGMLVALATLDPQPESVPINALVAVEGTPMEDIEPISIWE 241

Query: 255 HVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDT 314
            VR+++  RI+MP++++RL+AGR  MS E QA+CFF+GANSIF GD LLT  NP  N+D 
Sbjct: 242 MVRMVATTRIVMPQTQVRLSAGRTQMSREGQAMCFFAGANSIFAGDKLLTTPNPDVNEDM 301

Query: 315 ILFNRLGLIPD 325
            +F  LGL P 
Sbjct: 302 EMFKLLGLNPQ 312


>gi|109898872|ref|YP_662127.1| biotin synthase [Pseudoalteromonas atlantica T6c]
 gi|123064457|sp|Q15SR5|BIOB_PSEA6 RecName: Full=Biotin synthase
 gi|109701153|gb|ABG41073.1| biotin synthase [Pseudoalteromonas atlantica T6c]
          Length = 369

 Score =  317 bits (813), Expect = 1e-84,   Method: Composition-based stats.
 Identities = 163/316 (51%), Positives = 229/316 (72%)

Query: 12  PTKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGY 71
            ++    WT  EV  ++ MPFNDLLF +  VHR +F+PN++Q+S LL+IKTG CPE+C Y
Sbjct: 13  ASEVRHDWTLAEVNALFAMPFNDLLFKAQCVHRAHFDPNYVQVSTLLSIKTGACPEDCKY 72

Query: 72  CNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKG 131
           C QS    + L+  +L+ +++V++ A+ AK  G+TR+CMGAAWR PKERD+  + DM++ 
Sbjct: 73  CPQSARYDTGLEKERLMEIEKVIQRAREAKAAGSTRFCMGAAWRNPKERDMPYVTDMVRE 132

Query: 132 VKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLEN 191
           VK LGLETCMTLGML+ EQA  L +AGLDYYNHN+DTS  FY  + TT T++DRL TL+ 
Sbjct: 133 VKKLGLETCMTLGMLTREQAIALQQAGLDYYNHNLDTSPEFYGDIITTRTYQDRLNTLDA 192

Query: 192 VRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVD 251
           VR++G+ VC GGI+G+GE   DR  +L+ LANL   PES+PIN+L+ + G+  E  + +D
Sbjct: 193 VREAGMNVCSGGIVGMGETGSDRSGLLMQLANLEHQPESVPINMLVKVKGTPMENVEDLD 252

Query: 252 PIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYN 311
             E +R I+VARI+MPKS +RL+AGR  M++++QA+CF +GANSIF G  LLT  NP  +
Sbjct: 253 YFEFIRTIAVARIMMPKSFVRLSAGREAMNEQMQAMCFMAGANSIFYGCKLLTTSNPETH 312

Query: 312 KDTILFNRLGLIPDLS 327
           +D +LF +LG+    +
Sbjct: 313 EDVMLFKKLGINAKQT 328


>gi|254225505|ref|ZP_04919115.1| biotin synthase [Vibrio cholerae V51]
 gi|262402528|ref|ZP_06079089.1| biotin synthase [Vibrio sp. RC586]
 gi|125621975|gb|EAZ50299.1| biotin synthase [Vibrio cholerae V51]
 gi|262351310|gb|EEZ00443.1| biotin synthase [Vibrio sp. RC586]
          Length = 350

 Score =  317 bits (813), Expect = 1e-84,   Method: Composition-based stats.
 Identities = 165/313 (52%), Positives = 233/313 (74%)

Query: 16  PKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQS 75
              WT  EV  + + PF DLLF +  VHR +   NH+Q+S LL+IKTG CPE+C YC QS
Sbjct: 4   RHNWTVAEVKALLDKPFMDLLFEAQQVHRLHHPHNHVQVSTLLSIKTGACPEDCKYCPQS 63

Query: 76  VHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSL 135
            H ++ +   +L+ V++VL  A+ AK +G+TR+CMGAAW+ PKERD+ ++ +MI+GVK +
Sbjct: 64  AHYRTDVDKERLMEVERVLDAAQKAKNSGSTRFCMGAAWKNPKERDMPLLKEMIRGVKDM 123

Query: 136 GLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKS 195
           GLETCMTLGML+ +QAQ L++AGLDYYNHN+DTS  FY ++ TT T++DRL TL +VR +
Sbjct: 124 GLETCMTLGMLTPDQAQQLAQAGLDYYNHNLDTSPEFYGNIITTRTYQDRLDTLSHVRDA 183

Query: 196 GIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEH 255
           G+K+C GGI+G+GE  +DR  +L+ LANL T PES+PIN+L+ + G+  E+   V+P + 
Sbjct: 184 GMKICSGGIIGMGESTNDRAGLLVELANLPTHPESVPINMLVKVKGTPLEQVDDVEPFDF 243

Query: 256 VRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTI 315
           VR+I+VARI+MPKS +RL+AGR  M++++QALCF +GANSIF G  LLT  NP+ + D +
Sbjct: 244 VRLIAVARIMMPKSAVRLSAGREKMNEQMQALCFMAGANSIFYGCKLLTTPNPTEDSDML 303

Query: 316 LFNRLGLIPDLSA 328
           LF +LG+  +  A
Sbjct: 304 LFKKLGINREQVA 316


>gi|332285340|ref|YP_004417251.1| biotin synthase [Pusillimonas sp. T7-7]
 gi|330429293|gb|AEC20627.1| biotin synthase [Pusillimonas sp. T7-7]
          Length = 347

 Score =  317 bits (813), Expect = 1e-84,   Method: Composition-based stats.
 Identities = 162/308 (52%), Positives = 216/308 (70%)

Query: 16  PKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQS 75
           P+ W   ++ ++Y +PF DLL  +  VHR + +PN +QLS LL+IKTG CPE+C YC QS
Sbjct: 19  PQAWGIAQILRLYELPFLDLLHQAQAVHRAHHQPNTVQLSSLLSIKTGACPEDCAYCPQS 78

Query: 76  VHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSL 135
             + +  K   L+ V +VL+ A+ AK NGA R+CMGAAWR P  R L  +V+M+  VK+L
Sbjct: 79  ARHDTGGKQEALMPVAEVLEAARKAKANGAQRFCMGAAWRSPTARQLDSVVEMVGAVKAL 138

Query: 136 GLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKS 195
           GLETC+TLGML   QA+ L  AGLDYYNHN+DTS  FY ++ TT +++DRL TLE VR +
Sbjct: 139 GLETCVTLGMLKEGQAERLRDAGLDYYNHNLDTSPEFYGNIITTRSYQDRLDTLERVRNA 198

Query: 196 GIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEH 255
           G+ VCCGGI+GLGE   +R  ++  LANLS  PES+P+N L+ + G+  +    +DP E 
Sbjct: 199 GVHVCCGGIVGLGESRKERAGLVAQLANLSPYPESVPVNNLVKVAGTPLDATPDIDPFEF 258

Query: 256 VRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTI 315
           VR I+VARI MP++ +RL+AGR  MSD +QALCF +GANSIF G+ LLT  NP  ++D  
Sbjct: 259 VRTIAVARITMPRAVVRLSAGREAMSDAIQALCFMAGANSIFYGEQLLTTANPQLSQDQQ 318

Query: 316 LFNRLGLI 323
           LF RLGL 
Sbjct: 319 LFQRLGLT 326


>gi|86750442|ref|YP_486938.1| biotin synthase [Rhodopseudomonas palustris HaA2]
 gi|123003960|sp|Q2IUT3|BIOB_RHOP2 RecName: Full=Biotin synthase
 gi|86573470|gb|ABD08027.1| biotin synthase [Rhodopseudomonas palustris HaA2]
          Length = 353

 Score =  317 bits (813), Expect = 1e-84,   Method: Composition-based stats.
 Identities = 188/330 (56%), Positives = 247/330 (74%), Gaps = 2/330 (0%)

Query: 1   MSRSTVVPEENPTKK-PKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLN 59
           M+   +      T      WT ++   IYN+PF DL+F + T+HR++F+ N +Q ++LLN
Sbjct: 1   MNSIDLASLAAATPTLRHDWTREQAAAIYNLPFADLIFRAQTIHRQSFDANEVQCNQLLN 60

Query: 60  IKTGGCPENCGYCNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKE 119
           +KTGGC E+CGYC+QS H+ + L ASKL++  +V++ AK A++ GATRYCMGAAWR PK+
Sbjct: 61  VKTGGCAEDCGYCSQSAHHDTALPASKLMDPKKVIEGAKAARDAGATRYCMGAAWRSPKD 120

Query: 120 RDLSIIVDMIKGVKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTT 179
           RD++ +++M+KGVK+LG+E CMTLGML+ +QAQ L+ AGLDYYNHNIDTSE FY  V  +
Sbjct: 121 RDMAPVIEMVKGVKALGMEACMTLGMLTDDQAQQLADAGLDYYNHNIDTSEEFYSSVVKS 180

Query: 180 HTFEDRLQTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPI 239
            +F DRL TL  V+ +GIKVCCGGILGLGE   DR++ML TLANL   PES+PIN+LIPI
Sbjct: 181 RSFGDRLDTLATVQDAGIKVCCGGILGLGEKPTDRVEMLRTLANLPQHPESVPINMLIPI 240

Query: 240 PGSKFEE-NKKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFV 298
            G+   +  K VDP E VR I++ARI+MPKS +RLAAGR  MSDE+Q+LCF +GANSIF+
Sbjct: 241 EGTPIAKTAKPVDPFEFVRTIALARIMMPKSDVRLAAGRTAMSDEMQSLCFLAGANSIFI 300

Query: 299 GDTLLTAKNPSYNKDTILFNRLGLIPDLSA 328
           GDTLLT  NP  +KD +LF RLG+ P   A
Sbjct: 301 GDTLLTTPNPGDSKDRMLFARLGITPREGA 330


>gi|294627595|ref|ZP_06706178.1| biotin synthase BioB [Xanthomonas fuscans subsp. aurantifolii str.
           ICPB 11122]
 gi|294667205|ref|ZP_06732426.1| biotin synthase BioB [Xanthomonas fuscans subsp. aurantifolii str.
           ICPB 10535]
 gi|292598226|gb|EFF42380.1| biotin synthase BioB [Xanthomonas fuscans subsp. aurantifolii str.
           ICPB 11122]
 gi|292602986|gb|EFF46416.1| biotin synthase BioB [Xanthomonas fuscans subsp. aurantifolii str.
           ICPB 10535]
          Length = 344

 Score =  317 bits (812), Expect = 1e-84,   Method: Composition-based stats.
 Identities = 161/311 (51%), Positives = 220/311 (70%)

Query: 16  PKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQS 75
              W  KE+  ++++PF +LL  + +VHR +F+P  +Q+S LL++KTGGCPE+C YC Q+
Sbjct: 6   RHDWDRKELQALFDLPFPELLHRAASVHRAHFDPAQVQVSTLLSVKTGGCPEDCAYCPQA 65

Query: 76  VHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSL 135
               + + A KL+  ++V+ +A+ AK  GA+R+CMGAAWR PKERD+  +  MI+ VK++
Sbjct: 66  QRYDTGVSAQKLMETEEVVAKARQAKAAGASRFCMGAAWRSPKERDIPKVAAMIREVKAM 125

Query: 136 GLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKS 195
           GLETC TLGML   QA+ L  AGLDYYNHN+DT+  +Y  +  T  ++DRL TLE+VR  
Sbjct: 126 GLETCATLGMLDAGQARALKDAGLDYYNHNLDTAPDYYDSIIHTRQYQDRLNTLEHVRDV 185

Query: 196 GIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEH 255
           G+K CCGGI+G+GE  + RI +LL LA L   P+S+PIN L+ +PG+     +++DP E 
Sbjct: 186 GLKTCCGGIVGMGETREHRIGLLLALATLPAHPDSVPINQLVQVPGTPLHGTQQLDPFEF 245

Query: 256 VRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTI 315
           VR+I+VARI MPKS +RL+AGR  MSDELQALCF +GANSIF G+ LLT  NP   +D  
Sbjct: 246 VRMIAVARIAMPKSMVRLSAGREAMSDELQALCFLAGANSIFYGEKLLTTGNPDTERDQA 305

Query: 316 LFNRLGLIPDL 326
           LF RLGL P  
Sbjct: 306 LFQRLGLRPMQ 316


>gi|157961625|ref|YP_001501659.1| biotin synthase [Shewanella pealeana ATCC 700345]
 gi|254811576|sp|A8H3I7|BIOB_SHEPA RecName: Full=Biotin synthase
 gi|157846625|gb|ABV87124.1| biotin synthase [Shewanella pealeana ATCC 700345]
          Length = 350

 Score =  317 bits (812), Expect = 1e-84,   Method: Composition-based stats.
 Identities = 173/314 (55%), Positives = 230/314 (73%)

Query: 13  TKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYC 72
            +    W  +E+  ++ +P NDLLF +H++HR+ F+PN +Q+S+LL+IKTG CPE+C YC
Sbjct: 4   VQLRNNWKREEIEALFALPMNDLLFQAHSIHRQEFDPNEVQVSRLLSIKTGACPEDCKYC 63

Query: 73  NQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGV 132
            QS    + L+  +L+ ++ VL EA++AK  GA+R+CMGAAWR PKERD+  +  M++ V
Sbjct: 64  PQSARYDTGLEKERLLAMETVLTEARSAKAAGASRFCMGAAWRNPKERDMPYLKTMVEEV 123

Query: 133 KSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENV 192
           K+LG+ETCMTLGMLS EQA  L+ AGLDYYNHN+DTS  +Y  V TT T++ RL TL NV
Sbjct: 124 KALGMETCMTLGMLSAEQANTLADAGLDYYNHNLDTSPEYYGDVITTRTYQSRLDTLTNV 183

Query: 193 RKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDP 252
           R SG+KVC GGI+G+GE   DR  ++  LANL   P+S+PIN+L+ + G+ FE+   +DP
Sbjct: 184 RASGMKVCSGGIVGMGEKATDRAGLIQQLANLEQHPDSVPINMLVKVEGTPFEKLDDLDP 243

Query: 253 IEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNK 312
           +E VR I+VARI MPKSR+RL+AGR  MSDELQA+CFF+GANSIF G  LLT  NP  N 
Sbjct: 244 LEFVRTIAVARITMPKSRVRLSAGRENMSDELQAMCFFAGANSIFYGCKLLTTPNPEEND 303

Query: 313 DTILFNRLGLIPDL 326
           D  LF RLGL P+ 
Sbjct: 304 DMSLFKRLGLHPEQ 317


>gi|15890971|ref|NP_356643.1| biotin synthetase [Agrobacterium tumefaciens str. C58]
 gi|254810570|sp|A9CFX5|BIOB_AGRT5 RecName: Full=Biotin synthase
 gi|15159287|gb|AAK89428.1| biotin synthetase [Agrobacterium tumefaciens str. C58]
          Length = 339

 Score =  317 bits (812), Expect = 1e-84,   Method: Composition-based stats.
 Identities = 201/306 (65%), Positives = 247/306 (80%)

Query: 20  TSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQSVHNK 79
           + +E   IYN+PFNDLLF +  VHR +F+ N IQ+S+LL+IKTGGCPE+C YC+QS  N 
Sbjct: 23  SLEEAKIIYNLPFNDLLFRAQQVHRCHFDANAIQMSRLLSIKTGGCPEDCSYCSQSARNP 82

Query: 80  SKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLGLET 139
           + LKASKL+ V++VL EA+ AKE GATRYCMGAAWR PKERD+  +V M++GVK+L +ET
Sbjct: 83  TGLKASKLMEVERVLAEARKAKEGGATRYCMGAAWRNPKERDMEAVVAMVEGVKALDMET 142

Query: 140 CMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSGIKV 199
           CMTLGML+ EQ++ L+ AGLDYYNHN+DTSERFY  + TT TFEDRL+TL NVR +GIKV
Sbjct: 143 CMTLGMLTPEQSERLADAGLDYYNHNVDTSERFYSEIITTRTFEDRLETLANVRDAGIKV 202

Query: 200 CCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEHVRII 259
           C GGILG+GE ++DRI ML+TLANL  PPES+PIN+LIPIPGSK      VDPI+ VR I
Sbjct: 203 CAGGILGMGETVEDRISMLVTLANLPVPPESVPINMLIPIPGSKLANADPVDPIDFVRTI 262

Query: 260 SVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTILFNR 319
           ++ARILMP+S +RL+AGR  MSDE QALCF +GANSIF+G+TLLTA NP  + DT LF R
Sbjct: 263 ALARILMPRSHVRLSAGRTEMSDETQALCFLAGANSIFIGETLLTADNPGEDHDTALFRR 322

Query: 320 LGLIPD 325
           LGL P 
Sbjct: 323 LGLKPM 328


>gi|83718411|ref|YP_440895.1| biotin synthase [Burkholderia thailandensis E264]
 gi|167579599|ref|ZP_02372473.1| biotin synthase [Burkholderia thailandensis TXDOH]
 gi|167617682|ref|ZP_02386313.1| biotin synthase [Burkholderia thailandensis Bt4]
 gi|257140452|ref|ZP_05588714.1| biotin synthase [Burkholderia thailandensis E264]
 gi|83652236|gb|ABC36299.1| biotin synthase [Burkholderia thailandensis E264]
          Length = 339

 Score =  317 bits (812), Expect = 2e-84,   Method: Composition-based stats.
 Identities = 174/319 (54%), Positives = 226/319 (70%), Gaps = 2/319 (0%)

Query: 4   STVVPEENPTKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTG 63
           +T  P   P      W   +V  +Y +PFNDLLF +   HR++F+ N IQLS LL+IKTG
Sbjct: 13  TTETPVAAPVAP--RWRVADVIALYELPFNDLLFRAQQTHREHFDANAIQLSTLLSIKTG 70

Query: 64  GCPENCGYCNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLS 123
           GC E+CGYC+QS H+ + LKA KL+ VD VL  A+ AKENGATR+CMGAAWR PK+R + 
Sbjct: 71  GCEEDCGYCSQSAHHDTGLKAEKLMEVDAVLAAARTAKENGATRFCMGAAWRNPKDRHIE 130

Query: 124 IIVDMIKGVKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFE 183
            I +MI+GVK +GLETC+TLGML   QA+ L++AGLDYYNHN+DTS  FY  + +T T++
Sbjct: 131 PIKEMIRGVKDMGLETCVTLGMLEEHQAKALAEAGLDYYNHNLDTSPEFYGQIISTRTYQ 190

Query: 184 DRLQTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSK 243
           DRL TLE VR +GI VCCGGI+G+GE   +R  ++  LAN++  PES+PIN L+ I G+ 
Sbjct: 191 DRLDTLERVRDAGINVCCGGIIGMGESRRERAGLIAQLANMNPYPESVPINNLVAIEGTP 250

Query: 244 FEENKKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLL 303
            E  + +DP E VR I+VARI MPK+ +RL+AGR  + D +QALCF +GANS+F GD LL
Sbjct: 251 LENAQALDPFEFVRTIAVARITMPKAMVRLSAGREQLDDSMQALCFLAGANSMFYGDVLL 310

Query: 304 TAKNPSYNKDTILFNRLGL 322
           T  NP    D  L  RLG+
Sbjct: 311 TTGNPRAEADRKLLARLGM 329


>gi|229525723|ref|ZP_04415128.1| biotin synthase [Vibrio cholerae bv. albensis VL426]
 gi|229339304|gb|EEO04321.1| biotin synthase [Vibrio cholerae bv. albensis VL426]
          Length = 350

 Score =  317 bits (812), Expect = 2e-84,   Method: Composition-based stats.
 Identities = 165/313 (52%), Positives = 233/313 (74%)

Query: 16  PKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQS 75
              WT  EV  + + PF DLLF +  VHR +   NH+Q+S LL+IKTG CPE+C YC QS
Sbjct: 4   RHNWTVAEVKALLDKPFMDLLFEAQQVHRLHHPHNHVQVSTLLSIKTGACPEDCKYCPQS 63

Query: 76  VHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSL 135
            H ++ +   +L+ V++VL  A+ AK +G+TR+CMGAAW+ PKERD+ ++ +MI+GVK +
Sbjct: 64  AHYRTDVDKERLMEVERVLDAAQKAKTSGSTRFCMGAAWKNPKERDMPLLKEMIRGVKDM 123

Query: 136 GLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKS 195
           GLETCMTLGML+ +QAQ L++AGLDYYNHN+DTS  FY ++ TT T++DRL TL +VR +
Sbjct: 124 GLETCMTLGMLTPDQAQQLAQAGLDYYNHNLDTSPEFYGNIITTRTYQDRLDTLSHVRDA 183

Query: 196 GIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEH 255
           G+K+C GGI+G+GE  +DR  +L+ LANL T PES+PIN+L+ + G+  E+   V+P + 
Sbjct: 184 GMKICSGGIIGMGESTNDRAGLLVELANLPTHPESVPINMLVKVKGTPLEQVDDVEPFDF 243

Query: 256 VRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTI 315
           VR+I+VARI+MPKS +RL+AGR  M++++QALCF +GANSIF G  LLT  NP+ + D +
Sbjct: 244 VRLIAVARIMMPKSAVRLSAGREKMNEQMQALCFMAGANSIFYGCKLLTTPNPAEDSDML 303

Query: 316 LFNRLGLIPDLSA 328
           LF +LG+  +  A
Sbjct: 304 LFKKLGINREQVA 316


>gi|229520456|ref|ZP_04409881.1| biotin synthase [Vibrio cholerae TM 11079-80]
 gi|229342554|gb|EEO07547.1| biotin synthase [Vibrio cholerae TM 11079-80]
          Length = 350

 Score =  317 bits (812), Expect = 2e-84,   Method: Composition-based stats.
 Identities = 165/313 (52%), Positives = 232/313 (74%)

Query: 16  PKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQS 75
              WT  EV  + + PF DLLF +  VHR +   NH+Q+S LL+IKTG CPE+C YC QS
Sbjct: 4   RHNWTVAEVKALLDKPFMDLLFEAQQVHRLHHPHNHVQVSTLLSIKTGACPEDCKYCPQS 63

Query: 76  VHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSL 135
            H ++ +   +L+ V++VL  A+ AK +G+TR+CMGAAW+ PKERD+ ++ +MI+GVK +
Sbjct: 64  AHYRTDVDKERLMEVERVLDAAQKAKNSGSTRFCMGAAWKNPKERDMPLLKEMIRGVKDM 123

Query: 136 GLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKS 195
           GLETCMTLGML+  QAQ L++AGLDYYNHN+DTS  FY ++ TT T++DRL TL +VR +
Sbjct: 124 GLETCMTLGMLTPVQAQQLAQAGLDYYNHNLDTSPEFYGNIITTRTYQDRLDTLSHVRDA 183

Query: 196 GIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEH 255
           G+K+C GGI+G+GE  +DR  +L+ LANL T PES+PIN+L+ + G+  E+   V+P + 
Sbjct: 184 GMKICSGGIIGMGESTNDRAGLLVELANLPTHPESVPINMLVKVKGTPLEQVDDVEPFDF 243

Query: 256 VRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTI 315
           VR+I+VARI+MPKS +RL+AGR  M++++QALCF +GANSIF G  LLT  NP+ + D +
Sbjct: 244 VRLIAVARIMMPKSAVRLSAGREKMNEQMQALCFMAGANSIFYGCKLLTTPNPAEDSDML 303

Query: 316 LFNRLGLIPDLSA 328
           LF +LG+  +  A
Sbjct: 304 LFKKLGINREQVA 316


>gi|307728265|ref|YP_003905489.1| biotin synthase [Burkholderia sp. CCGE1003]
 gi|307582800|gb|ADN56198.1| biotin synthase [Burkholderia sp. CCGE1003]
          Length = 364

 Score =  317 bits (812), Expect = 2e-84,   Method: Composition-based stats.
 Identities = 169/308 (54%), Positives = 222/308 (72%)

Query: 18  VWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQSVH 77
            W   ++  +Y +PFNDL+F +   HR++F+ N +QLS LL+IKTGGC E+C YC QSVH
Sbjct: 38  RWRVADIVALYELPFNDLMFRAQQTHREHFDANTVQLSTLLSIKTGGCEEDCAYCPQSVH 97

Query: 78  NKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLGL 137
           + + L+A KL+ VD+VL  AK AKENGATR+CMGAAWR PK+R L  I DMI+GVK++GL
Sbjct: 98  HDTGLQADKLMPVDEVLAAAKAAKENGATRFCMGAAWRNPKDRHLEPIKDMIRGVKAMGL 157

Query: 138 ETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSGI 197
           ETC+TLGML   QAQ L +AGLDYYNHN+DTS  FY  + +T T++DRL TLE VR +GI
Sbjct: 158 ETCVTLGMLETHQAQALREAGLDYYNHNLDTSPEFYGQIISTRTYQDRLDTLERVRDAGI 217

Query: 198 KVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEHVR 257
            VCCGGI+GLGE   +R  ++  LAN+   PES+PIN L+ + G+     + +DP E VR
Sbjct: 218 NVCCGGIVGLGESRRERAGLIAQLANMDPYPESVPINNLVQVEGTPLTGTEAIDPFEFVR 277

Query: 258 IISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTILF 317
            I++ARI MP++ +RL+AGR  M + LQA+CF +GANSIF GD LLT  NP    D  L 
Sbjct: 278 TIAIARITMPRAMVRLSAGREQMDEALQAMCFLAGANSIFYGDQLLTTSNPQAEADRKLL 337

Query: 318 NRLGLIPD 325
           +RLG+  +
Sbjct: 338 SRLGIRAE 345


>gi|289668157|ref|ZP_06489232.1| biotin synthase [Xanthomonas campestris pv. musacearum NCPPB4381]
          Length = 481

 Score =  317 bits (812), Expect = 2e-84,   Method: Composition-based stats.
 Identities = 162/311 (52%), Positives = 221/311 (71%)

Query: 16  PKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQS 75
              W  KE+  ++++PF +LL  + +VHR +F+P  +Q+S LL++KTGGCPE+C YC Q+
Sbjct: 6   RHDWDHKELQSLFDLPFPELLHRAASVHRAHFDPAEVQVSTLLSVKTGGCPEDCAYCPQA 65

Query: 76  VHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSL 135
               + + A KL+  ++V+ +A+ AK  GA+R+CMGAAWR PKERD+  +  MI+ VK++
Sbjct: 66  QRYDTGVTAQKLMETEEVVAKARQAKAAGASRFCMGAAWRSPKERDIPKVAAMIREVKAM 125

Query: 136 GLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKS 195
           GLETC TLGML   QA+ L  AGLDYYNHN+DT+  +Y  +  T  ++DRL TLE+VR  
Sbjct: 126 GLETCATLGMLDAGQARALKDAGLDYYNHNLDTAPDYYDSIIHTRQYQDRLNTLEHVRDV 185

Query: 196 GIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEH 255
           G+K CCGGI+G+GE  D RI +LL LA L   P+S+PIN L+ +PG+     +++DP E 
Sbjct: 186 GLKTCCGGIVGMGETRDHRIGLLLALATLPAHPDSVPINQLVQVPGTPLHGTQQLDPFEF 245

Query: 256 VRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTI 315
           VR+I+VARI+MPKS +RL+AGR  MSDELQALCF +GANSIF G+ LLT  NP   +D  
Sbjct: 246 VRMIAVARIVMPKSMVRLSAGREAMSDELQALCFLAGANSIFYGEKLLTTGNPDTERDQA 305

Query: 316 LFNRLGLIPDL 326
           LF RLGL P  
Sbjct: 306 LFQRLGLRPMQ 316


>gi|295675282|ref|YP_003603806.1| biotin synthase [Burkholderia sp. CCGE1002]
 gi|295435125|gb|ADG14295.1| biotin synthase [Burkholderia sp. CCGE1002]
          Length = 366

 Score =  317 bits (811), Expect = 2e-84,   Method: Composition-based stats.
 Identities = 168/308 (54%), Positives = 219/308 (71%)

Query: 18  VWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQSVH 77
            W   ++  +Y +PFNDLLF +   HR++F+ N +QLS LL+IKTGGC E+C YC QSVH
Sbjct: 32  RWRVADIVALYELPFNDLLFRAQQTHREHFDANAVQLSTLLSIKTGGCEEDCAYCPQSVH 91

Query: 78  NKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLGL 137
           + + L A KL+ VD+VL  AK AK+NGATR+CMGAAWR PK+R L  I DMI+GVK++GL
Sbjct: 92  HDTGLAADKLMPVDEVLAAAKLAKDNGATRFCMGAAWRNPKDRHLEPIKDMIRGVKAMGL 151

Query: 138 ETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSGI 197
           ETC+TLGML   QAQ L  AGLDYYNHN+DTS  FY  + +T T++DRL TLE VR +GI
Sbjct: 152 ETCVTLGMLETHQAQALRDAGLDYYNHNLDTSPEFYGQIISTRTYQDRLDTLERVRDAGI 211

Query: 198 KVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEHVR 257
            VCCGGI+G+GE   +R  ++  LAN+   PES+PIN L+ + G+     + +DP E VR
Sbjct: 212 NVCCGGIVGMGESRRERAGLIAQLANMEPYPESVPINNLVQVQGTPLTGTEPIDPFEFVR 271

Query: 258 IISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTILF 317
            I++ARI MP++ +RL+AGR  M + LQA+CF +GANSIF GD LLT  NP    D  L 
Sbjct: 272 TIAIARITMPRAMVRLSAGREQMDEALQAMCFLAGANSIFYGDQLLTTSNPQAEADRQLL 331

Query: 318 NRLGLIPD 325
            RLG+  +
Sbjct: 332 ARLGIRAE 339


>gi|307824521|ref|ZP_07654746.1| biotin synthase [Methylobacter tundripaludum SV96]
 gi|307734505|gb|EFO05357.1| biotin synthase [Methylobacter tundripaludum SV96]
          Length = 322

 Score =  317 bits (811), Expect = 2e-84,   Method: Composition-based stats.
 Identities = 173/306 (56%), Positives = 226/306 (73%)

Query: 16  PKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQS 75
              W   EV  +Y +PFNDL+F + TVHR+NF+PN +Q+S LL+IKTG C E+CGYC QS
Sbjct: 8   RHDWQLDEVQALYALPFNDLIFKAQTVHRENFDPNEVQISSLLSIKTGSCSEDCGYCPQS 67

Query: 76  VHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSL 135
               S L    L+ VD VLK A+ AK+ GA+R+CMGAAWR+PK+RD+  +V+M++GVK+L
Sbjct: 68  ARYDSDLTPEALMPVDAVLKAAQLAKDQGASRFCMGAAWRQPKDRDVERVVEMVQGVKAL 127

Query: 136 GLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKS 195
           G+ETC+TLGML+  Q   L + GLDYYNHN+DTSE +Y  V TT T++DRL TL  VR +
Sbjct: 128 GMETCVTLGMLTDAQTARLKEGGLDYYNHNLDTSEDYYSEVITTRTYQDRLDTLARVRDA 187

Query: 196 GIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEH 255
           GI VCCGGI+G+GE   DR ++L+ LANL   PES+P+N+L+ + G+     + +DPI  
Sbjct: 188 GINVCCGGIVGMGESDVDRANLLIELANLPKHPESVPVNMLVQVEGTPLMGTESLDPIIF 247

Query: 256 VRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTI 315
           +R I+VARI+MPKSR+RL+AGR  MSDE+QALCF +GANSIF GD LLT  NP  N D  
Sbjct: 248 IRTIAVARIMMPKSRVRLSAGRNNMSDEMQALCFLAGANSIFYGDKLLTTDNPMTNHDLA 307

Query: 316 LFNRLG 321
           LF+RLG
Sbjct: 308 LFDRLG 313


>gi|167624399|ref|YP_001674693.1| biotin synthase [Shewanella halifaxensis HAW-EB4]
 gi|254811574|sp|B0TJN8|BIOB_SHEHH RecName: Full=Biotin synthase
 gi|167354421|gb|ABZ77034.1| biotin synthase [Shewanella halifaxensis HAW-EB4]
          Length = 350

 Score =  317 bits (811), Expect = 2e-84,   Method: Composition-based stats.
 Identities = 173/314 (55%), Positives = 230/314 (73%)

Query: 13  TKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYC 72
            +    W  +E+  ++ +P NDLLF +H++HR+ F+PN +Q+S+LL+IKTG CPE+C YC
Sbjct: 4   VQLRNNWKREEIESLFALPMNDLLFQAHSIHRQEFDPNEVQISRLLSIKTGACPEDCKYC 63

Query: 73  NQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGV 132
            QS    + L+  +L+ ++ VL EA++AK  GA+R+CMGAAWR PKERD+  +  M++ V
Sbjct: 64  PQSARYDTGLEKERLLAMETVLTEARSAKAAGASRFCMGAAWRNPKERDMPYLKTMVEEV 123

Query: 133 KSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENV 192
           K+LG+ETCMTLGMLS EQA  L+ AGLDYYNHN+DTS  +Y  V TT T++ RL TL NV
Sbjct: 124 KALGMETCMTLGMLSAEQANTLADAGLDYYNHNLDTSPEYYGDVITTRTYQSRLDTLSNV 183

Query: 193 RKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDP 252
           R SG+KVC GGI+G+GE   DR  ++  LANL   P+S+PIN+L+ + G+ FE+   +DP
Sbjct: 184 RASGMKVCSGGIVGMGEKATDRAGLIQQLANLDQHPDSVPINMLVKVEGTPFEKLDDLDP 243

Query: 253 IEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNK 312
           +E VR I+VARI MPKSR+RL+AGR  MSDELQA+CFF+GANSIF G  LLT  NP  N 
Sbjct: 244 LEFVRTIAVARITMPKSRVRLSAGRENMSDELQAMCFFAGANSIFYGCKLLTTPNPEEND 303

Query: 313 DTILFNRLGLIPDL 326
           D  LF RLGL P+ 
Sbjct: 304 DMGLFRRLGLHPEQ 317


>gi|91976588|ref|YP_569247.1| biotin synthase [Rhodopseudomonas palustris BisB5]
 gi|123721908|sp|Q138Z3|BIOB_RHOPS RecName: Full=Biotin synthase
 gi|91683044|gb|ABE39346.1| biotin synthase [Rhodopseudomonas palustris BisB5]
          Length = 342

 Score =  317 bits (811), Expect = 2e-84,   Method: Composition-based stats.
 Identities = 186/311 (59%), Positives = 240/311 (77%), Gaps = 1/311 (0%)

Query: 16  PKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQS 75
              WT +E   IY+ PF DL+F + T+HR++F+ N +Q ++LLN+KTGGC E+CGYC+QS
Sbjct: 21  RHNWTREEAAAIYHAPFADLIFRAQTIHRQSFDANAVQCNQLLNVKTGGCAEDCGYCSQS 80

Query: 76  VHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSL 135
            H+ + L ASKL++  +V++ AK A++ GATRYCMGAAWR PK+RD++ +++M+KGVK+L
Sbjct: 81  SHHDTALPASKLMDPAKVIEGAKAARDAGATRYCMGAAWRSPKDRDMAPVIEMVKGVKAL 140

Query: 136 GLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKS 195
           G+E CMTLGML+ +QA+ L+ AGLDYYNHNIDTSE FY  V  T +F DRL+TLE V+ +
Sbjct: 141 GMEACMTLGMLTDDQAKQLADAGLDYYNHNIDTSEEFYSSVVKTRSFGDRLETLEKVQDA 200

Query: 196 GIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKF-EENKKVDPIE 254
           GIKVCCGGILGLGE   DR++ML TLANL   PES+PIN+LIPI G+        VDP E
Sbjct: 201 GIKVCCGGILGLGEKPTDRVEMLRTLANLPQHPESVPINMLIPIEGTPIAATATPVDPFE 260

Query: 255 HVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDT 314
            VR I++ARI+MPKS +RLAAGR  MSDE+QALCF +GANSIF+GDTLLT  NP  +KD 
Sbjct: 261 FVRTIALARIMMPKSDVRLAAGRTAMSDEMQALCFLAGANSIFIGDTLLTTPNPGDSKDR 320

Query: 315 ILFNRLGLIPD 325
            LF RLG+ P 
Sbjct: 321 ALFARLGITPR 331


>gi|15641125|ref|NP_230757.1| biotin synthase [Vibrio cholerae O1 biovar El Tor str. N16961]
 gi|121591284|ref|ZP_01678579.1| biotin synthase [Vibrio cholerae 2740-80]
 gi|121726271|ref|ZP_01679561.1| biotin synthase [Vibrio cholerae V52]
 gi|147673516|ref|YP_001216580.1| biotin synthase [Vibrio cholerae O395]
 gi|153213568|ref|ZP_01948858.1| biotin synthase [Vibrio cholerae 1587]
 gi|153816955|ref|ZP_01969622.1| biotin synthase [Vibrio cholerae NCTC 8457]
 gi|153823821|ref|ZP_01976488.1| biotin synthase [Vibrio cholerae B33]
 gi|153824925|ref|ZP_01977592.1| biotin synthase [Vibrio cholerae MZO-2]
 gi|153828144|ref|ZP_01980811.1| biotin synthase [Vibrio cholerae 623-39]
 gi|227081285|ref|YP_002809836.1| biotin synthase [Vibrio cholerae M66-2]
 gi|229505293|ref|ZP_04394803.1| biotin synthase [Vibrio cholerae BX 330286]
 gi|229511037|ref|ZP_04400516.1| biotin synthase [Vibrio cholerae B33]
 gi|229518158|ref|ZP_04407602.1| biotin synthase [Vibrio cholerae RC9]
 gi|229529799|ref|ZP_04419189.1| biotin synthase [Vibrio cholerae 12129(1)]
 gi|229608312|ref|YP_002878960.1| biotin synthase [Vibrio cholerae MJ-1236]
 gi|254291535|ref|ZP_04962326.1| biotin synthase [Vibrio cholerae AM-19226]
 gi|254848241|ref|ZP_05237591.1| biotin synthase [Vibrio cholerae MO10]
 gi|255745524|ref|ZP_05419472.1| biotin synthase [Vibrio cholera CIRS 101]
 gi|262158402|ref|ZP_06029518.1| biotin synthase [Vibrio cholerae INDRE 91/1]
 gi|262170264|ref|ZP_06037951.1| biotin synthase [Vibrio cholerae RC27]
 gi|81623161|sp|Q9KSZ4|BIOB_VIBCH RecName: Full=Biotin synthase
 gi|257096241|sp|A5F2H3|BIOB_VIBC3 RecName: Full=Biotin synthase
 gi|9655583|gb|AAF94271.1| biotin synthase [Vibrio cholerae O1 biovar El Tor str. N16961]
 gi|121546868|gb|EAX57026.1| biotin synthase [Vibrio cholerae 2740-80]
 gi|121631217|gb|EAX63590.1| biotin synthase [Vibrio cholerae V52]
 gi|124115904|gb|EAY34724.1| biotin synthase [Vibrio cholerae 1587]
 gi|126512542|gb|EAZ75136.1| biotin synthase [Vibrio cholerae NCTC 8457]
 gi|126518656|gb|EAZ75879.1| biotin synthase [Vibrio cholerae B33]
 gi|146315399|gb|ABQ19938.1| biotin synthase [Vibrio cholerae O395]
 gi|148876386|gb|EDL74521.1| biotin synthase [Vibrio cholerae 623-39]
 gi|149741437|gb|EDM55467.1| biotin synthase [Vibrio cholerae MZO-2]
 gi|150422599|gb|EDN14555.1| biotin synthase [Vibrio cholerae AM-19226]
 gi|227009173|gb|ACP05385.1| biotin synthase [Vibrio cholerae M66-2]
 gi|227012927|gb|ACP09137.1| biotin synthase [Vibrio cholerae O395]
 gi|229333573|gb|EEN99059.1| biotin synthase [Vibrio cholerae 12129(1)]
 gi|229344873|gb|EEO09847.1| biotin synthase [Vibrio cholerae RC9]
 gi|229351002|gb|EEO15943.1| biotin synthase [Vibrio cholerae B33]
 gi|229357516|gb|EEO22433.1| biotin synthase [Vibrio cholerae BX 330286]
 gi|229370967|gb|ACQ61390.1| biotin synthase [Vibrio cholerae MJ-1236]
 gi|254843946|gb|EET22360.1| biotin synthase [Vibrio cholerae MO10]
 gi|255736599|gb|EET91996.1| biotin synthase [Vibrio cholera CIRS 101]
 gi|262021279|gb|EEY39993.1| biotin synthase [Vibrio cholerae RC27]
 gi|262029843|gb|EEY48491.1| biotin synthase [Vibrio cholerae INDRE 91/1]
 gi|327483817|gb|AEA78224.1| Biotin synthase [Vibrio cholerae LMA3894-4]
          Length = 350

 Score =  317 bits (811), Expect = 2e-84,   Method: Composition-based stats.
 Identities = 165/313 (52%), Positives = 233/313 (74%)

Query: 16  PKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQS 75
              WT  EV  + + PF DLLF +  VHR +   NH+Q+S LL+IKTG CPE+C YC QS
Sbjct: 4   RHNWTVAEVKALLDKPFMDLLFEAQQVHRLHHPHNHVQVSTLLSIKTGACPEDCKYCPQS 63

Query: 76  VHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSL 135
            H ++ +   +L+ V++VL  A+ AK +G+TR+CMGAAW+ PKERD+ ++ +MI+GVK +
Sbjct: 64  AHYRTDVDKERLMEVERVLDAAQKAKNSGSTRFCMGAAWKNPKERDMPLLKEMIRGVKDM 123

Query: 136 GLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKS 195
           GLETCMTLGML+ +QAQ L++AGLDYYNHN+DTS  FY ++ TT T++DRL TL +VR +
Sbjct: 124 GLETCMTLGMLTPDQAQQLAQAGLDYYNHNLDTSPEFYGNIITTRTYQDRLDTLSHVRDA 183

Query: 196 GIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEH 255
           G+K+C GGI+G+GE  +DR  +L+ LANL T PES+PIN+L+ + G+  E+   V+P + 
Sbjct: 184 GMKICSGGIIGMGESTNDRAGLLVELANLPTHPESVPINMLVKVKGTPLEQVDDVEPFDF 243

Query: 256 VRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTI 315
           VR+I+VARI+MPKS +RL+AGR  M++++QALCF +GANSIF G  LLT  NP+ + D +
Sbjct: 244 VRLIAVARIMMPKSAVRLSAGREKMNEQMQALCFMAGANSIFYGCKLLTTPNPAEDSDML 303

Query: 316 LFNRLGLIPDLSA 328
           LF +LG+  +  A
Sbjct: 304 LFKKLGINREQVA 316


>gi|262370303|ref|ZP_06063629.1| biotin synthase [Acinetobacter johnsonii SH046]
 gi|262314645|gb|EEY95686.1| biotin synthase [Acinetobacter johnsonii SH046]
          Length = 329

 Score =  317 bits (811), Expect = 2e-84,   Method: Composition-based stats.
 Identities = 169/310 (54%), Positives = 227/310 (73%)

Query: 16  PKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQS 75
              WT +E+  +Y+ PF DL+F + TVHR++F+ N IQ+S LL+IKTG CPE+C YC+QS
Sbjct: 4   RNDWTREEIEALYDQPFLDLVFQAQTVHRQHFQANTIQVSTLLSIKTGKCPEDCKYCSQS 63

Query: 76  VHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSL 135
               SKL+A K I VD+V+ EAK A  +G++R+CMGAAWR P ERD+  +++M+K VK+L
Sbjct: 64  ARYDSKLEAEKRIAVDKVISEAKEALASGSSRFCMGAAWRNPHERDMPYVLEMVKEVKAL 123

Query: 136 GLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKS 195
           GLETCMTLGML+  QA  L  AGLDYYNHN+DTS  +Y H+ +T TF+DRL TLE VR++
Sbjct: 124 GLETCMTLGMLNESQAGRLKDAGLDYYNHNLDTSREYYSHIISTRTFDDRLNTLEYVRQA 183

Query: 196 GIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEH 255
           G+KVC GGI+GLGE  +DRI +L  LA +   PES+PIN+L+PI G+   + +K+D  E 
Sbjct: 184 GMKVCSGGIVGLGEKKEDRIGLLQELATMPIHPESVPINMLVPIEGTPLADVEKLDVTEW 243

Query: 256 VRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTI 315
           +R I+VARI+MP S +RL+AGR  +SD  QAL F +GANS+F G+ LLT  N    KD  
Sbjct: 244 IRTIAVARIIMPHSYIRLSAGREALSDSDQALAFMAGANSLFSGEKLLTTPNAGEGKDRQ 303

Query: 316 LFNRLGLIPD 325
           LF +LGL+ +
Sbjct: 304 LFTKLGLVAE 313


>gi|262372762|ref|ZP_06066041.1| biotin synthase [Acinetobacter junii SH205]
 gi|262312787|gb|EEY93872.1| biotin synthase [Acinetobacter junii SH205]
          Length = 333

 Score =  317 bits (811), Expect = 2e-84,   Method: Composition-based stats.
 Identities = 167/310 (53%), Positives = 231/310 (74%)

Query: 16  PKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQS 75
              WT  E+  +Y+ PF DL+F +  VHR++F+ N IQ+S LL+IKTG CPE+C YC+QS
Sbjct: 8   RNDWTRDEIQALYDQPFLDLVFEAQRVHRQHFQANTIQVSTLLSIKTGKCPEDCKYCSQS 67

Query: 76  VHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSL 135
            H  SKL+A K I VD+V++EA +AKE+G++R+CMGAAWR P ERD+  +++M++ VK+L
Sbjct: 68  AHYDSKLEAEKRIAVDKVIREAISAKESGSSRFCMGAAWRNPHERDMPYVLEMVREVKAL 127

Query: 136 GLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKS 195
           GLETCMTLGML+  QA+ L  AGLDYYNHN+DTS  +Y H+ +T +F+DRL TL++VR++
Sbjct: 128 GLETCMTLGMLNQSQAERLKDAGLDYYNHNLDTSREYYSHIISTRSFDDRLNTLDHVRQA 187

Query: 196 GIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEH 255
           G+KVC GGI+GLGE  +DRI +L  L+ +   PES+PIN+L+PI G+   + +K+D  E 
Sbjct: 188 GMKVCSGGIVGLGETRNDRIGLLHELSTMPVHPESVPINMLVPIEGTPLADVEKLDVTEW 247

Query: 256 VRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTI 315
           +R I+VARI+MP S +RL+AGR  +SD  QAL F +GANS+F GD LLT  N    KD +
Sbjct: 248 IRTIAVARIIMPHSYIRLSAGRESLSDSDQALAFMAGANSLFSGDKLLTTPNAGEGKDQV 307

Query: 316 LFNRLGLIPD 325
           LF +LGL  +
Sbjct: 308 LFAKLGLTAE 317


>gi|262165388|ref|ZP_06033125.1| biotin synthase [Vibrio mimicus VM223]
 gi|262025104|gb|EEY43772.1| biotin synthase [Vibrio mimicus VM223]
          Length = 350

 Score =  317 bits (811), Expect = 2e-84,   Method: Composition-based stats.
 Identities = 166/313 (53%), Positives = 233/313 (74%)

Query: 16  PKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQS 75
              WT  EV  + + PF DLLF +  VHR +   NH+Q+S LL+IKTG CPE+C YC QS
Sbjct: 4   RHNWTVAEVKALLDKPFMDLLFEAQQVHRLHHPHNHVQVSTLLSIKTGACPEDCKYCPQS 63

Query: 76  VHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSL 135
            H ++ +   +L+ V++VL  A+ AK +G+TR+CMGAAW+ PKERD+ ++ +MI+GVK +
Sbjct: 64  AHYRTDVDKERLMEVERVLDAAQKAKTSGSTRFCMGAAWKNPKERDMPLLKEMIRGVKDM 123

Query: 136 GLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKS 195
           GLETCMTLGML+ +QAQ L+ AGLDYYNHN+DTS  +Y ++ TT T++DRL TL +VR +
Sbjct: 124 GLETCMTLGMLTPDQAQQLADAGLDYYNHNLDTSPEYYGNIITTRTYQDRLDTLSHVRDA 183

Query: 196 GIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEH 255
           G+K+C GGI+G+GE  +DR  +L+ LANLST PES+PIN+L+ + G+  E+   VDP + 
Sbjct: 184 GMKICSGGIIGMGESTNDRAGLLVELANLSTHPESVPINMLVKVKGTPLEQVDDVDPFDF 243

Query: 256 VRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTI 315
           VR+I+VARI+MPKS +RL+AGR  M++++QALCF +GANSIF G  LLT  NP+ + D +
Sbjct: 244 VRLIAVARIMMPKSAVRLSAGREKMNEQMQALCFMAGANSIFYGCKLLTTPNPAEDSDML 303

Query: 316 LFNRLGLIPDLSA 328
           LF +LG+  +  A
Sbjct: 304 LFKKLGINREQVA 316


>gi|229515494|ref|ZP_04404953.1| biotin synthase [Vibrio cholerae TMA 21]
 gi|229347263|gb|EEO12223.1| biotin synthase [Vibrio cholerae TMA 21]
          Length = 350

 Score =  317 bits (811), Expect = 2e-84,   Method: Composition-based stats.
 Identities = 164/313 (52%), Positives = 233/313 (74%)

Query: 16  PKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQS 75
              WT  EV  + + PF DLLF +  VHR +   NH+Q+S LL+IKTG CPE+C YC QS
Sbjct: 4   RHNWTVAEVKALLDKPFMDLLFEAQQVHRLHHPHNHVQVSTLLSIKTGACPEDCKYCPQS 63

Query: 76  VHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSL 135
            H ++ +   +L+ V++VL  A+ AK +G+TR+CMGAAW+ PKERD+ ++ +MI+GVK +
Sbjct: 64  AHYRTDVDKERLMEVERVLDAAQKAKTSGSTRFCMGAAWKNPKERDMPLLKEMIRGVKGM 123

Query: 136 GLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKS 195
           GLETCMTLGML+ +QAQ L++AGLDYYNHN+DTS  +Y ++ TT T++DRL TL +VR +
Sbjct: 124 GLETCMTLGMLTPDQAQQLAQAGLDYYNHNLDTSPEYYGNIITTRTYQDRLDTLSHVRDA 183

Query: 196 GIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEH 255
           G+K+C GGI+G+GE  +DR  +L+ LANL T PES+PIN+L+ + G+  E+   V+P + 
Sbjct: 184 GMKICSGGIIGMGESTNDRAGLLVELANLPTHPESVPINMLVKVKGTPLEQVDDVEPFDF 243

Query: 256 VRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTI 315
           VR+I+VARI+MPKS +RL+AGR  M++++QALCF +GANSIF G  LLT  NP+ + D +
Sbjct: 244 VRLIAVARIMMPKSAVRLSAGREKMNEQMQALCFMAGANSIFYGCKLLTTPNPAEDSDML 303

Query: 316 LFNRLGLIPDLSA 328
           LF +LG+  +  A
Sbjct: 304 LFKKLGINREQVA 316


>gi|332716723|ref|YP_004444189.1| biotin synthase [Agrobacterium sp. H13-3]
 gi|325063408|gb|ADY67098.1| biotin synthase [Agrobacterium sp. H13-3]
          Length = 339

 Score =  316 bits (810), Expect = 2e-84,   Method: Composition-based stats.
 Identities = 203/306 (66%), Positives = 251/306 (82%)

Query: 20  TSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQSVHNK 79
           + +E   IYN+PFNDLLF +  VHR++F+ N IQ+S+LL+IKTGGCPE+CGYC+QS  N 
Sbjct: 23  SLEEAKIIYNLPFNDLLFRAQQVHRRHFDANAIQMSRLLSIKTGGCPEDCGYCSQSARNP 82

Query: 80  SKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLGLET 139
           + LKASKL+ V++VL EA+ AKE GATRYCMGAAWR PKERD+  +V M++GVK+LG+ET
Sbjct: 83  TGLKASKLMEVERVLAEARKAKEGGATRYCMGAAWRNPKERDMEAVVAMVEGVKALGMET 142

Query: 140 CMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSGIKV 199
           CMTLGML+ EQ++ L+ AGLDYYNHN+DTSERFY  + TT TFEDRL+TL NVR +G+KV
Sbjct: 143 CMTLGMLTPEQSERLAHAGLDYYNHNVDTSERFYSEIITTRTFEDRLETLANVRDAGMKV 202

Query: 200 CCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEHVRII 259
           C GGILG+GE ++DRI ML+TLANL  PPES+PIN+LIPIPGSK  +   VDPI+ VR I
Sbjct: 203 CAGGILGMGETVEDRISMLVTLANLPVPPESVPINMLIPIPGSKLAKAAPVDPIDFVRTI 262

Query: 260 SVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTILFNR 319
           ++ARILMP+S +RL+AGR  MSDE QALCF +GANSIFVG+TLLTA NP  + DT LF R
Sbjct: 263 ALARILMPRSHVRLSAGRTEMSDETQALCFLAGANSIFVGETLLTADNPGEDHDTALFRR 322

Query: 320 LGLIPD 325
           LGL P 
Sbjct: 323 LGLKPM 328


>gi|254810871|sp|Q1MRA1|BIOB_LAWIP RecName: Full=Biotin synthase
          Length = 316

 Score =  316 bits (810), Expect = 2e-84,   Method: Composition-based stats.
 Identities = 178/312 (57%), Positives = 224/312 (71%)

Query: 16  PKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQS 75
              WT KE  QI+N+P  +LL+ + T+HRK F+PN IQ+S LLNIKTG CPENCGYC+QS
Sbjct: 2   RNDWTFKEAKQIFNLPLLELLYKAQTIHRKYFDPNKIQISMLLNIKTGNCPENCGYCSQS 61

Query: 76  VHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSL 135
            H K+ L+   L+++D ++ EAK AKE G+TR+CMGAAWR P ++DL I+  MI+ VK L
Sbjct: 62  SHYKTDLQKEPLVDIDTLISEAKKAKELGSTRFCMGAAWRSPLDKDLKIVCQMIEEVKKL 121

Query: 136 GLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKS 195
           GLETC+TLG L   Q  +L KAGLD+YNHN++TS  FY H+ TTHTF+DRL TL+ VRK 
Sbjct: 122 GLETCVTLGFLKEHQIAMLKKAGLDFYNHNMNTSPEFYEHIATTHTFDDRLATLKAVRKF 181

Query: 196 GIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEH 255
           GIK+C GGI+GLGE IDDRI MLL LA L   PES+PIN  + + G+       +DP + 
Sbjct: 182 GIKLCSGGIIGLGETIDDRISMLLLLATLEEQPESVPINRFVKVAGTPLNPQSDIDPFDF 241

Query: 256 VRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTI 315
           VRII++ RILMPKS +RLAAGR  MSDELQ LCF  GANSIF G  LLT   P   +D +
Sbjct: 242 VRIIALTRILMPKSYIRLAAGREQMSDELQTLCFMGGANSIFYGGRLLTTDGPQPEQDDL 301

Query: 316 LFNRLGLIPDLS 327
           LF ++GL    +
Sbjct: 302 LFQKIGLEKVQT 313


>gi|127512648|ref|YP_001093845.1| biotin synthase [Shewanella loihica PV-4]
 gi|254811575|sp|A3QDN8|BIOB_SHELP RecName: Full=Biotin synthase
 gi|126637943|gb|ABO23586.1| biotin synthase [Shewanella loihica PV-4]
          Length = 350

 Score =  316 bits (810), Expect = 2e-84,   Method: Composition-based stats.
 Identities = 170/314 (54%), Positives = 231/314 (73%)

Query: 13  TKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYC 72
                 W   E+  ++ +P NDLLF +H++HR++F+PN +Q+S+LL+IKTG CPE+C YC
Sbjct: 4   LALRHDWQRDEIEALFALPMNDLLFKAHSIHRQHFDPNEVQISRLLSIKTGACPEDCKYC 63

Query: 73  NQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGV 132
            QS    + L+  +LI +++VL EA+ AK  GA+R+CMGAAWR P ERD+  + DM+  V
Sbjct: 64  PQSARYDTGLEKERLIEIEKVLTEARAAKAAGASRFCMGAAWRNPHERDMPYLKDMVSEV 123

Query: 133 KSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENV 192
           K++G+ETCMTLGMLS  QA+ L+ AGLDYYNHN+DTS  +Y  + TT T++DRL TL+NV
Sbjct: 124 KAMGMETCMTLGMLSESQAKDLADAGLDYYNHNLDTSPEYYGDIITTRTYQDRLNTLDNV 183

Query: 193 RKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDP 252
           R +G+KVC GGI+G+GE   DR  +L  LAN++  PES+PIN+L+ + G+ FE    +DP
Sbjct: 184 RAAGMKVCSGGIVGMGEQASDRAGLLQQLANMAKHPESVPINMLVKVAGTPFENLDDLDP 243

Query: 253 IEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNK 312
           +E VR I+VARI+MP SR+RL+AGR  M+DELQA+CFF+GANSIF G  LLT  NP  N+
Sbjct: 244 LEFVRTIAVARIVMPLSRVRLSAGREKMTDELQAMCFFAGANSIFYGCKLLTTSNPEENE 303

Query: 313 DTILFNRLGLIPDL 326
           D  LF RLGL P+ 
Sbjct: 304 DMTLFKRLGLHPEQ 317


>gi|37198255|dbj|BAC94091.1| biotin synthase [Vibrio vulnificus YJ016]
          Length = 381

 Score =  316 bits (810), Expect = 2e-84,   Method: Composition-based stats.
 Identities = 164/311 (52%), Positives = 231/311 (74%)

Query: 13  TKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYC 72
            +    WT  +V ++  MPF DLLF +  VHR+    N++Q+S LL+IKTG CPE+C YC
Sbjct: 32  VEVRHNWTHAQVRELMEMPFMDLLFEAQQVHRQYHPKNYVQVSTLLSIKTGACPEDCKYC 91

Query: 73  NQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGV 132
            QS   ++ ++  +L+ V++VL  A+ AK  G+TR+CMGAAW+ PKERD+ ++ DMIKGV
Sbjct: 92  PQSARYQTDVEKERLMEVERVLDAAQKAKNAGSTRFCMGAAWKNPKERDMPLLTDMIKGV 151

Query: 133 KSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENV 192
           K +GLETCMTLGML+ EQA+ L+ AGLDYYNHN+DTS  +Y ++ TT T++DRL TL +V
Sbjct: 152 KDMGLETCMTLGMLTPEQAKQLASAGLDYYNHNLDTSPEYYGNIITTRTYQDRLDTLSHV 211

Query: 193 RKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDP 252
           R +G+K+C GGI+G+GE  +DR  +L+ LANL T PES+PIN+L+ + G+  E  ++VDP
Sbjct: 212 RDAGMKICSGGIIGMGESANDRAGLLVELANLPTHPESVPINMLVKVKGTPLETAEEVDP 271

Query: 253 IEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNK 312
            + +R+I+VARI+MP S +RL+AGR  M++++Q LCF +GANSIF G  LLT  NPS +K
Sbjct: 272 FDFIRLIAVARIMMPTSAVRLSAGRENMNEQMQTLCFMAGANSIFYGCKLLTTPNPSEDK 331

Query: 313 DTILFNRLGLI 323
           D  LFN+LG+ 
Sbjct: 332 DMQLFNKLGIN 342


>gi|167835207|ref|ZP_02462090.1| biotin synthase [Burkholderia thailandensis MSMB43]
          Length = 339

 Score =  316 bits (810), Expect = 2e-84,   Method: Composition-based stats.
 Identities = 174/326 (53%), Positives = 227/326 (69%), Gaps = 4/326 (1%)

Query: 1   MSRSTVVPEEN----PTKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSK 56
           M+++   P              W   +V  +Y +PFNDLLF +   HR++F+ N IQLS 
Sbjct: 4   MTQAQTAPATTETPVAAPAAPRWRVADVIALYELPFNDLLFRAQQAHREHFDANAIQLST 63

Query: 57  LLNIKTGGCPENCGYCNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWRE 116
           LL+IKTGGC E+CGYC+QS H+++ LKA KL+ VD VL  A+ AKENGATR+CMGAAWR 
Sbjct: 64  LLSIKTGGCEEDCGYCSQSAHHETGLKAEKLMEVDAVLAAARTAKENGATRFCMGAAWRN 123

Query: 117 PKERDLSIIVDMIKGVKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHV 176
           PK+R +  I DMI+GVK +GLETC+TLGML   QA+ L++AGLDYYNHN+DTS  FY  +
Sbjct: 124 PKDRHIEPIKDMIRGVKEMGLETCVTLGMLEAHQAKALAEAGLDYYNHNLDTSPEFYGQI 183

Query: 177 TTTHTFEDRLQTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLL 236
            +T T++DRL TLE VR +GI VCCGGI+G+GE   +R  ++  LAN+   PES+PIN L
Sbjct: 184 ISTRTYQDRLDTLERVRDAGINVCCGGIIGMGESRRERAGLIAQLANMDPYPESVPINNL 243

Query: 237 IPIPGSKFEENKKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSI 296
           + I G+  E  + +DP E VR I+VARI MPK+ +RL+AGR  + D +QALCF +GANS+
Sbjct: 244 VAIEGTPLENAQALDPFEFVRTIAVARITMPKAMVRLSAGREQLDDSMQALCFLAGANSM 303

Query: 297 FVGDTLLTAKNPSYNKDTILFNRLGL 322
           F GD LLT  NP    D  L  RLG+
Sbjct: 304 FYGDVLLTTGNPRAEADRKLLARLGM 329


>gi|94986864|ref|YP_594797.1| biotin synthase [Lawsonia intracellularis PHE/MN1-00]
 gi|94731113|emb|CAJ54475.1| biotin synthase [Lawsonia intracellularis PHE/MN1-00]
          Length = 322

 Score =  316 bits (810), Expect = 2e-84,   Method: Composition-based stats.
 Identities = 178/312 (57%), Positives = 224/312 (71%)

Query: 16  PKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQS 75
              WT KE  QI+N+P  +LL+ + T+HRK F+PN IQ+S LLNIKTG CPENCGYC+QS
Sbjct: 8   RNDWTFKEAKQIFNLPLLELLYKAQTIHRKYFDPNKIQISMLLNIKTGNCPENCGYCSQS 67

Query: 76  VHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSL 135
            H K+ L+   L+++D ++ EAK AKE G+TR+CMGAAWR P ++DL I+  MI+ VK L
Sbjct: 68  SHYKTDLQKEPLVDIDTLISEAKKAKELGSTRFCMGAAWRSPLDKDLKIVCQMIEEVKKL 127

Query: 136 GLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKS 195
           GLETC+TLG L   Q  +L KAGLD+YNHN++TS  FY H+ TTHTF+DRL TL+ VRK 
Sbjct: 128 GLETCVTLGFLKEHQIAMLKKAGLDFYNHNMNTSPEFYEHIATTHTFDDRLATLKAVRKF 187

Query: 196 GIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEH 255
           GIK+C GGI+GLGE IDDRI MLL LA L   PES+PIN  + + G+       +DP + 
Sbjct: 188 GIKLCSGGIIGLGETIDDRISMLLLLATLEEQPESVPINRFVKVAGTPLNPQSDIDPFDF 247

Query: 256 VRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTI 315
           VRII++ RILMPKS +RLAAGR  MSDELQ LCF  GANSIF G  LLT   P   +D +
Sbjct: 248 VRIIALTRILMPKSYIRLAAGREQMSDELQTLCFMGGANSIFYGGRLLTTDGPQPEQDDL 307

Query: 316 LFNRLGLIPDLS 327
           LF ++GL    +
Sbjct: 308 LFQKIGLEKVQT 319


>gi|299134077|ref|ZP_07027270.1| biotin synthase [Afipia sp. 1NLS2]
 gi|298590824|gb|EFI51026.1| biotin synthase [Afipia sp. 1NLS2]
          Length = 351

 Score =  316 bits (810), Expect = 3e-84,   Method: Composition-based stats.
 Identities = 175/312 (56%), Positives = 233/312 (74%), Gaps = 1/312 (0%)

Query: 13  TKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYC 72
                 WT  E   +Y++PF DL+F + ++HR NF+PNH++ + LL+IKTGGCPE+CGYC
Sbjct: 13  VLPRHDWTRDEAQALYDLPFADLMFQAQSIHRANFDPNHVETASLLSIKTGGCPEDCGYC 72

Query: 73  NQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGV 132
           +QS H K+ +KA+KL++ D V+  AK AKE+GA R+CM AAWR PK++DL  + DM+  V
Sbjct: 73  SQSAHYKTDVKATKLMDHDDVIATAKRAKESGANRFCMAAAWRNPKDKDLDKVCDMVSEV 132

Query: 133 KSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENV 192
           K+LGLETC TLGML+ EQA  L  AGLD+YNHN+DTS  FY H+ TT T +DR++TL + 
Sbjct: 133 KALGLETCATLGMLTREQADRLRAAGLDFYNHNVDTSPEFYGHIITTRTMQDRIETLAHA 192

Query: 193 RKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEE-NKKVD 251
           R+SG+KVCCGGI+G+GE ++DR+ ML+ LANL+  PES+PINL   + G          D
Sbjct: 193 RESGLKVCCGGIVGMGEQVEDRLGMLMLLANLAEHPESVPINLWNEVKGVPVNGTANAPD 252

Query: 252 PIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYN 311
           PIE VR+I+VARI+MPKS +RL+AGR  M+DE+QALCF +GANSIF+GD LLT KNP  +
Sbjct: 253 PIEMVRMIAVARIMMPKSVVRLSAGRQYMTDEMQALCFLAGANSIFIGDVLLTTKNPQTD 312

Query: 312 KDTILFNRLGLI 323
           KD  L +RLG+ 
Sbjct: 313 KDAALLDRLGIK 324


>gi|329910730|ref|ZP_08275370.1| Biotin synthase [Oxalobacteraceae bacterium IMCC9480]
 gi|327546098|gb|EGF31162.1| Biotin synthase [Oxalobacteraceae bacterium IMCC9480]
          Length = 336

 Score =  316 bits (810), Expect = 3e-84,   Method: Composition-based stats.
 Identities = 159/324 (49%), Positives = 226/324 (69%), Gaps = 1/324 (0%)

Query: 1   MSRSTVV-PEENPTKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLN 59
           M+  T+      PT     W  ++V  ++N+PFN+LLF +  +HR++F+P  ++L+ LL+
Sbjct: 1   MTSQTIAFQAATPTIVASTWPVEDVLALFNLPFNELLFRAQQIHREHFDPTEVELATLLS 60

Query: 60  IKTGGCPENCGYCNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKE 119
           IKTGGCPE+CGYC Q+    + + A K++ +  VL+ A+ AK +GATR+CMGAAWREPK+
Sbjct: 61  IKTGGCPEDCGYCPQAARYDTGVTAQKILPLATVLEAARQAKAHGATRFCMGAAWREPKD 120

Query: 120 RDLSIIVDMIKGVKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTT 179
           RDL  + +M++ VK+LGLETC TLGML   QA+ L  AGLDYYNHN+DT+  FY +V +T
Sbjct: 121 RDLEQVEEMVREVKALGLETCATLGMLGVGQAEKLKDAGLDYYNHNLDTAPEFYGNVIST 180

Query: 180 HTFEDRLQTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPI 239
             ++ RL TL  VR +GIKVCCGGI+G+GE    R  ++  LANL+  PES+P+N L+ +
Sbjct: 181 RDYQHRLDTLGRVRGAGIKVCCGGIVGMGESRLQRAGLVAQLANLTPYPESVPVNHLVQV 240

Query: 240 PGSKFEENKKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVG 299
            G+    ++ +DP+E VR I+VARI MP +R+RL+AGR  M + +QA+CF +GANSIF G
Sbjct: 241 EGTPLYGSEALDPLEFVRTIAVARITMPTARVRLSAGRRQMGEAVQAMCFLAGANSIFYG 300

Query: 300 DTLLTAKNPSYNKDTILFNRLGLI 323
           D LLT  NP   +D  L  +LG+ 
Sbjct: 301 DKLLTTGNPEVEEDQALLAKLGMR 324


>gi|255319279|ref|ZP_05360496.1| biotin synthase [Acinetobacter radioresistens SK82]
 gi|262379726|ref|ZP_06072882.1| biotin synthase [Acinetobacter radioresistens SH164]
 gi|255303672|gb|EET82872.1| biotin synthase [Acinetobacter radioresistens SK82]
 gi|262299183|gb|EEY87096.1| biotin synthase [Acinetobacter radioresistens SH164]
          Length = 333

 Score =  316 bits (810), Expect = 3e-84,   Method: Composition-based stats.
 Identities = 169/312 (54%), Positives = 232/312 (74%)

Query: 16  PKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQS 75
              W+ +E+  +Y  PF DL+F +  +HR+NF+PN IQ+S LL+IKTG CPE+C YC+QS
Sbjct: 8   RNDWSREEIEALYQQPFLDLIFEAQRIHRENFQPNTIQVSTLLSIKTGKCPEDCKYCSQS 67

Query: 76  VHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSL 135
            H  S L+A K I V++V++EAK A E+G++R+CMGAAWR P ERD+  +++M++ VK+L
Sbjct: 68  AHYDSNLEAEKRIAVEKVIREAKEALESGSSRFCMGAAWRNPNERDMPYVLEMVREVKAL 127

Query: 136 GLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKS 195
           GLETCMTLGML+  QA+ L  AGLDYYNHN+DTS  +Y H+ +T TF+DRL TL++VR++
Sbjct: 128 GLETCMTLGMLNQSQAERLKDAGLDYYNHNLDTSREYYSHIISTRTFDDRLDTLDHVRQA 187

Query: 196 GIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEH 255
           G+KVC GGI+GLGE   DRI +L  LA L   PES+PIN+L+PI G+   + +K+D  E 
Sbjct: 188 GMKVCSGGIVGLGESKQDRIGLLHELATLPVHPESVPINMLVPIEGTPLADVEKLDVTEW 247

Query: 256 VRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTI 315
           +R I+VARI+MP+S +RL+AGR  +SD  QAL F +GANS+F G+ LLT  N    KD I
Sbjct: 248 IRTIAVARIIMPQSYIRLSAGRESLSDSDQALAFMAGANSLFSGEKLLTTPNAGEGKDRI 307

Query: 316 LFNRLGLIPDLS 327
           LFN+LGL  + +
Sbjct: 308 LFNKLGLSAEKA 319


>gi|258621721|ref|ZP_05716752.1| Biotin synthase [Vibrio mimicus VM573]
 gi|258626333|ref|ZP_05721180.1| Biotin synthase [Vibrio mimicus VM603]
 gi|258581385|gb|EEW06287.1| Biotin synthase [Vibrio mimicus VM603]
 gi|258585952|gb|EEW10670.1| Biotin synthase [Vibrio mimicus VM573]
          Length = 350

 Score =  316 bits (809), Expect = 3e-84,   Method: Composition-based stats.
 Identities = 165/313 (52%), Positives = 234/313 (74%)

Query: 16  PKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQS 75
              WT  EV  + + PF DLLF +  VHR +   NH+Q+S LL+IKTG CPE+C YC QS
Sbjct: 4   RHNWTVAEVKALLDKPFMDLLFEAQQVHRLHHPHNHVQVSTLLSIKTGACPEDCKYCPQS 63

Query: 76  VHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSL 135
            H ++ +   +L+ V++VL  A+ AK +G+TR+CMGAAW+ PKERD+ ++ +MI+GVK +
Sbjct: 64  AHYRTDVDKERLMEVERVLDAAQKAKTSGSTRFCMGAAWKNPKERDMPLLKEMIRGVKDM 123

Query: 136 GLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKS 195
           GLETCMTLGML+ +QAQ L++AGLDYYNHN+DTS  +Y ++ TT T++DRL TL +VR +
Sbjct: 124 GLETCMTLGMLTPDQAQQLAEAGLDYYNHNLDTSPEYYGNIITTRTYQDRLDTLSHVRDA 183

Query: 196 GIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEH 255
           G+K+C GGI+G+GE  +DR  +L+ LANLST PES+PIN+L+ + G+  E+   V+P + 
Sbjct: 184 GMKICSGGIIGMGESTNDRAGLLVELANLSTHPESVPINMLVKVKGTPLEQVDDVEPFDF 243

Query: 256 VRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTI 315
           VR+I+VARI+MPKS +RL+AGR  M++++QALCF +GANSIF G  LLT  NP+ + D +
Sbjct: 244 VRLIAVARIMMPKSAVRLSAGREKMNEQMQALCFMAGANSIFYGCKLLTTPNPAEDSDML 303

Query: 316 LFNRLGLIPDLSA 328
           LF +LG+  +  A
Sbjct: 304 LFKKLGINREQVA 316


>gi|153802132|ref|ZP_01956718.1| biotin synthase [Vibrio cholerae MZO-3]
 gi|124122325|gb|EAY41068.1| biotin synthase [Vibrio cholerae MZO-3]
          Length = 350

 Score =  316 bits (809), Expect = 3e-84,   Method: Composition-based stats.
 Identities = 166/313 (53%), Positives = 234/313 (74%)

Query: 16  PKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQS 75
              WT  EV  + + PF DLLF +  VHR +   NH+Q+S LL+IKTG CPE+C YC QS
Sbjct: 4   RHNWTVAEVKALLDKPFMDLLFEAQQVHRLHHPHNHVQVSTLLSIKTGACPEDCKYCPQS 63

Query: 76  VHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSL 135
            H ++ +   +L+ V++VL  A+ AK +G+TR+CMGAAW+ PKERD+ ++ +MI+GVK +
Sbjct: 64  AHYRTDVDKERLMEVERVLDAAQKAKNSGSTRFCMGAAWKNPKERDMPLLKEMIRGVKDM 123

Query: 136 GLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKS 195
           GLETCMTLGML+ +QAQ L++AGLDYYNHN+DTS  FY ++ TT T++DRL TL +VR +
Sbjct: 124 GLETCMTLGMLTPDQAQQLAQAGLDYYNHNLDTSPEFYGNIITTRTYQDRLDTLSHVRDA 183

Query: 196 GIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEH 255
           G+K+C GGI+G+GE  +DR  +L+ LANLST PES+PIN+L+ + G+  E+   V+P + 
Sbjct: 184 GMKICSGGIIGMGESTNDRAGLLVELANLSTHPESVPINMLVKVKGTPLEQVDDVEPFDF 243

Query: 256 VRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTI 315
           VR+I+VARI+MPKS +RL+AGR  M++++QALCF +GANSIF G  LLT  NP+ + D +
Sbjct: 244 VRLIAVARIMMPKSAVRLSAGREKMNEQMQALCFMAGANSIFYGCKLLTTPNPAEDSDML 303

Query: 316 LFNRLGLIPDLSA 328
           LF +LG+  +  A
Sbjct: 304 LFKKLGINREQVA 316


>gi|121601069|ref|YP_994370.1| biotin synthase [Burkholderia mallei SAVP1]
 gi|134279978|ref|ZP_01766690.1| biotin synthase [Burkholderia pseudomallei 305]
 gi|237810590|ref|YP_002895041.1| biotin synthase [Burkholderia pseudomallei MSHR346]
 gi|254202062|ref|ZP_04908426.1| biotin synthase [Burkholderia mallei FMH]
 gi|254810583|sp|A1V817|BIOB_BURMS RecName: Full=Biotin synthase
 gi|254810630|sp|A3N520|BIOB_BURP6 RecName: Full=Biotin synthase
 gi|254810637|sp|A3MNG1|BIOB_BURM7 RecName: Full=Biotin synthase
 gi|254810638|sp|A2S7R3|BIOB_BURM9 RecName: Full=Biotin synthase
 gi|254810639|sp|Q62MW9|BIOB_BURMA RecName: Full=Biotin synthase
 gi|121229879|gb|ABM52397.1| biotin synthase [Burkholderia mallei SAVP1]
 gi|134249178|gb|EBA49260.1| biotin synthase [Burkholderia pseudomallei 305]
 gi|147747956|gb|EDK55032.1| biotin synthase [Burkholderia mallei FMH]
 gi|237504686|gb|ACQ97004.1| biotin synthase [Burkholderia pseudomallei MSHR346]
          Length = 336

 Score =  316 bits (809), Expect = 3e-84,   Method: Composition-based stats.
 Identities = 171/305 (56%), Positives = 222/305 (72%)

Query: 18  VWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQSVH 77
            W   +V  +Y +PFNDLLF +   HR++F+ N IQLS LL+IKTGGC E+CGYC+QS H
Sbjct: 22  RWRVADVIALYELPFNDLLFRAQQTHREHFDANAIQLSTLLSIKTGGCEEDCGYCSQSAH 81

Query: 78  NKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLGL 137
           + + LKA KL+ VD VL  A+ AKENGATR+CMGAAWR PK+R +  I +MI+GVK +GL
Sbjct: 82  HDTGLKAEKLMEVDAVLAAARTAKENGATRFCMGAAWRNPKDRHIEPIKEMIRGVKDMGL 141

Query: 138 ETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSGI 197
           ETC+TLGML   QA+ L++AGLDYYNHN+DTS  FY  + +T T++DRL TLE VR +GI
Sbjct: 142 ETCVTLGMLEEHQAKALAEAGLDYYNHNLDTSPEFYGQIISTRTYQDRLDTLERVRDAGI 201

Query: 198 KVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEHVR 257
            VCCGGI+G+GE   +R  ++  LAN++  PES+PIN L+ I G+  E  + +DP E VR
Sbjct: 202 NVCCGGIIGMGESRRERAGLIAQLANMNPYPESVPINNLVAIEGTPLENAQALDPFEFVR 261

Query: 258 IISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTILF 317
            I+VARI MPK+ +RL+AGR  + D +QALCF +GANS+F GD LLT  NP    D  L 
Sbjct: 262 TIAVARITMPKAMVRLSAGREQLDDAMQALCFLAGANSMFYGDVLLTTGNPRAEADRKLL 321

Query: 318 NRLGL 322
            RLG+
Sbjct: 322 ARLGM 326


>gi|261210727|ref|ZP_05925019.1| biotin synthase [Vibrio sp. RC341]
 gi|260840212|gb|EEX66792.1| biotin synthase [Vibrio sp. RC341]
          Length = 350

 Score =  316 bits (809), Expect = 3e-84,   Method: Composition-based stats.
 Identities = 167/313 (53%), Positives = 234/313 (74%)

Query: 16  PKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQS 75
              WT  EV  + + PF DLLF +  VHR +   NH+Q+S LL+IKTG CPE+C YC QS
Sbjct: 4   RHNWTVAEVKALLDKPFMDLLFEAQQVHRLHHPHNHVQVSTLLSIKTGACPEDCKYCPQS 63

Query: 76  VHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSL 135
            H ++ +   +L+ V++VL  A+ AK +G+TR+CMGAAW+ PKERD+ ++ +MI+GVK +
Sbjct: 64  AHYRTDVDKERLMEVERVLDAAQKAKTSGSTRFCMGAAWKNPKERDMPLLKEMIRGVKDM 123

Query: 136 GLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKS 195
           GLETCMTLGML+ +QAQ L++AGLDYYNHN+DTS  FY ++ TT T++DRL TL +VR +
Sbjct: 124 GLETCMTLGMLTPDQAQQLAQAGLDYYNHNLDTSPEFYGNIITTRTYQDRLDTLSHVRDA 183

Query: 196 GIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEH 255
           G+K+C GGI+G+GE  +DR  +L+ LANLST PES+PIN+L+ + G+  E+   VDP + 
Sbjct: 184 GMKICSGGIIGMGESTNDRAGLLVELANLSTHPESVPINMLVKVKGTPLEQVDDVDPFDF 243

Query: 256 VRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTI 315
           VR+I+VARI+MPKS +RL+AGR  M++++QALCF +GANSIF G  LLT  NP+ + D +
Sbjct: 244 VRLIAVARIMMPKSAVRLSAGREKMNEQMQALCFMAGANSIFYGCKLLTTPNPAEDSDML 303

Query: 316 LFNRLGLIPDLSA 328
           LF +LG+  +  A
Sbjct: 304 LFKKLGINREQVA 316


>gi|83311856|ref|YP_422120.1| biotin synthase and related enzyme [Magnetospirillum magneticum
           AMB-1]
 gi|123726928|sp|Q2W3L4|BIOB_MAGSA RecName: Full=Biotin synthase
 gi|82946697|dbj|BAE51561.1| Biotin synthase and related enzyme [Magnetospirillum magneticum
           AMB-1]
          Length = 326

 Score =  316 bits (809), Expect = 3e-84,   Method: Composition-based stats.
 Identities = 166/310 (53%), Positives = 224/310 (72%)

Query: 16  PKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQS 75
              W+++E+  ++ +PFNDL+F +  VHR +F+ N +Q+S+L++IKTG CPE+C YC QS
Sbjct: 17  RHDWSAEEIEALFALPFNDLMFEAQKVHRAHFDANRVQVSRLISIKTGSCPEDCSYCPQS 76

Query: 76  VHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSL 135
            H  + L+  KL+ V++V++ A+ AKE GA+R+CMGAAWR PK  D  + V MI+GVK+L
Sbjct: 77  AHYATGLEKEKLLAVEEVVESARQAKEEGASRFCMGAAWRGPKGDDFEVAVAMIEGVKAL 136

Query: 136 GLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKS 195
           G+ETC T G+L   QAQ L +AGLDYYNHNIDTS   Y  V TT TF+DRL TL+ VR +
Sbjct: 137 GMETCATFGLLDKWQAQRLKEAGLDYYNHNIDTSPEHYSEVITTRTFQDRLDTLDVVRDA 196

Query: 196 GIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEH 255
           G+ VC GGI+GLGE   DR  M+ TLAN+   P+S+PINLLIPI G+   + ++ D  + 
Sbjct: 197 GLHVCSGGIVGLGETRTDRARMIQTLANMPKHPDSVPINLLIPIQGTPLADAERPDSFDF 256

Query: 256 VRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTI 315
           +R I+VARI MPKS +RL+AGR  M++E+QALCF +GANS+F G  LLTAKN +  KD  
Sbjct: 257 IRTIAVARITMPKSFVRLSAGREGMTEEMQALCFLAGANSVFCGQKLLTAKNAAPGKDKS 316

Query: 316 LFNRLGLIPD 325
           LF +LGL P 
Sbjct: 317 LFGKLGLQPM 326


>gi|325917190|ref|ZP_08179417.1| biotin synthase [Xanthomonas vesicatoria ATCC 35937]
 gi|325536580|gb|EGD08349.1| biotin synthase [Xanthomonas vesicatoria ATCC 35937]
          Length = 361

 Score =  316 bits (809), Expect = 3e-84,   Method: Composition-based stats.
 Identities = 160/311 (51%), Positives = 219/311 (70%)

Query: 16  PKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQS 75
              W  KE+  ++++PF +LL  + +VHR +F+P  +Q+S LL++KTGGCPE+C YC Q+
Sbjct: 23  RHDWDRKELQALFDLPFPELLHHAASVHRAHFDPAEVQVSTLLSVKTGGCPEDCAYCPQA 82

Query: 76  VHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSL 135
               + + A KL+  ++V+ +A+ AK  GA+R+CMGAAWR PKERD+  +  MI+ VK++
Sbjct: 83  QRYDTGVTAQKLMETEEVVAKARQAKAAGASRFCMGAAWRSPKERDIPKVAAMIREVKAM 142

Query: 136 GLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKS 195
           GLETC TLGML   QA+ L  AGLDYYNHN+DT+  +Y  +  T  ++DRL TLE+VR  
Sbjct: 143 GLETCATLGMLDAGQARALKDAGLDYYNHNLDTAPDYYDSIIHTRQYQDRLNTLEHVRDV 202

Query: 196 GIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEH 255
           G+K CCGGI+G+GE  + RI +LL LA L   P+S+PIN L+ + G+     +++DP E 
Sbjct: 203 GLKTCCGGIVGMGETREHRIGLLLALATLPAHPDSVPINQLVQVAGTPLHGTQQLDPFEF 262

Query: 256 VRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTI 315
           VR+I+VARI MPKS +RL+AGR  MSDELQALCF +GANSIF G+ LLT  NP   +D  
Sbjct: 263 VRMIAVARITMPKSMVRLSAGRETMSDELQALCFLAGANSIFYGEKLLTTGNPDTERDQA 322

Query: 316 LFNRLGLIPDL 326
           LF RLGL P  
Sbjct: 323 LFQRLGLRPMQ 333


>gi|254448935|ref|ZP_05062390.1| biotin synthase [gamma proteobacterium HTCC5015]
 gi|198261472|gb|EDY85762.1| biotin synthase [gamma proteobacterium HTCC5015]
          Length = 335

 Score =  316 bits (809), Expect = 3e-84,   Method: Composition-based stats.
 Identities = 168/311 (54%), Positives = 220/311 (70%)

Query: 13  TKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYC 72
           T     WT KE+ Q++  PFNDLLF + +VHR++F+PN +Q+S LL+IKTG CPE+CGYC
Sbjct: 2   TSTRHDWTQKEIEQLFQQPFNDLLFHAQSVHREHFDPNAVQMSSLLSIKTGACPEDCGYC 61

Query: 73  NQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGV 132
            QS    ++L+   L+ + +VL  A+ AK  GA+R+CMGAAWR P +R L  + +M+  V
Sbjct: 62  PQSAKYNTELEREALMPLGEVLSAARAAKAKGASRFCMGAAWRNPNDRQLEQVGEMVSAV 121

Query: 133 KSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENV 192
           + +GLETC+TLGML   QAQ L   GLDYYNHN+DTS  +Y  V TT T++DRL TL +V
Sbjct: 122 RDMGLETCVTLGMLEAHQAQRLRDVGLDYYNHNLDTSPDYYGEVITTRTYQDRLDTLSHV 181

Query: 193 RKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDP 252
           R +GI VCCGGI+G+GE   DR +++  LANL   PES+PINLL+ + G+     + +DP
Sbjct: 182 RDAGIHVCCGGIVGMGEAPSDRAELVQQLANLPQHPESVPINLLVQVAGTPLYGTEALDP 241

Query: 253 IEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNK 312
            + VR I+VARI MP+S +RL+AGR  MSDELQALCF +GANSIF GD LLT  NP   +
Sbjct: 242 FDFVRTIAVARITMPQSMVRLSAGRNDMSDELQALCFMAGANSIFYGDKLLTTDNPEAER 301

Query: 313 DTILFNRLGLI 323
           D  LF RLGL 
Sbjct: 302 DQKLFERLGLH 312


>gi|226954184|ref|ZP_03824648.1| biotin synthase [Acinetobacter sp. ATCC 27244]
 gi|294650202|ref|ZP_06727576.1| biotin synthase [Acinetobacter haemolyticus ATCC 19194]
 gi|226835053|gb|EEH67436.1| biotin synthase [Acinetobacter sp. ATCC 27244]
 gi|292823908|gb|EFF82737.1| biotin synthase [Acinetobacter haemolyticus ATCC 19194]
          Length = 333

 Score =  316 bits (809), Expect = 3e-84,   Method: Composition-based stats.
 Identities = 166/310 (53%), Positives = 230/310 (74%)

Query: 16  PKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQS 75
              WT  E+  +Y+ PF DL+F +  VHR++F+ N IQ+S LL+IKTG CPE+C YC+QS
Sbjct: 8   RNDWTRDEIQALYDQPFLDLVFEAQRVHRQHFQANTIQVSTLLSIKTGKCPEDCKYCSQS 67

Query: 76  VHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSL 135
               SKL+A K I VD+V++EA+ AK++G++R+CMGAAWR P ERD+  +++M++ VK+L
Sbjct: 68  ARYDSKLEAEKRITVDKVIREAQAAKDSGSSRFCMGAAWRNPHERDMPYVLEMVREVKAL 127

Query: 136 GLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKS 195
           GLETCMTLGML+  QA+ L  AGLDYYNHN+DTS  +Y H+ +T TF+DRL TL++VR++
Sbjct: 128 GLETCMTLGMLNQSQAERLKDAGLDYYNHNLDTSREYYSHIISTRTFDDRLNTLDHVRQA 187

Query: 196 GIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEH 255
           G+KVC GGI+GLGE  +DRI +L  LA +   PES+PIN+L+PI G+   + +K+D  E 
Sbjct: 188 GMKVCSGGIVGLGESRNDRIGLLHELATMPVHPESVPINMLVPIEGTPLADVEKLDVTEW 247

Query: 256 VRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTI 315
           +R I+VARI+MP S +RL+AGR  +SD  QAL F +GANS+F G+ LLT  N    KD +
Sbjct: 248 IRTIAVARIIMPHSYIRLSAGRESLSDSDQALAFMAGANSLFSGEKLLTTPNAGEGKDQV 307

Query: 316 LFNRLGLIPD 325
           LF +LGL  +
Sbjct: 308 LFAKLGLTAE 317


>gi|92113294|ref|YP_573222.1| biotin synthase [Chromohalobacter salexigens DSM 3043]
 gi|122990553|sp|Q1QYD5|BIOB_CHRSD RecName: Full=Biotin synthase
 gi|91796384|gb|ABE58523.1| biotin synthase [Chromohalobacter salexigens DSM 3043]
          Length = 370

 Score =  316 bits (809), Expect = 3e-84,   Method: Composition-based stats.
 Identities = 165/312 (52%), Positives = 229/312 (73%)

Query: 16  PKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQS 75
              W+ +E+  ++ +PFNDLLF +  VHR +F+PN +Q+S LL+IKTG CPE+C YC QS
Sbjct: 22  RHDWSLEEIEALFALPFNDLLFRAQQVHRAHFDPNAVQVSTLLSIKTGACPEDCKYCPQS 81

Query: 76  VHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSL 135
            H  + L   KL+ +++V+++A+ AK  GA+R+CMGAAWR P+E+DL ++ +M+  VK+L
Sbjct: 82  GHYNTGLGKEKLLEIEKVVEQARAAKAAGASRFCMGAAWRSPREKDLRVVTEMVGRVKAL 141

Query: 136 GLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKS 195
           GLETCMTLGM+  +QA+ L++AGLDYYNHN+DTS  +Y  + TT T+ DRL+TL NVR++
Sbjct: 142 GLETCMTLGMVDVDQARRLAEAGLDYYNHNLDTSPDYYGEIITTRTYADRLETLANVREA 201

Query: 196 GIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEH 255
           G+KVC GGILG+GE   DR  +L  L  L   PES+PIN+L+ +PG+  E  + +DP+  
Sbjct: 202 GMKVCSGGILGMGEAPRDRAALLQQLVRLDPHPESVPINMLVKVPGTPMENVEDMDPLTF 261

Query: 256 VRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTI 315
           +R I+VARILMPKS +RL+AGR  M +  QAL F +GANSIF GDTLLT  NP   +D  
Sbjct: 262 IRAIAVARILMPKSHVRLSAGREQMDESTQALAFLAGANSIFYGDTLLTTGNPQVERDRA 321

Query: 316 LFNRLGLIPDLS 327
           LF++LGL P+ S
Sbjct: 322 LFDKLGLHPEPS 333


>gi|325285942|ref|YP_004261732.1| biotin synthase [Cellulophaga lytica DSM 7489]
 gi|324321396|gb|ADY28861.1| biotin synthase [Cellulophaga lytica DSM 7489]
          Length = 364

 Score =  316 bits (809), Expect = 3e-84,   Method: Composition-based stats.
 Identities = 149/314 (47%), Positives = 218/314 (69%), Gaps = 1/314 (0%)

Query: 13  TKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYC 72
           ++    W+ +E+  IYN P  DLL+ + T+HR+  +PN +Q+S LL+IKTGGCPE+CGYC
Sbjct: 2   SEVRHNWSKQEILDIYNKPLMDLLYEAATIHRQEHDPNTVQVSTLLSIKTGGCPEDCGYC 61

Query: 73  NQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKER-DLSIIVDMIKG 131
            Q+    + ++ + L++V QV  +A  AK +G++R CMGAAWR  K+  +   +++M++ 
Sbjct: 62  PQAARYHTDVEGNDLMSVQQVKAQALRAKSSGSSRVCMGAAWRNVKDGPEFDQVLEMVRT 121

Query: 132 VKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLEN 191
           +  L +E C TLGM++  QAQ L++AGL  YNHN+DTSE +Y  V +T  FEDRL T+EN
Sbjct: 122 INKLDMEVCCTLGMITENQAQRLAEAGLYAYNHNLDTSEDYYKDVISTRAFEDRLDTIEN 181

Query: 192 VRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVD 251
           VRK+ + VC GGI+G+GE ++DR  ML+ L+ LS  PES+PIN L+ + G+  E+ + V 
Sbjct: 182 VRKTNVTVCSGGIIGMGEALEDRAGMLVALSTLSPQPESVPINALVAVEGTPMEDIEPVS 241

Query: 252 PIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYN 311
             + VR+++  RI+MP +++RL+AGR  MS E QA+CFF+GANSIF GD LLT  NP  N
Sbjct: 242 IWDMVRMVATTRIVMPNTQVRLSAGRTQMSREGQAMCFFAGANSIFAGDKLLTTPNPDVN 301

Query: 312 KDTILFNRLGLIPD 325
           +D  +F  LGL P 
Sbjct: 302 EDMEMFKMLGLNPQ 315


>gi|170691628|ref|ZP_02882793.1| biotin synthase [Burkholderia graminis C4D1M]
 gi|170143833|gb|EDT11996.1| biotin synthase [Burkholderia graminis C4D1M]
          Length = 364

 Score =  316 bits (809), Expect = 4e-84,   Method: Composition-based stats.
 Identities = 169/308 (54%), Positives = 221/308 (71%)

Query: 18  VWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQSVH 77
            W   ++  +Y +PFNDL+F +   HR++F+ N +QLS LL+IKTGGC E+C YC QSVH
Sbjct: 38  RWRVADIVALYELPFNDLMFRAQQTHREHFDANTVQLSTLLSIKTGGCEEDCAYCPQSVH 97

Query: 78  NKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLGL 137
           + + L+A KL+ VD+VL  AK AKENGATR+CMGAAWR PK+R L  I DMI+GVK++GL
Sbjct: 98  HDTGLQADKLMPVDEVLAAAKAAKENGATRFCMGAAWRNPKDRHLEPIKDMIRGVKAMGL 157

Query: 138 ETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSGI 197
           ETC+TLGML   QAQ L +AGLDYYNHN+DTS  FY  + +T T++DRL TLE VR +GI
Sbjct: 158 ETCVTLGMLETHQAQALREAGLDYYNHNLDTSPEFYGQIISTRTYQDRLDTLERVRDAGI 217

Query: 198 KVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEHVR 257
            VCCGGI+GLGE   +R  ++  LAN+   PES+PIN L+ + G+     + +DP E VR
Sbjct: 218 NVCCGGIVGLGESRRERAGLIAQLANMEPYPESVPINNLVQVEGTPLTGTEAIDPFEFVR 277

Query: 258 IISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTILF 317
            I++ARI MP++ +RL+AGR  M + LQA+CF +GANSIF GD LLT  NP    D  L 
Sbjct: 278 TIAIARITMPRAMVRLSAGREQMDEALQAMCFLAGANSIFYGDQLLTTSNPQAEADRKLL 337

Query: 318 NRLGLIPD 325
            RLG+  +
Sbjct: 338 ARLGIRAE 345


>gi|124383327|ref|YP_001027982.1| biotin synthase [Burkholderia mallei NCTC 10229]
 gi|126439058|ref|YP_001057441.1| biotin synthase [Burkholderia pseudomallei 668]
 gi|126450148|ref|YP_001081797.1| biotin synthase [Burkholderia mallei NCTC 10247]
 gi|167717807|ref|ZP_02401043.1| biotin synthase [Burkholderia pseudomallei DM98]
 gi|217420193|ref|ZP_03451699.1| biotin synthase [Burkholderia pseudomallei 576]
 gi|238562833|ref|ZP_00439814.2| biotin synthase [Burkholderia mallei GB8 horse 4]
 gi|251767531|ref|ZP_02267620.2| biotin synthase [Burkholderia mallei PRL-20]
 gi|254176784|ref|ZP_04883441.1| biotin synthase [Burkholderia mallei ATCC 10399]
 gi|254182032|ref|ZP_04888629.1| biotin synthase [Burkholderia pseudomallei 1655]
 gi|254187962|ref|ZP_04894474.1| biotin synthase [Burkholderia pseudomallei Pasteur 52237]
 gi|254196909|ref|ZP_04903333.1| biotin synthase [Burkholderia pseudomallei S13]
 gi|254207393|ref|ZP_04913744.1| biotin synthase [Burkholderia mallei JHU]
 gi|254359800|ref|ZP_04976071.1| biotin synthase [Burkholderia mallei 2002721280]
 gi|124291347|gb|ABN00616.1| biotin synthase [Burkholderia mallei NCTC 10229]
 gi|126218551|gb|ABN82057.1| biotin synthase [Burkholderia pseudomallei 668]
 gi|126243018|gb|ABO06111.1| biotin synthase [Burkholderia mallei NCTC 10247]
 gi|147752935|gb|EDK60001.1| biotin synthase [Burkholderia mallei JHU]
 gi|148029014|gb|EDK86946.1| biotin synthase [Burkholderia mallei 2002721280]
 gi|157935642|gb|EDO91312.1| biotin synthase [Burkholderia pseudomallei Pasteur 52237]
 gi|160697825|gb|EDP87795.1| biotin synthase [Burkholderia mallei ATCC 10399]
 gi|169653652|gb|EDS86345.1| biotin synthase [Burkholderia pseudomallei S13]
 gi|184212570|gb|EDU09613.1| biotin synthase [Burkholderia pseudomallei 1655]
 gi|217397497|gb|EEC37513.1| biotin synthase [Burkholderia pseudomallei 576]
 gi|238521873|gb|EEP85321.1| biotin synthase [Burkholderia mallei GB8 horse 4]
 gi|243062423|gb|EES44609.1| biotin synthase [Burkholderia mallei PRL-20]
          Length = 339

 Score =  315 bits (808), Expect = 4e-84,   Method: Composition-based stats.
 Identities = 171/305 (56%), Positives = 222/305 (72%)

Query: 18  VWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQSVH 77
            W   +V  +Y +PFNDLLF +   HR++F+ N IQLS LL+IKTGGC E+CGYC+QS H
Sbjct: 25  RWRVADVIALYELPFNDLLFRAQQTHREHFDANAIQLSTLLSIKTGGCEEDCGYCSQSAH 84

Query: 78  NKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLGL 137
           + + LKA KL+ VD VL  A+ AKENGATR+CMGAAWR PK+R +  I +MI+GVK +GL
Sbjct: 85  HDTGLKAEKLMEVDAVLAAARTAKENGATRFCMGAAWRNPKDRHIEPIKEMIRGVKDMGL 144

Query: 138 ETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSGI 197
           ETC+TLGML   QA+ L++AGLDYYNHN+DTS  FY  + +T T++DRL TLE VR +GI
Sbjct: 145 ETCVTLGMLEEHQAKALAEAGLDYYNHNLDTSPEFYGQIISTRTYQDRLDTLERVRDAGI 204

Query: 198 KVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEHVR 257
            VCCGGI+G+GE   +R  ++  LAN++  PES+PIN L+ I G+  E  + +DP E VR
Sbjct: 205 NVCCGGIIGMGESRRERAGLIAQLANMNPYPESVPINNLVAIEGTPLENAQALDPFEFVR 264

Query: 258 IISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTILF 317
            I+VARI MPK+ +RL+AGR  + D +QALCF +GANS+F GD LLT  NP    D  L 
Sbjct: 265 TIAVARITMPKAMVRLSAGREQLDDAMQALCFLAGANSMFYGDVLLTTGNPRAEADRKLL 324

Query: 318 NRLGL 322
            RLG+
Sbjct: 325 ARLGM 329


>gi|254810629|sp|Q3JWR8|BIOB_BURP1 RecName: Full=Biotin synthase
          Length = 336

 Score =  315 bits (808), Expect = 4e-84,   Method: Composition-based stats.
 Identities = 170/305 (55%), Positives = 221/305 (72%)

Query: 18  VWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQSVH 77
            W   +V  +Y +PFNDLLF +   HR++F+ N IQLS LL+IKTGGC E+CGYC+QS H
Sbjct: 22  RWRVADVIALYELPFNDLLFRAQQTHREHFDANAIQLSTLLSIKTGGCEEDCGYCSQSAH 81

Query: 78  NKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLGL 137
           + + LKA KL+ VD VL  A+ AKENGATR+CMGAAWR PK+R +  I +MI+GVK +GL
Sbjct: 82  HDTGLKAEKLMEVDAVLAAARTAKENGATRFCMGAAWRNPKDRHIEPIKEMIRGVKDMGL 141

Query: 138 ETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSGI 197
           ETC+TLGML   QA+ L++AGLDYYNHN+DTS  FY  + +T T++DRL TLE VR +GI
Sbjct: 142 ETCVTLGMLEEHQAKALAEAGLDYYNHNLDTSPEFYGQIISTRTYQDRLDTLERVRDAGI 201

Query: 198 KVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEHVR 257
            VCCGGI+G+GE   +R  ++  LAN++  PES+PIN L+ I G+     + +DP E VR
Sbjct: 202 NVCCGGIIGMGESRRERAGLIAQLANMNPYPESVPINNLVAIEGTPLANAQALDPFEFVR 261

Query: 258 IISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTILF 317
            I+VARI MPK+ +RL+AGR  + D +QALCF +GANS+F GD LLT  NP    D  L 
Sbjct: 262 TIAVARITMPKAMVRLSAGREQLDDAMQALCFLAGANSMFYGDVLLTTGNPRAEADRKLL 321

Query: 318 NRLGL 322
            RLG+
Sbjct: 322 ARLGM 326


>gi|163753454|ref|ZP_02160578.1| biotin synthase [Kordia algicida OT-1]
 gi|161327186|gb|EDP98511.1| biotin synthase [Kordia algicida OT-1]
          Length = 369

 Score =  315 bits (808), Expect = 4e-84,   Method: Composition-based stats.
 Identities = 147/314 (46%), Positives = 219/314 (69%), Gaps = 1/314 (0%)

Query: 13  TKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYC 72
           +     WT +E+  IYN P  +LL+ + T+HR + +PN +Q+S LL+IKTGGCPE+CGYC
Sbjct: 2   SNIRHNWTKEEIIAIYNKPMMELLYEAATIHRLHHDPNTVQVSTLLSIKTGGCPEDCGYC 61

Query: 73  NQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKER-DLSIIVDMIKG 131
            Q+    + ++ + L++V QV  +A  AK +G++R CMGAAWR  K+  +   +++M++ 
Sbjct: 62  PQAARYHTDIEGNDLMSVSQVKAQALRAKSSGSSRVCMGAAWRNVKDGPEFDQVLEMVRT 121

Query: 132 VKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLEN 191
           +  L +E C TLGM++  QAQ L++AGL  YNHN+D+SE +Y  V +T  +EDRL+T++N
Sbjct: 122 INKLDMEVCCTLGMVTENQAQRLAEAGLYAYNHNLDSSEEYYKEVISTRGYEDRLETIDN 181

Query: 192 VRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVD 251
           VRK+ + VC GGI+G+GE ++DR  ML+ LA L+  PES+PIN L+ + G+  E  K V+
Sbjct: 182 VRKTNVTVCSGGIIGMGESVEDRAGMLVALATLNPQPESVPINALVAVDGTPLENEKPVE 241

Query: 252 PIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYN 311
             E +R+++  RI+MP++++RL+AGR  MS E QA+CFF+GANSIF GD LLT  NP  N
Sbjct: 242 IWEMIRMVATTRIVMPETQVRLSAGRTNMSREGQAMCFFAGANSIFAGDKLLTTPNPDVN 301

Query: 312 KDTILFNRLGLIPD 325
           +D  +F  LGL P 
Sbjct: 302 EDMKMFEMLGLNPQ 315


>gi|299770456|ref|YP_003732482.1| biotin synthase [Acinetobacter sp. DR1]
 gi|298700544|gb|ADI91109.1| biotin synthase [Acinetobacter sp. DR1]
          Length = 329

 Score =  315 bits (808), Expect = 4e-84,   Method: Composition-based stats.
 Identities = 170/310 (54%), Positives = 229/310 (73%)

Query: 16  PKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQS 75
              W  +E+  +Y  PF DL+F +  VHR++F  N IQ+S LL+IKTG CPE+C YC+QS
Sbjct: 4   RNDWNREEIQALYEQPFLDLVFKAQQVHREHFTANSIQVSTLLSIKTGKCPEDCKYCSQS 63

Query: 76  VHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSL 135
            H +SKL+A K I V++V+ EAK AK++G++R+CMGAAWR P ERD+  +++M++ VK+L
Sbjct: 64  AHYESKLEAEKRIAVEKVISEAKAAKDSGSSRFCMGAAWRNPHERDMPYVLEMVREVKAL 123

Query: 136 GLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKS 195
           GLETCMTLGML+  QA+ L  AGLDYYNHN+DTS  +Y H+ +T TF+DRL TL+ VR++
Sbjct: 124 GLETCMTLGMLNQSQAERLQVAGLDYYNHNLDTSREYYSHIISTRTFDDRLNTLDYVRQA 183

Query: 196 GIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEH 255
           G+KVC GGI+GLGE  DDR+ +L  LA L   PES+PIN+L+PI G+   + +K+D IE 
Sbjct: 184 GMKVCSGGIVGLGESRDDRVGLLHELATLPIHPESVPINMLVPIEGTPLADVEKLDVIEW 243

Query: 256 VRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTI 315
           +R I+VARI+MP S +RL+AGR  +SD  QAL F +GANS+F GD LLT  N    KD  
Sbjct: 244 IRTIAVARIIMPHSYIRLSAGRESLSDSDQALAFMAGANSLFSGDKLLTTPNAGEGKDQA 303

Query: 316 LFNRLGLIPD 325
           LFN+LGL  +
Sbjct: 304 LFNKLGLTAE 313


>gi|126455331|ref|YP_001064692.1| biotin synthase [Burkholderia pseudomallei 1106a]
 gi|226200314|ref|ZP_03795858.1| biotin synthase [Burkholderia pseudomallei Pakistan 9]
 gi|254810584|sp|A3NQS1|BIOB_BURP0 RecName: Full=Biotin synthase
 gi|254810623|sp|Q63Y25|BIOB_BURPS RecName: Full=Biotin synthase
 gi|126228973|gb|ABN92513.1| biotin synthase [Burkholderia pseudomallei 1106a]
 gi|225927636|gb|EEH23679.1| biotin synthase [Burkholderia pseudomallei Pakistan 9]
          Length = 336

 Score =  315 bits (808), Expect = 4e-84,   Method: Composition-based stats.
 Identities = 171/305 (56%), Positives = 222/305 (72%)

Query: 18  VWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQSVH 77
            W   +V  +Y +PFNDLLF +   HR++F+ N IQLS LL+IKTGGC E+CGYC+QS H
Sbjct: 22  RWRVADVIALYELPFNDLLFRAQQTHREHFDANAIQLSTLLSIKTGGCEEDCGYCSQSAH 81

Query: 78  NKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLGL 137
           + + LKA KL+ VD VL  A+ AKENGATR+CMGAAWR PK+R +  I +MI+GVK +GL
Sbjct: 82  HDTGLKAEKLMEVDAVLAAARTAKENGATRFCMGAAWRNPKDRHIEPIKEMIRGVKDMGL 141

Query: 138 ETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSGI 197
           ETC+TLGML   QA+ L++AGLDYYNHN+DTS  FY  + +T T++DRL TLE VR +GI
Sbjct: 142 ETCVTLGMLEEHQAKALAEAGLDYYNHNLDTSPEFYGQIISTRTYQDRLDTLERVRDAGI 201

Query: 198 KVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEHVR 257
            VCCGGI+G+GE   +R  ++  LAN++  PES+PIN L+ I G+  E  + +DP E VR
Sbjct: 202 NVCCGGIIGMGESRRERAGLIAQLANMNPYPESVPINNLVAIEGTPLENAQALDPFEFVR 261

Query: 258 IISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTILF 317
            I+VARI MPK+ +RL+AGR  + D +QALCF +GANS+F GD LLT  NP    D  L 
Sbjct: 262 TIAVARITMPKAMVRLSAGREQLDDAMQALCFLAGANSMFYGDVLLTTGNPRAEADRKLL 321

Query: 318 NRLGL 322
            RLG+
Sbjct: 322 ARLGM 326


>gi|253998276|ref|YP_003050339.1| biotin synthase [Methylovorus sp. SIP3-4]
 gi|313200349|ref|YP_004039007.1| biotin synthase [Methylovorus sp. MP688]
 gi|253984955|gb|ACT49812.1| biotin synthase [Methylovorus sp. SIP3-4]
 gi|312439665|gb|ADQ83771.1| biotin synthase [Methylovorus sp. MP688]
          Length = 330

 Score =  315 bits (808), Expect = 4e-84,   Method: Composition-based stats.
 Identities = 165/312 (52%), Positives = 218/312 (69%)

Query: 13  TKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYC 72
            +  K WT  ++ +++ MPF+DL+  + TVHR+NF+PN +Q+S LL+IKTGGC E+CGYC
Sbjct: 18  VEAEKRWTVAQIVELFEMPFSDLIHRAQTVHRQNFDPNAVQVSTLLSIKTGGCSEDCGYC 77

Query: 73  NQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGV 132
            Q+    + ++   L+ +D VL+ AK AKENGA+R+CMGAAWR PK+RDL  ++ MI  V
Sbjct: 78  PQAARYHTDVENEPLMALDAVLEAAKAAKENGASRFCMGAAWRSPKQRDLEPVLKMIAEV 137

Query: 133 KSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENV 192
           K++GLETC TLGML   QA+ L  AGLDYYNHN+DT+  FY  V TT T++DRL TL+ V
Sbjct: 138 KAMGLETCATLGMLKDGQAEQLKDAGLDYYNHNLDTAPEFYGDVITTRTYQDRLDTLDRV 197

Query: 193 RKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDP 252
           R + I VCCGGI+G+GE    R  +L  LAN+  PPES+PINLL  + G+      ++DP
Sbjct: 198 RDADINVCCGGIIGMGESRVQRAGLLAQLANMERPPESVPINLLTQVEGTPLHGTDELDP 257

Query: 253 IEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNK 312
            E VR I+ ARI MP S +RL+AGR  M + +QALCF +GANSIF G+ LLT  NP    
Sbjct: 258 FEFVRTIAAARITMPGSYVRLSAGRQSMHEGIQALCFIAGANSIFYGEKLLTTGNPEAEA 317

Query: 313 DTILFNRLGLIP 324
           D  LF +LGL P
Sbjct: 318 DRALFAKLGLHP 329


>gi|262171853|ref|ZP_06039531.1| biotin synthase [Vibrio mimicus MB-451]
 gi|261892929|gb|EEY38915.1| biotin synthase [Vibrio mimicus MB-451]
          Length = 350

 Score =  315 bits (808), Expect = 4e-84,   Method: Composition-based stats.
 Identities = 165/313 (52%), Positives = 234/313 (74%)

Query: 16  PKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQS 75
              WT  EV  + + PF DLLF +  VHR +   NH+Q+S LL+IKTG CPE+C YC QS
Sbjct: 4   RHNWTVAEVKALLDKPFMDLLFEAQQVHRLHHPHNHVQVSTLLSIKTGACPEDCKYCPQS 63

Query: 76  VHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSL 135
            H ++ +   +L+ V++VL  A+ AK +G+TR+CMGAAW+ PKERD+ ++ +MI+GVK +
Sbjct: 64  AHYRTDVDKERLMEVERVLDAAQKAKTSGSTRFCMGAAWKNPKERDMPLLKEMIRGVKDM 123

Query: 136 GLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKS 195
           GLETCMTLGML+ +QAQ L++AGLDYYNHN+DTS  +Y ++ TT T++DRL TL +VR +
Sbjct: 124 GLETCMTLGMLTADQAQQLAEAGLDYYNHNLDTSPEYYGNIITTRTYQDRLDTLSHVRDA 183

Query: 196 GIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEH 255
           G+K+C GGI+G+GE  +DR  +L+ LANLST PES+PIN+L+ + G+  E+   V+P + 
Sbjct: 184 GMKICSGGIIGMGESTNDRAGLLVELANLSTHPESVPINMLVKVKGTPLEQVDDVEPFDF 243

Query: 256 VRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTI 315
           VR+I+VARI+MPKS +RL+AGR  M++++QALCF +GANSIF G  LLT  NP+ + D +
Sbjct: 244 VRLIAVARIMMPKSAVRLSAGREKMNEQMQALCFMAGANSIFYGCKLLTTPNPAEDSDML 303

Query: 316 LFNRLGLIPDLSA 328
           LF +LG+  +  A
Sbjct: 304 LFKKLGINREQVA 316


>gi|260768125|ref|ZP_05877059.1| biotin synthase [Vibrio furnissii CIP 102972]
 gi|260616155|gb|EEX41340.1| biotin synthase [Vibrio furnissii CIP 102972]
          Length = 350

 Score =  315 bits (808), Expect = 5e-84,   Method: Composition-based stats.
 Identities = 163/315 (51%), Positives = 230/315 (73%)

Query: 14  KKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCN 73
           +    WT  EV  +   PF DLLF +  VHR++   NH+Q+S LL+IKTG CPE+C YC 
Sbjct: 2   EIRHNWTVAEVKALLEKPFMDLLFDAQLVHRQHHPHNHVQVSTLLSIKTGACPEDCKYCP 61

Query: 74  QSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVK 133
           QS H ++ +   +L+ V++VL  A+ AK +G+TR+CMGAAW+ PK RD+ ++ +MI GVK
Sbjct: 62  QSAHYRTDVDKERLMEVERVLDAAQKAKSSGSTRFCMGAAWKNPKARDMPLLKEMISGVK 121

Query: 134 SLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVR 193
            +GLETCMTLGML+ +QAQ L+ AGLDYYNHN+DTS  FY ++ TT T++DRL TL +VR
Sbjct: 122 GMGLETCMTLGMLTSDQAQELADAGLDYYNHNLDTSPEFYGNIITTRTYQDRLDTLSHVR 181

Query: 194 KSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPI 253
            +G+K+C GGI+G+GE  +DR  +L+ LANLS  PES+PIN+L+ + G+  E+   V+P 
Sbjct: 182 DAGMKICSGGIIGMGESTNDRAGLLVELANLSVHPESVPINMLVKVKGTPLEQVDDVEPF 241

Query: 254 EHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKD 313
           + VR+I+VARI+MP+S +RL+AGR  M++++QALCF +GANSIF G  LLT  NP+ + D
Sbjct: 242 DFVRLIAVARIMMPQSAVRLSAGREKMNEQMQALCFMAGANSIFYGCKLLTTPNPAEDSD 301

Query: 314 TILFNRLGLIPDLSA 328
            +LF +LG+     A
Sbjct: 302 MLLFKKLGINSQQVA 316


>gi|254810627|sp|Q481G0|BIOB_COLP3 RecName: Full=Biotin synthase
          Length = 346

 Score =  315 bits (808), Expect = 5e-84,   Method: Composition-based stats.
 Identities = 170/317 (53%), Positives = 233/317 (73%)

Query: 12  PTKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGY 71
            +     W  KEV  ++ MPFNDL+F + T+HR+NF PN +Q+S LL+IKTG CPE+C Y
Sbjct: 2   NSILRHNWNLKEVEALFAMPFNDLMFKAQTIHRENFNPNEVQVSTLLSIKTGACPEDCKY 61

Query: 72  CNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKG 131
           C+QS  NK+ L+   L+ V++VL+ A+ AKE G+TR+CMGAAWR PKERD+  ++DM+K 
Sbjct: 62  CSQSARNKTDLEKESLLAVEKVLEAAQRAKEMGSTRFCMGAAWRNPKERDMPYVLDMVKS 121

Query: 132 VKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLEN 191
           VK+LG+ETCMTLGMLS +QA  L+ AGLDYYNHN+DTS   Y  + TT TF+DRL TL N
Sbjct: 122 VKALGMETCMTLGMLSGDQADQLNGAGLDYYNHNLDTSPEHYNQIITTRTFQDRLDTLSN 181

Query: 192 VRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVD 251
           VR +G+KVC GGI+GLGE   DR  +L+ LANL+  PES+PIN+L+ + G+   +   ++
Sbjct: 182 VRSAGMKVCSGGIVGLGEKAVDRSSLLIQLANLNPQPESVPINMLVKVEGTPLADIDDLE 241

Query: 252 PIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYN 311
             + +R I+VARI+MP S +RL+AGR  M++++QA+CF +GANSIF G  LLTA+NP  N
Sbjct: 242 SFDFIRCIAVARIMMPHSHVRLSAGRTAMNEQMQAMCFLAGANSIFYGCKLLTAENPETN 301

Query: 312 KDTILFNRLGLIPDLSA 328
           +D  LF +LG+  +  A
Sbjct: 302 QDIALFEKLGINTETVA 318


>gi|227823052|ref|YP_002827024.1| biotin synthase BioB [Sinorhizobium fredii NGR234]
 gi|227342053|gb|ACP26271.1| biotin synthase BioB [Sinorhizobium fredii NGR234]
          Length = 339

 Score =  315 bits (808), Expect = 5e-84,   Method: Composition-based stats.
 Identities = 204/316 (64%), Positives = 252/316 (79%)

Query: 10  ENPTKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENC 69
           EN T     W   E  +IYN+PFNDLLF + +VHR +F+PN +Q+S+LL+IKTGGC E+C
Sbjct: 13  ENSTAGGAHWNLVEARKIYNLPFNDLLFRAQSVHRAHFDPNAVQMSRLLSIKTGGCAEDC 72

Query: 70  GYCNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMI 129
           GYC+QS H  + LKASKL+ V++V+ EA+ AKE GATRYCMGAAWR PKERD+ +IV M+
Sbjct: 73  GYCSQSAHYPTGLKASKLMEVERVIAEARRAKEGGATRYCMGAAWRSPKERDMEVIVAMV 132

Query: 130 KGVKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTL 189
           +GV+SLG+E CMTLGMLS +Q++ L+ AGLDYYNHN+DTSERFY  + TT TF DRL TL
Sbjct: 133 RGVRSLGMEACMTLGMLSPQQSERLADAGLDYYNHNVDTSERFYSEIITTRTFADRLDTL 192

Query: 190 ENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKK 249
            NVR++GIKVC GGILG+GE ++DRI ML+TLANL   PES+PIN+LIPIPGSK  +   
Sbjct: 193 ANVREAGIKVCAGGILGMGETVEDRISMLVTLANLPAAPESVPINMLIPIPGSKLADAAP 252

Query: 250 VDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPS 309
           VDPI+ VR I++ARILMP S +RL+AGR  MSDE+QALCFF+GANSIFVG+TLLTA NP 
Sbjct: 253 VDPIDFVRTIALARILMPLSHVRLSAGRTEMSDEMQALCFFAGANSIFVGETLLTADNPG 312

Query: 310 YNKDTILFNRLGLIPD 325
            + D  LF RLGL P 
Sbjct: 313 EDHDAALFRRLGLKPM 328


>gi|53724641|ref|YP_101948.1| biotin synthase [Burkholderia mallei ATCC 23344]
 gi|52428064|gb|AAU48657.1| biotin synthase [Burkholderia mallei ATCC 23344]
          Length = 322

 Score =  315 bits (807), Expect = 5e-84,   Method: Composition-based stats.
 Identities = 171/305 (56%), Positives = 222/305 (72%)

Query: 18  VWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQSVH 77
            W   +V  +Y +PFNDLLF +   HR++F+ N IQLS LL+IKTGGC E+CGYC+QS H
Sbjct: 8   RWRVADVIALYELPFNDLLFRAQQTHREHFDANAIQLSTLLSIKTGGCEEDCGYCSQSAH 67

Query: 78  NKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLGL 137
           + + LKA KL+ VD VL  A+ AKENGATR+CMGAAWR PK+R +  I +MI+GVK +GL
Sbjct: 68  HDTGLKAEKLMEVDAVLAAARTAKENGATRFCMGAAWRNPKDRHIEPIKEMIRGVKDMGL 127

Query: 138 ETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSGI 197
           ETC+TLGML   QA+ L++AGLDYYNHN+DTS  FY  + +T T++DRL TLE VR +GI
Sbjct: 128 ETCVTLGMLEEHQAKALAEAGLDYYNHNLDTSPEFYGQIISTRTYQDRLDTLERVRDAGI 187

Query: 198 KVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEHVR 257
            VCCGGI+G+GE   +R  ++  LAN++  PES+PIN L+ I G+  E  + +DP E VR
Sbjct: 188 NVCCGGIIGMGESRRERAGLIAQLANMNPYPESVPINNLVAIEGTPLENAQALDPFEFVR 247

Query: 258 IISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTILF 317
            I+VARI MPK+ +RL+AGR  + D +QALCF +GANS+F GD LLT  NP    D  L 
Sbjct: 248 TIAVARITMPKAMVRLSAGREQLDDAMQALCFLAGANSMFYGDVLLTTGNPRAEADRKLL 307

Query: 318 NRLGL 322
            RLG+
Sbjct: 308 ARLGM 312


>gi|76811463|ref|YP_331985.1| biotin synthase [Burkholderia pseudomallei 1710b]
 gi|254258901|ref|ZP_04949955.1| biotin synthase [Burkholderia pseudomallei 1710a]
 gi|76580916|gb|ABA50391.1| biotin synthase [Burkholderia pseudomallei 1710b]
 gi|254217590|gb|EET06974.1| biotin synthase [Burkholderia pseudomallei 1710a]
          Length = 339

 Score =  315 bits (807), Expect = 5e-84,   Method: Composition-based stats.
 Identities = 170/305 (55%), Positives = 221/305 (72%)

Query: 18  VWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQSVH 77
            W   +V  +Y +PFNDLLF +   HR++F+ N IQLS LL+IKTGGC E+CGYC+QS H
Sbjct: 25  RWRVADVIALYELPFNDLLFRAQQTHREHFDANAIQLSTLLSIKTGGCEEDCGYCSQSAH 84

Query: 78  NKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLGL 137
           + + LKA KL+ VD VL  A+ AKENGATR+CMGAAWR PK+R +  I +MI+GVK +GL
Sbjct: 85  HDTGLKAEKLMEVDAVLAAARTAKENGATRFCMGAAWRNPKDRHIEPIKEMIRGVKDMGL 144

Query: 138 ETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSGI 197
           ETC+TLGML   QA+ L++AGLDYYNHN+DTS  FY  + +T T++DRL TLE VR +GI
Sbjct: 145 ETCVTLGMLEEHQAKALAEAGLDYYNHNLDTSPEFYGQIISTRTYQDRLDTLERVRDAGI 204

Query: 198 KVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEHVR 257
            VCCGGI+G+GE   +R  ++  LAN++  PES+PIN L+ I G+     + +DP E VR
Sbjct: 205 NVCCGGIIGMGESRRERAGLIAQLANMNPYPESVPINNLVAIEGTPLANAQALDPFEFVR 264

Query: 258 IISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTILF 317
            I+VARI MPK+ +RL+AGR  + D +QALCF +GANS+F GD LLT  NP    D  L 
Sbjct: 265 TIAVARITMPKAMVRLSAGREQLDDAMQALCFLAGANSMFYGDVLLTTGNPRAEADRKLL 324

Query: 318 NRLGL 322
            RLG+
Sbjct: 325 ARLGM 329


>gi|166714085|ref|ZP_02245292.1| biotin synthase [Xanthomonas oryzae pv. oryzicola BLS256]
          Length = 344

 Score =  315 bits (807), Expect = 5e-84,   Method: Composition-based stats.
 Identities = 162/311 (52%), Positives = 220/311 (70%)

Query: 16  PKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQS 75
              W  KE+  ++++PF +LL  + +VHR +F+P  +Q+S LL++KTGGCPE+C YC Q+
Sbjct: 6   RHDWDHKELQALFDLPFPELLHRAASVHRAHFDPAEVQVSTLLSVKTGGCPEDCAYCPQA 65

Query: 76  VHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSL 135
               + + A KL+  ++V+ +A+ AK  GA+R+CMGAAWR PKERD+  +  MI+ VK++
Sbjct: 66  QRYDTGVTAQKLLETEEVVAKARQAKAAGASRFCMGAAWRSPKERDIPKVAAMIREVKAM 125

Query: 136 GLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKS 195
           GLETC TLGML   QA+ L  AGLDYYNHN+DT+  +Y  +  T  ++DRL TLE+VR  
Sbjct: 126 GLETCATLGMLDAGQARALKDAGLDYYNHNLDTAPDYYDTIIHTRQYQDRLNTLEHVRDV 185

Query: 196 GIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEH 255
           G+K CCGGI+G+GE  D RI +LL LA L   P+S+PIN L+ +PG+     +++DP E 
Sbjct: 186 GLKTCCGGIVGMGETRDHRIGLLLALATLPAHPDSVPINQLVQVPGTPLHGTQQLDPFEF 245

Query: 256 VRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTI 315
           VR+I+VARI MPKS +RL+AGR  MSDELQALCF +GANSIF G+ LLT  NP   +D  
Sbjct: 246 VRMIAVARIAMPKSMVRLSAGREAMSDELQALCFLAGANSIFYGEKLLTTGNPETERDQA 305

Query: 316 LFNRLGLIPDL 326
           LF RLGL P  
Sbjct: 306 LFQRLGLRPMQ 316


>gi|284037294|ref|YP_003387224.1| biotin synthase [Spirosoma linguale DSM 74]
 gi|283816587|gb|ADB38425.1| biotin synthase [Spirosoma linguale DSM 74]
          Length = 330

 Score =  315 bits (807), Expect = 6e-84,   Method: Composition-based stats.
 Identities = 157/313 (50%), Positives = 213/313 (68%), Gaps = 1/313 (0%)

Query: 16  PKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQS 75
              WT  E+ +IYN P  DL++ + TVHR+  +P  +Q+  LL++KTGGCPE+C YC Q+
Sbjct: 2   RTDWTRAEIAEIYNSPVLDLMYRAATVHRQYHDPQEVQVCTLLSVKTGGCPEDCAYCPQA 61

Query: 76  VHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKE-RDLSIIVDMIKGVKS 134
               + +K  KL+ VD+VL  A+ AK+ G+TR+CMGAAWRE ++  D   ++DM+ GV  
Sbjct: 62  ARYHTAVKVHKLMEVDEVLTAAQRAKDTGSTRFCMGAAWREVRDNSDFDKVLDMVHGVNE 121

Query: 135 LGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRK 194
           +GLE C TLGML+  QAQ L  AGL  YNHN+DTSE FY  + +T T++DRL TL + RK
Sbjct: 122 MGLEVCCTLGMLTETQAQKLKDAGLYAYNHNLDTSEEFYGDIISTRTYDDRLDTLGHARK 181

Query: 195 SGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIE 254
           +GI VC GGI+G+GE   DRI ML TLA L   PES+P+N L+P+ G+  E+  +V   E
Sbjct: 182 AGISVCSGGIIGMGESDQDRIGMLHTLATLPQHPESVPVNALVPVEGTPLEDQPRVSVWE 241

Query: 255 HVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDT 314
            +R+I+ ARI+MPK+ +RL+AGR  M+ E QALCF +GANSIF GD LLT  NP  + D 
Sbjct: 242 MIRMIATARIIMPKAMVRLSAGRVRMNTEEQALCFLAGANSIFAGDKLLTTPNPDEDADQ 301

Query: 315 ILFNRLGLIPDLS 327
            LF  L + P  +
Sbjct: 302 QLFQTLNIRPRKA 314


>gi|53718004|ref|YP_106990.1| biotin synthase [Burkholderia pseudomallei K96243]
 gi|242316301|ref|ZP_04815317.1| biotin synthase [Burkholderia pseudomallei 1106b]
 gi|254295920|ref|ZP_04963377.1| biotin synthase [Burkholderia pseudomallei 406e]
 gi|52208418|emb|CAH34352.1| biotin synthase [Burkholderia pseudomallei K96243]
 gi|157806148|gb|EDO83318.1| biotin synthase [Burkholderia pseudomallei 406e]
 gi|242139540|gb|EES25942.1| biotin synthase [Burkholderia pseudomallei 1106b]
          Length = 339

 Score =  315 bits (807), Expect = 6e-84,   Method: Composition-based stats.
 Identities = 171/305 (56%), Positives = 222/305 (72%)

Query: 18  VWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQSVH 77
            W   +V  +Y +PFNDLLF +   HR++F+ N IQLS LL+IKTGGC E+CGYC+QS H
Sbjct: 25  RWRVADVIALYELPFNDLLFRAQQTHREHFDANAIQLSTLLSIKTGGCEEDCGYCSQSAH 84

Query: 78  NKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLGL 137
           + + LKA KL+ VD VL  A+ AKENGATR+CMGAAWR PK+R +  I +MI+GVK +GL
Sbjct: 85  HDTGLKAEKLMEVDAVLAAARTAKENGATRFCMGAAWRNPKDRHIEPIKEMIRGVKDMGL 144

Query: 138 ETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSGI 197
           ETC+TLGML   QA+ L++AGLDYYNHN+DTS  FY  + +T T++DRL TLE VR +GI
Sbjct: 145 ETCVTLGMLEEHQAKALAEAGLDYYNHNLDTSPEFYGQIISTRTYQDRLDTLERVRDAGI 204

Query: 198 KVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEHVR 257
            VCCGGI+G+GE   +R  ++  LAN++  PES+PIN L+ I G+  E  + +DP E VR
Sbjct: 205 NVCCGGIIGMGESRRERAGLIAQLANMNPYPESVPINNLVAIEGTPLENAQALDPFEFVR 264

Query: 258 IISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTILF 317
            I+VARI MPK+ +RL+AGR  + D +QALCF +GANS+F GD LLT  NP    D  L 
Sbjct: 265 TIAVARITMPKAMVRLSAGREQLDDAMQALCFLAGANSMFYGDVLLTTGNPRAEADRKLL 324

Query: 318 NRLGL 322
            RLG+
Sbjct: 325 ARLGM 329


>gi|83648030|ref|YP_436465.1| biotin synthase [Hahella chejuensis KCTC 2396]
 gi|123726290|sp|Q2SBD4|BIOB_HAHCH RecName: Full=Biotin synthase
 gi|83636073|gb|ABC32040.1| biotin synthase [Hahella chejuensis KCTC 2396]
          Length = 354

 Score =  315 bits (807), Expect = 6e-84,   Method: Composition-based stats.
 Identities = 168/314 (53%), Positives = 237/314 (75%)

Query: 13  TKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYC 72
           +     W+ +EV  ++ +PFNDLLF +   HR+NF+PN +Q+S LL+IKTG CPE+C YC
Sbjct: 3   SPIRHDWSLEEVEALFALPFNDLLFQAQVTHRRNFDPNEVQVSTLLSIKTGACPEDCKYC 62

Query: 73  NQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGV 132
            QS H  + L+  KL+ V++V+ EAK AKE GA+R+CMGAAWR P+ +D+  +++M+K V
Sbjct: 63  PQSGHYNTGLEKEKLLEVEKVVNEAKAAKEKGASRFCMGAAWRNPRAKDMPYVLEMVKQV 122

Query: 133 KSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENV 192
           KSLG+ETCMTLGML+ +QA  L+ AGLDYYNHN+DTSE +Y  + TT T+ DRL+TL+NV
Sbjct: 123 KSLGMETCMTLGMLTADQASELAGAGLDYYNHNLDTSENYYGEIITTRTYSDRLETLQNV 182

Query: 193 RKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDP 252
           R +G+KVCCGGI+G+GE   DR  +L  LANL + PES+PIN+L+ + G+  E  + +DP
Sbjct: 183 RDAGMKVCCGGIMGMGESARDRAALLAQLANLPSHPESVPINMLVKVKGTPLEVQEDIDP 242

Query: 253 IEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNK 312
            + +R I+VARILMP+S +RL+AGR  M++++QA+CF +GANSIF G+ LLT  NP  +K
Sbjct: 243 FDFIRTIAVARILMPRSHVRLSAGREDMNEQMQAMCFLAGANSIFYGEKLLTTPNPEADK 302

Query: 313 DTILFNRLGLIPDL 326
           D +LF +LG+ P+ 
Sbjct: 303 DMMLFKKLGIRPEQ 316


>gi|172087814|ref|YP_001816747.1| biotin synthase [Vibrio fischeri ES114]
 gi|254811605|sp|B1WN69|BIOB_VIBF1 RecName: Full=Biotin synthase
 gi|171902397|gb|ACB55715.1| biotin synthase [Vibrio fischeri ES114]
          Length = 350

 Score =  315 bits (807), Expect = 6e-84,   Method: Composition-based stats.
 Identities = 162/313 (51%), Positives = 228/313 (72%)

Query: 16  PKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQS 75
              WT  EV  + + PF DL+F +  VHRK  + NH+Q+S LL+IKTG CPE+C YC QS
Sbjct: 4   RHNWTVAEVQTLMDKPFMDLIFEAQLVHRKYQQANHVQVSTLLSIKTGACPEDCKYCPQS 63

Query: 76  VHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSL 135
            H ++ +   +L+ V+ VL  AK AK +G+TR+CMGAAW+ PKERD+  ++DMIKGVK +
Sbjct: 64  AHYRTDVDRERLMEVESVLDAAKKAKNSGSTRFCMGAAWKNPKERDMPYLLDMIKGVKEM 123

Query: 136 GLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKS 195
           GLETCMTLGM++ +QA  LS+AGLDYYNHN+DTS  FY ++ TT T++DRL TL +VR +
Sbjct: 124 GLETCMTLGMITADQAGELSEAGLDYYNHNLDTSPEFYGNIITTRTYQDRLDTLSHVRDA 183

Query: 196 GIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEH 255
           G+K+C GGI+G+GE   DR  + + LANL   PES+P+N+L+ + G+  E+ + VDP + 
Sbjct: 184 GMKICSGGIIGMGESASDRAGLFVELANLPQHPESVPVNMLVKVKGTPLEDAEDVDPFDF 243

Query: 256 VRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTI 315
           +R+I+VARI+MP+S +RL+AGR  M++++QALCF +GANS+F G  LLT  NP  + D  
Sbjct: 244 IRLIAVARIMMPESAVRLSAGRESMNEQMQALCFMAGANSVFYGCKLLTTPNPDEDTDMQ 303

Query: 316 LFNRLGLIPDLSA 328
           LF +LG+  +  A
Sbjct: 304 LFKKLGVNSEQVA 316


>gi|163787120|ref|ZP_02181567.1| biotin synthase [Flavobacteriales bacterium ALC-1]
 gi|159877008|gb|EDP71065.1| biotin synthase [Flavobacteriales bacterium ALC-1]
          Length = 364

 Score =  315 bits (807), Expect = 6e-84,   Method: Composition-based stats.
 Identities = 147/314 (46%), Positives = 220/314 (70%), Gaps = 1/314 (0%)

Query: 13  TKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYC 72
           ++    WT +E+ +IYN P  +LL+ + T HR++ +PN +Q+S LL+IKTGGCPE+CGYC
Sbjct: 2   SEVRHNWTKEEILEIYNKPLMELLYEAATTHREHHDPNTVQVSTLLSIKTGGCPEDCGYC 61

Query: 73  NQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKER-DLSIIVDMIKG 131
            Q+    + ++ + L++V QV  +A  AK +G++R CMGAAWR  K+  +   +++M++ 
Sbjct: 62  PQAARYHTDIEGNDLMSVQQVKAQALRAKSSGSSRVCMGAAWRNVKDGPEFDQVLEMVRT 121

Query: 132 VKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLEN 191
           +  L +E C TLGM++  QAQ L++AGL  YNHN+D+SE +Y  V +T  FEDRL+T++N
Sbjct: 122 INKLDMEVCCTLGMVTENQAQRLAEAGLYAYNHNLDSSEEYYKEVISTRGFEDRLETIDN 181

Query: 192 VRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVD 251
           VRK+ + VC GGI+G+GE  +DR  ML+ L+ L+  PES+PIN L+ + G+  EE K V 
Sbjct: 182 VRKTNVTVCSGGIIGMGEKEEDRGGMLVALSTLNPQPESVPINALVAVEGTPLEEEKPVS 241

Query: 252 PIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYN 311
             + VR+++  RI+MP++++RL+AGR  M+ E QA+CFF+GANSIF GD LLT  NP  N
Sbjct: 242 IWDMVRMVATTRIVMPETQVRLSAGRTQMTREGQAMCFFAGANSIFAGDKLLTTPNPDVN 301

Query: 312 KDTILFNRLGLIPD 325
           +D  +F  LGL P 
Sbjct: 302 EDMEMFKLLGLNPQ 315


>gi|289664361|ref|ZP_06485942.1| biotin synthase [Xanthomonas campestris pv. vasculorum NCPPB702]
          Length = 344

 Score =  315 bits (806), Expect = 6e-84,   Method: Composition-based stats.
 Identities = 162/311 (52%), Positives = 219/311 (70%)

Query: 16  PKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQS 75
              W  KE+  + ++PF +LL  +  VHR +F+P  +Q+S LL++KTGGCPE+C YC Q+
Sbjct: 6   RHDWDHKELQSLLDLPFPELLHRAANVHRAHFDPAEVQVSTLLSVKTGGCPEDCAYCPQA 65

Query: 76  VHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSL 135
               + + A KL+  ++V+ +A+ AK  GA+R+CMGAAWR PKERD+  +  MI+ VK++
Sbjct: 66  QRYDTGVTAQKLMETEEVVAKARQAKAAGASRFCMGAAWRSPKERDIPKVAAMIREVKAM 125

Query: 136 GLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKS 195
           GLETC TLGML   QA+ L  AGLDYYNHN+DT+  +Y  +  T  ++DRL TLE+VR  
Sbjct: 126 GLETCATLGMLDAGQARALKDAGLDYYNHNLDTAPDYYDSIIHTRQYQDRLNTLEHVRDV 185

Query: 196 GIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEH 255
           G+K CCGGI+G+GE  D RI +LL LA L   P+S+PIN L+ +PG+     +++DP E 
Sbjct: 186 GLKTCCGGIVGMGETRDHRIGLLLALATLPAHPDSVPINQLVQVPGTPLHGTQQLDPFEF 245

Query: 256 VRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTI 315
           VR+I+VARI+MPKS +RL+AGR  MSDELQALCF +GANSIF G+ LLT  NP   +D  
Sbjct: 246 VRMIAVARIVMPKSMVRLSAGREAMSDELQALCFLAGANSIFYGEKLLTTGNPDTERDQA 305

Query: 316 LFNRLGLIPDL 326
           LF RLGL P  
Sbjct: 306 LFQRLGLRPMQ 316


>gi|219681656|ref|YP_002468042.1| biotin synthetase [Buchnera aphidicola str. 5A (Acyrthosiphon
           pisum)]
 gi|257471345|ref|ZP_05635344.1| biotin synthetase [Buchnera aphidicola str. LSR1 (Acyrthosiphon
           pisum)]
 gi|254810576|sp|B8D983|BIOB_BUCA5 RecName: Full=Biotin synthase
 gi|219624499|gb|ACL30654.1| biotin synthetase [Buchnera aphidicola str. 5A (Acyrthosiphon
           pisum)]
          Length = 343

 Score =  315 bits (806), Expect = 7e-84,   Method: Composition-based stats.
 Identities = 166/309 (53%), Positives = 230/309 (74%)

Query: 17  KVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQSV 76
           K WT +E   ++  PF +L+F +   HRKNF+PN IQ+S LL+IKTG CPE+C YC QS 
Sbjct: 3   KKWTLEETKMLFKKPFFNLMFQAQEEHRKNFDPNTIQISTLLSIKTGSCPEDCKYCPQSS 62

Query: 77  HNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLG 136
             K+ LK   L+ ++Q+L  AK AK++G++R+CMGAAW+ PKE+D+  +  +IK +K +G
Sbjct: 63  RYKTGLKKEPLLEIEQILSAAKKAKDSGSSRFCMGAAWKNPKEKDMPYLEKIIKKIKEMG 122

Query: 137 LETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSG 196
           +ETCMTLG L+  QA+ L+ AGLD+YNHN+DTS+ FY ++ TT T+++RL TL  VR SG
Sbjct: 123 METCMTLGTLNSTQAKKLADAGLDFYNHNLDTSKNFYSNIITTRTYQERLHTLHAVRSSG 182

Query: 197 IKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEHV 256
           +KVC GGI+GLGE   DRI++L+ L+NLS  PES+PIN+L+ IPG+   +NK V+P + +
Sbjct: 183 MKVCSGGIIGLGEKKQDRIELLIELSNLSIQPESVPINMLVKIPGTPMADNKDVEPFDFI 242

Query: 257 RIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTIL 316
           RII+VARI+MPKS +RL+AGR  M+D+ QA+CF +GANSIF G  LLT+ NP    D  L
Sbjct: 243 RIIAVARIMMPKSYIRLSAGRHKMNDQTQAMCFMAGANSIFYGCKLLTSDNPEEKHDLEL 302

Query: 317 FNRLGLIPD 325
           F +L LIP+
Sbjct: 303 FKKLDLIPE 311


>gi|328766819|gb|EGF76871.1| hypothetical protein BATDEDRAFT_92155 [Batrachochytrium
           dendrobatidis JAM81]
          Length = 412

 Score =  315 bits (806), Expect = 7e-84,   Method: Composition-based stats.
 Identities = 154/314 (49%), Positives = 219/314 (69%), Gaps = 2/314 (0%)

Query: 16  PKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQS 75
              WT +E+  IY+ P  +LL+ + TVHR++F P  +Q   LL+IKTGGC E+C YC QS
Sbjct: 68  RNDWTKQEIQAIYDTPLIELLYQAATVHRQHFNPREVQQCTLLSIKTGGCTEDCAYCPQS 127

Query: 76  VHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKER--DLSIIVDMIKGVK 133
             +K+ +KASKL+  D+VL+ A+ AK+ G+TR+CMGAAWR+ + R  + S I + ++ ++
Sbjct: 128 SKHKTTVKASKLLPHDEVLEAARKAKDAGSTRFCMGAAWRDVQGRKTNFSQITEYVRQIR 187

Query: 134 SLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVR 193
            +G+E C +LGML+ EQA  L +AGL  YNHN+DTS  FYP++ TT ++++RL T+ NVR
Sbjct: 188 GMGMEVCCSLGMLNKEQAIALKEAGLTAYNHNLDTSREFYPNIITTRSYDERLNTISNVR 247

Query: 194 KSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPI 253
            +GI VC GGI+GLGE+++DR+ ML TL+ L   PES+PIN L+ +PG+  E  K V   
Sbjct: 248 DAGISVCSGGIIGLGEVVNDRVGMLHTLSTLPKHPESVPINALLAVPGTPLENQKPVSVW 307

Query: 254 EHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKD 313
           E VR+IS ARI+MPK+ +RL+AGR   S   QALCF +GANSIF GD LLT  N   ++D
Sbjct: 308 EMVRMISTARIIMPKAMVRLSAGRVNFSQSEQALCFIAGANSIFTGDKLLTTPNNKASQD 367

Query: 314 TILFNRLGLIPDLS 327
             +   LG++P  +
Sbjct: 368 KEMIEALGILPKPA 381


>gi|12407614|gb|AAG53589.1|AF248314_4 biotin synthase BioB [uncultured bacterium pCosAS1]
          Length = 346

 Score =  315 bits (806), Expect = 7e-84,   Method: Composition-based stats.
 Identities = 155/311 (49%), Positives = 217/311 (69%)

Query: 18  VWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQSVH 77
            WT  +V  ++  P  +LLF +  +HR++F+P  IQ+S LL+IKTG CPE+C YC QS  
Sbjct: 6   RWTLSQVTALFEKPLLELLFEAQQIHRQHFDPQQIQVSTLLSIKTGACPEDCKYCPQSAR 65

Query: 78  NKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLGL 137
            K+ L++ +L+ V+QVL+ A+ AK  G+TR+CMGAAW+ P ERD+  +  M++GVK++GL
Sbjct: 66  YKTGLESERLMEVEQVLESARQAKNAGSTRFCMGAAWKNPHERDMPYLEQMVQGVKAMGL 125

Query: 138 ETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSGI 197
           + CMTLG L   QAQ L+ AGLDYYNHN+DT   FY ++ TT T+++RL TL+ VR +GI
Sbjct: 126 QACMTLGTLDDHQAQRLASAGLDYYNHNLDTFPEFYGNIITTRTYQERLDTLDKVRDAGI 185

Query: 198 KVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEHVR 257
           KVC GGI+GL E + DR  +LL LANL TPPES+PIN+L+ + G+   +N  V   + +R
Sbjct: 186 KVCSGGIVGLCETVTDRAGLLLQLANLPTPPESVPINMLVKVKGTPLADNDDVXAFDXIR 245

Query: 258 IISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTILF 317
             SVA ++ P   +RL+ GR  M+++ QA+CF +GANSIF G  LLT  NP  +KD  LF
Sbjct: 246 TXSVAXVMXPTXLVRLSTGREQMNEQTQAMCFMAGANSIFYGCKLLTTPNPEEDKDVQLF 305

Query: 318 NRLGLIPDLSA 328
            +LGL P  +A
Sbjct: 306 RKLGLNPQQTA 316


>gi|15616902|ref|NP_240115.1| biotin synthetase [Buchnera aphidicola str. APS (Acyrthosiphon
           pisum)]
 gi|11131248|sp|P57378|BIOB_BUCAI RecName: Full=Biotin synthase
 gi|25294052|pir||A84964 biotin synthase (EC 2.8.1.6) [imported] - Buchnera sp.  (strain
           APS)
 gi|10038966|dbj|BAB13001.1| biotin synthetase [Buchnera aphidicola str. APS (Acyrthosiphon
           pisum)]
          Length = 343

 Score =  315 bits (806), Expect = 7e-84,   Method: Composition-based stats.
 Identities = 166/309 (53%), Positives = 231/309 (74%)

Query: 17  KVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQSV 76
           K WT +E   ++  PF +L+F +   HRKNF+PN IQ+S LL+IKTG CPE+C YC QS 
Sbjct: 3   KKWTLEETKMLFKKPFFNLMFQAQEEHRKNFDPNTIQISTLLSIKTGSCPEDCKYCPQSS 62

Query: 77  HNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLG 136
             K+ LK   L+ ++Q+L  AK AK++G++R+CMGAAW+ PKE+D+  + ++IK +K +G
Sbjct: 63  RYKTGLKKEPLLEIEQILSAAKKAKDSGSSRFCMGAAWKNPKEKDMPYLEEIIKKIKEMG 122

Query: 137 LETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSG 196
           +ETCMTLG L+  QA+ L+ AGLD+YNHN+DTS+ FY ++ TT T+++RL TL  VR SG
Sbjct: 123 METCMTLGTLNSTQAKKLADAGLDFYNHNLDTSKNFYNNIITTRTYQERLHTLHAVRSSG 182

Query: 197 IKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEHV 256
           +KVC GGI+GLGE   DRI++L+ L+NLS  PES+PIN+L+ IPG+   +NK V+P + +
Sbjct: 183 MKVCSGGIIGLGEKKQDRIELLMELSNLSIQPESVPINMLVKIPGTPMADNKDVEPFDFI 242

Query: 257 RIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTIL 316
           RII+VARI+MPKS +RL+AGR  M+D+ QA+CF +GANSIF G  LLT+ NP    D  L
Sbjct: 243 RIIAVARIMMPKSYIRLSAGRHKMNDQTQAMCFMAGANSIFYGCKLLTSDNPEEKHDLEL 302

Query: 317 FNRLGLIPD 325
           F +L LIP+
Sbjct: 303 FKKLDLIPE 311


>gi|254810870|sp|Q609V2|BIOB_METCA RecName: Full=Biotin synthase
          Length = 326

 Score =  315 bits (806), Expect = 7e-84,   Method: Composition-based stats.
 Identities = 167/316 (52%), Positives = 229/316 (72%)

Query: 8   PEENPTKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPE 67
                      WT  E   ++ +PFN+LLF + T+HR++F+PN +Q+S LL+IKTG C E
Sbjct: 5   ERAEEPVLRHDWTQGEAEALFALPFNELLFQAQTIHRRHFDPNEVQVSSLLSIKTGACSE 64

Query: 68  NCGYCNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVD 127
           +C YC QS H ++ +K   L++++ VL+ A+ A+E GATR+CMGAAWR P++ DL  I  
Sbjct: 65  DCAYCPQSAHYETGVKRESLMSLEDVLEAAQRAREEGATRFCMGAAWRSPRDGDLEAIAA 124

Query: 128 MIKGVKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQ 187
           M++GVK+LG+ETC+T GMLS EQA+ L +AGLDYYNHN+DTSE +Y  + TT T++DRL 
Sbjct: 125 MVEGVKALGMETCVTAGMLSDEQARRLKEAGLDYYNHNLDTSESYYGEIITTRTYQDRLD 184

Query: 188 TLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEEN 247
           TL+ VR +G+ VCCGGI+G+GE   DR  +L+ LANL   PES+PINLL+ + G+   + 
Sbjct: 185 TLQRVRDAGMHVCCGGIVGMGESAADRAGLLIGLANLPRHPESVPINLLVRVEGTPLADT 244

Query: 248 KKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKN 307
             +DP + VR ++VARI+MP SR+RL+AGR+ MSDE+QALCF +GANSIF GD LLT +N
Sbjct: 245 AALDPFDFVRTVAVARIMMPASRVRLSAGRSDMSDEMQALCFLAGANSIFYGDRLLTTEN 304

Query: 308 PSYNKDTILFNRLGLI 323
           P   +D  LF RLGL 
Sbjct: 305 PQAQRDRRLFARLGLR 320


>gi|332188546|ref|ZP_08390266.1| biotin synthase [Sphingomonas sp. S17]
 gi|332011451|gb|EGI53536.1| biotin synthase [Sphingomonas sp. S17]
          Length = 342

 Score =  315 bits (806), Expect = 8e-84,   Method: Composition-based stats.
 Identities = 171/328 (52%), Positives = 227/328 (69%), Gaps = 6/328 (1%)

Query: 4   STVVPEENPTKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTG 63
           +T     +       WT  E+  ++++PF +LLF +  VHR +   + +QLS LL+IKTG
Sbjct: 3   TTTPALSSEATPRTDWTRAEIAALFDLPFTELLFRAAEVHRAHHAADQVQLSTLLSIKTG 62

Query: 64  GCPENCGYCNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLS 123
           GCPE+CGYC+QS H  + LKA+KL++   VL+ A  AK++G+TR+CMGAAWR PK+RD+ 
Sbjct: 63  GCPEDCGYCSQSTHADTGLKATKLMDPRAVLQAAAQAKDHGSTRFCMGAAWRNPKDRDMP 122

Query: 124 IIVDMIKGVKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFE 183
            IV+M+KGV+++G+ETCMTLGML+  QAQ L++AGLDYYNHNIDTS   Y  V TT +F 
Sbjct: 123 AIVEMVKGVRAMGMETCMTLGMLTDAQAQTLAEAGLDYYNHNIDTSPERYGDVITTRSFG 182

Query: 184 DRLQTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSK 243
           +RL+TLE+VR +GI VCCGGI+G+GE   DR+  +  LA L   P S+P+N L+P+ G+ 
Sbjct: 183 ERLETLEHVRDAGINVCCGGIVGMGETRGDRVGFIHALATLPVHPGSVPVNALVPVKGTV 242

Query: 244 FEENKKVDP------IEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIF 297
             +     P      IE VR ++VARI MP S +RL+AGR  MSD  QALCF +GANSIF
Sbjct: 243 LGDMLADTPLAKIDDIEFVRTVAVARITMPHSMVRLSAGRESMSDATQALCFLAGANSIF 302

Query: 298 VGDTLLTAKNPSYNKDTILFNRLGLIPD 325
            GD LLTA N   +KD  LF RLGL P 
Sbjct: 303 TGDKLLTAGNAGDDKDAALFARLGLTPM 330


>gi|146298563|ref|YP_001193154.1| biotin synthase [Flavobacterium johnsoniae UW101]
 gi|254810686|sp|A5FLT1|BIOB_FLAJ1 RecName: Full=Biotin synthase
 gi|146152981|gb|ABQ03835.1| biotin synthase [Flavobacterium johnsoniae UW101]
          Length = 363

 Score =  315 bits (806), Expect = 8e-84,   Method: Composition-based stats.
 Identities = 153/308 (49%), Positives = 217/308 (70%), Gaps = 1/308 (0%)

Query: 17  KVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQSV 76
             WT  E+  IYN P  DLL+ + T+HR+  +PN +Q+S LL+IKTGGCPE+CGYC Q+ 
Sbjct: 7   HNWTKDEIIAIYNKPLMDLLYEAATIHRQQHDPNVVQVSTLLSIKTGGCPEDCGYCPQAA 66

Query: 77  HNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKE-RDLSIIVDMIKGVKSL 135
              + ++ + L+ V QV  +A  AK NG++R CMGAAWR  K+  +   +++M++ +  L
Sbjct: 67  RYNTGVEGNDLMTVSQVKAQALRAKSNGSSRVCMGAAWRNVKDGEEFDQVLEMVRTINKL 126

Query: 136 GLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKS 195
            +E C TLGML+  QAQ L++AGL  YNHN+DTSE +Y  V +T  FEDRLQT+ENVRK+
Sbjct: 127 DMEVCCTLGMLTENQAQRLAEAGLYAYNHNLDTSEEYYKDVISTRGFEDRLQTIENVRKT 186

Query: 196 GIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEH 255
            + VC GGI+G+GE I+DR  ML+ L+ L+  PES+PIN L+ + G+  EE K V+  E 
Sbjct: 187 NVTVCSGGIIGMGESIEDRAGMLVALSTLNPQPESVPINALVAVEGTPMEEEKPVEIWEM 246

Query: 256 VRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTI 315
           +R+++  RI+MP++++RL+AGR  MS E QA+CFF+GANSIF GD LLT  NP  N+D  
Sbjct: 247 IRMVATTRIVMPETQVRLSAGRTNMSREGQAMCFFAGANSIFAGDKLLTTPNPDVNEDMK 306

Query: 316 LFNRLGLI 323
           +F  LG++
Sbjct: 307 MFETLGMV 314


>gi|260773034|ref|ZP_05881950.1| biotin synthase [Vibrio metschnikovii CIP 69.14]
 gi|260612173|gb|EEX37376.1| biotin synthase [Vibrio metschnikovii CIP 69.14]
          Length = 350

 Score =  315 bits (806), Expect = 8e-84,   Method: Composition-based stats.
 Identities = 165/308 (53%), Positives = 228/308 (74%)

Query: 16  PKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQS 75
              WT  EV  + + PF DLLF +  VHR+    NH+Q+S LL+IKTG CPE+C YC QS
Sbjct: 4   RHNWTRAEVTALLDQPFMDLLFTAQQVHRQFHPHNHVQVSTLLSIKTGACPEDCKYCPQS 63

Query: 76  VHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSL 135
            H ++ +   +L+ V++VL  A+ AK++G+TR+CMGAAW+ PK RD+ ++  MI GVK  
Sbjct: 64  AHYRTDVDKERLMEVERVLDAAEKAKQSGSTRFCMGAAWKNPKARDMPLLKAMIAGVKEK 123

Query: 136 GLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKS 195
           GLETCMTLGMLS EQA  L++AGLDYYNHN+DTS  FY ++ TT T++DRL TL +VR S
Sbjct: 124 GLETCMTLGMLSAEQAYELAQAGLDYYNHNLDTSPEFYGNIITTRTYQDRLDTLSHVRDS 183

Query: 196 GIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEH 255
           G+K+C GGI+G+GE +DDR  +L+ LANL T PES+PIN+L+ + G+     ++V+P + 
Sbjct: 184 GMKICSGGIIGMGESVDDRAGLLVELANLPTQPESVPINMLVKVQGTPLASAEEVEPFDF 243

Query: 256 VRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTI 315
           +R+I+VARI+MPKS +RL+AGR  M++++QALCF +GANSIF G  LLT  NP+ + D  
Sbjct: 244 IRLIAVARIMMPKSAVRLSAGREKMNEQMQALCFMAGANSIFYGCKLLTTPNPAEDSDLQ 303

Query: 316 LFNRLGLI 323
           LFN+LG+ 
Sbjct: 304 LFNKLGIN 311


>gi|260461694|ref|ZP_05809940.1| biotin synthase [Mesorhizobium opportunistum WSM2075]
 gi|319785248|ref|YP_004144724.1| biotin synthase [Mesorhizobium ciceri biovar biserrulae WSM1271]
 gi|259032335|gb|EEW33600.1| biotin synthase [Mesorhizobium opportunistum WSM2075]
 gi|317171136|gb|ADV14674.1| biotin synthase [Mesorhizobium ciceri biovar biserrulae WSM1271]
          Length = 336

 Score =  315 bits (806), Expect = 8e-84,   Method: Composition-based stats.
 Identities = 199/310 (64%), Positives = 249/310 (80%)

Query: 18  VWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQSVH 77
            W+ KE   IY MPFNDLLF + T+HR+NF+ N +QLS+LL+IKTGGCPE+CGYC+QS H
Sbjct: 24  RWSRKEAEAIYGMPFNDLLFLAQTIHRQNFDRNRVQLSRLLSIKTGGCPEDCGYCSQSAH 83

Query: 78  NKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLGL 137
           +++ LKASKL+ V+ V++EA  A++ GATRYCMGAAWR PK+RD+  ++ MI+GVK+LG+
Sbjct: 84  HQTGLKASKLMEVNHVIEEATKARDAGATRYCMGAAWRSPKDRDMDAVLAMIEGVKALGM 143

Query: 138 ETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSGI 197
           ETCMTLGML F QAQ L  AGLDYYNHNIDTS R+Y  V +T TF DRL+TL  VR++GI
Sbjct: 144 ETCMTLGMLDFSQAQRLKAAGLDYYNHNIDTSARYYGKVVSTRTFADRLETLGRVREAGI 203

Query: 198 KVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEHVR 257
           KVCCGGI+G+GE   DRIDML+TLANL  PPES+PIN+LIPI G+   +   +DPI+ +R
Sbjct: 204 KVCCGGIVGMGEERADRIDMLVTLANLPEPPESVPINMLIPIRGTPLADADPIDPIDFIR 263

Query: 258 IISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTILF 317
            I++AR++MPKS +RL+AGR  MSDE QALCFF+GANSIFVGDTLLTA NP  +KDT LF
Sbjct: 264 TIALARVMMPKSYVRLSAGRTSMSDETQALCFFAGANSIFVGDTLLTADNPGEDKDTRLF 323

Query: 318 NRLGLIPDLS 327
            RLG+ P   
Sbjct: 324 KRLGIEPMQC 333


>gi|332306095|ref|YP_004433946.1| biotin synthase [Glaciecola agarilytica 4H-3-7+YE-5]
 gi|332173424|gb|AEE22678.1| biotin synthase [Glaciecola agarilytica 4H-3-7+YE-5]
          Length = 381

 Score =  314 bits (805), Expect = 8e-84,   Method: Composition-based stats.
 Identities = 162/316 (51%), Positives = 228/316 (72%)

Query: 12  PTKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGY 71
            ++    W   EV  ++ MPFNDLLF +  VHR +F+PN++Q+S LL+IKTG CPE+C Y
Sbjct: 13  ASEIRHDWALDEVNALFAMPFNDLLFKAQCVHRAHFDPNYVQVSTLLSIKTGACPEDCKY 72

Query: 72  CNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKG 131
           C QS    + L+  +L+ +++V++ A+ AK  G+TR+CMGAAWR PKERD+  + DM++ 
Sbjct: 73  CPQSARYDTGLEKERLMEIEKVIQRAREAKAAGSTRFCMGAAWRNPKERDMPYVTDMVRE 132

Query: 132 VKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLEN 191
           VK LGLETCMTLGML+ EQA  L +AGLDYYNHN+DTS  FY  + TT T++DRL TL+ 
Sbjct: 133 VKKLGLETCMTLGMLTREQAIALKQAGLDYYNHNLDTSPEFYGDIITTRTYQDRLNTLDA 192

Query: 192 VRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVD 251
           VR++G+ VC GGI+G+GE   DR  +L+ LANL   PES+PIN+L+ + G+  E  + +D
Sbjct: 193 VREAGMNVCSGGIVGMGETGSDRSGLLMQLANLEHHPESVPINMLVKVKGTPMENVEDLD 252

Query: 252 PIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYN 311
             E +R I+VARI+MPKS +RL+AGR  M++++QA+CF +GANSIF G  LLT  NP  +
Sbjct: 253 YFEFIRTIAVARIMMPKSFVRLSAGREAMNEQMQAMCFMAGANSIFYGCKLLTTSNPDTH 312

Query: 312 KDTILFNRLGLIPDLS 327
           +D +LF +LG+    +
Sbjct: 313 EDVMLFKKLGINAKQT 328


>gi|13474856|ref|NP_106426.1| biotin synthetase [Mesorhizobium loti MAFF303099]
 gi|21326937|gb|AAM48103.1|AF416912_1 biotin synthase [Mesorhizobium loti]
 gi|14025612|dbj|BAB52212.1| biotin synthetase [Mesorhizobium loti MAFF303099]
          Length = 331

 Score =  314 bits (805), Expect = 8e-84,   Method: Composition-based stats.
 Identities = 202/307 (65%), Positives = 250/307 (81%)

Query: 19  WTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQSVHN 78
           WT  E   +++ PFNDLLF + TVHR+NF+PN +QLS+LL+IKTGGCPE+CGYC+QS H+
Sbjct: 20  WTRAEAQALHDAPFNDLLFQAQTVHRQNFDPNKVQLSRLLSIKTGGCPEDCGYCSQSAHH 79

Query: 79  KSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLGLE 138
           +S LKASKL+ V +V+ EA  A++ GATRYCMGAAWR PK RD+  +V M++GVK+LG+E
Sbjct: 80  ESGLKASKLMEVRRVIAEATKARDAGATRYCMGAAWRNPKARDMDAVVAMVEGVKALGME 139

Query: 139 TCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSGIK 198
           TCMTLGML  EQA  L +AGLDYYNHNIDTSER+Y  + +T TF DRL TL NVR SGIK
Sbjct: 140 TCMTLGMLDLEQAARLKQAGLDYYNHNIDTSERYYSEIISTRTFADRLDTLANVRDSGIK 199

Query: 199 VCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEHVRI 258
           VCCGGI+G+GE   DRIDML+TLANL   PES+PIN+LIPI G+   E K ++PIE VR+
Sbjct: 200 VCCGGIVGMGEEPVDRIDMLVTLANLPEHPESVPINMLIPIEGTPLAEAKPIEPIEFVRV 259

Query: 259 ISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTILFN 318
           I++ARI+MPKS +RL+AGR  M+DE+QALCFF+GANSIFVGDTLLTA NP  +KDT+LF 
Sbjct: 260 IALARIMMPKSHVRLSAGRTAMTDEMQALCFFAGANSIFVGDTLLTADNPGEDKDTLLFQ 319

Query: 319 RLGLIPD 325
           RLG+ P 
Sbjct: 320 RLGIEPM 326


>gi|197337663|ref|YP_002158418.1| biotin synthase [Vibrio fischeri MJ11]
 gi|254811606|sp|B5EUQ0|BIOB_VIBFM RecName: Full=Biotin synthase
 gi|197314915|gb|ACH64364.1| biotin synthase [Vibrio fischeri MJ11]
          Length = 350

 Score =  314 bits (805), Expect = 9e-84,   Method: Composition-based stats.
 Identities = 163/313 (52%), Positives = 228/313 (72%)

Query: 16  PKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQS 75
              WT  EV  + + PF DL+F +  VHRK  + NH+Q+S LL+IKTG CPE+C YC QS
Sbjct: 4   RHNWTVAEVQTLMDKPFMDLIFEAQLVHRKYQQANHVQVSTLLSIKTGACPEDCKYCPQS 63

Query: 76  VHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSL 135
            H ++ +   +L+ V+ VL  AK AK +G+TR+CMGAAW+ PKERD+  ++DMIKGVK +
Sbjct: 64  AHYRTDVDRERLMEVESVLDAAKKAKNSGSTRFCMGAAWKNPKERDMPYLLDMIKGVKEM 123

Query: 136 GLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKS 195
           GLETCMTLGM++ EQA  LS+AGLDYYNHN+DTS  FY ++ TT T++DRL TL +VR +
Sbjct: 124 GLETCMTLGMITAEQAGELSEAGLDYYNHNLDTSPEFYGNIITTRTYQDRLDTLSHVRDA 183

Query: 196 GIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEH 255
           G+K+C GGI+G+GE   DR  + + LANL   PES+P+N+L+ + G+  E+ + VDP + 
Sbjct: 184 GMKICSGGIIGMGESASDRAGLFVELANLPQHPESVPVNMLVKVKGTPLEDAEDVDPFDF 243

Query: 256 VRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTI 315
           +R+I+VARI+MP+S +RL+AGR  M++++QALCF +GANS+F G  LLT  NP  + D  
Sbjct: 244 IRLIAVARIMMPESAVRLSAGRESMNEQMQALCFMAGANSVFYGCKLLTTPNPDEDTDMQ 303

Query: 316 LFNRLGLIPDLSA 328
           LF +LG+  +  A
Sbjct: 304 LFKKLGVNSEQVA 316


>gi|219682211|ref|YP_002468595.1| biotin synthetase [Buchnera aphidicola str. Tuc7 (Acyrthosiphon
           pisum)]
 gi|254810577|sp|B8D7I5|BIOB_BUCAT RecName: Full=Biotin synthase
 gi|219621944|gb|ACL30100.1| biotin synthetase [Buchnera aphidicola str. Tuc7 (Acyrthosiphon
           pisum)]
 gi|311086602|gb|ADP66683.1| biotin synthetase [Buchnera aphidicola str. TLW03 (Acyrthosiphon
           pisum)]
 gi|311087712|gb|ADP67791.1| biotin synthetase [Buchnera aphidicola str. JF98 (Acyrthosiphon
           pisum)]
          Length = 343

 Score =  314 bits (805), Expect = 9e-84,   Method: Composition-based stats.
 Identities = 166/309 (53%), Positives = 230/309 (74%)

Query: 17  KVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQSV 76
           K WT +E   ++  PF +L+F +   HRKNF+PN IQ+S LL+IKTG CPE+C YC QS 
Sbjct: 3   KKWTLEETKMLFKKPFFNLMFQAQEEHRKNFDPNTIQISTLLSIKTGSCPEDCKYCPQSS 62

Query: 77  HNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLG 136
             K+ LK   L+ ++Q+L  AK AK++G++R+CMGAAW+ PKE+D+  +  +IK +K +G
Sbjct: 63  RYKTGLKKEPLLEIEQILSAAKKAKDSGSSRFCMGAAWKNPKEKDMPYLEKIIKKIKEMG 122

Query: 137 LETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSG 196
           +ETCMTLG L+  QA+ L+ AGLD+YNHN+DTS+ FY ++ TT T+++RL TL  VR SG
Sbjct: 123 METCMTLGTLNSTQAKKLADAGLDFYNHNLDTSKNFYSNIITTRTYQERLHTLHAVRSSG 182

Query: 197 IKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEHV 256
           +KVC GGI+GLGE   DRI++L+ L+NLS  PES+PIN+L+ IPG+   +NK V+P + +
Sbjct: 183 MKVCSGGIIGLGEKKQDRIELLMELSNLSIQPESVPINMLVKIPGTPMADNKDVEPFDFI 242

Query: 257 RIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTIL 316
           RII+VARI+MPKS +RL+AGR  M+D+ QA+CF +GANSIF G  LLT+ NP    D  L
Sbjct: 243 RIIAVARIMMPKSYIRLSAGRHKMNDQTQAMCFMAGANSIFYGCKLLTSDNPEEKHDLEL 302

Query: 317 FNRLGLIPD 325
           F +L LIP+
Sbjct: 303 FKKLDLIPE 311


>gi|298207126|ref|YP_003715305.1| Biotin synthase [Croceibacter atlanticus HTCC2559]
 gi|83849760|gb|EAP87628.1| Biotin synthase [Croceibacter atlanticus HTCC2559]
          Length = 362

 Score =  314 bits (805), Expect = 9e-84,   Method: Composition-based stats.
 Identities = 149/310 (48%), Positives = 215/310 (69%), Gaps = 1/310 (0%)

Query: 17  KVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQSV 76
             WT +E+  IYN PF DLL+ + TVHR+  +PN +Q+S LL+IKTGGCPE+CGYC Q+ 
Sbjct: 5   HNWTIEEILDIYNKPFMDLLYEAATVHREFHDPNTVQVSTLLSIKTGGCPEDCGYCPQAA 64

Query: 77  HNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKE-RDLSIIVDMIKGVKSL 135
              + ++ + L+ V QV  +A  AK +G++R CMGAAWR  K+  +   +++M++ +  L
Sbjct: 65  RYHTDIEGNDLMGVQQVKAQALRAKASGSSRVCMGAAWRNVKDGEEFEQVLEMVRTINKL 124

Query: 136 GLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKS 195
            +E C TLGML+  QA  L++AGL  YNHN+D+SE +Y  V +T  FEDRL+T++NVRK+
Sbjct: 125 EMEVCCTLGMLTENQAHRLAEAGLYAYNHNLDSSEEYYKEVISTRGFEDRLKTIDNVRKT 184

Query: 196 GIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEH 255
            + VC GGI+G+GE   DR  ML+ LA L+  PES+PIN L+ + G+  E+ + +   + 
Sbjct: 185 NVTVCSGGIIGMGESTKDRAGMLVALATLNPQPESVPINALVAVDGTPLEDQEPIPIWDM 244

Query: 256 VRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTI 315
           VR+++  RI+MP++++RL+AGR  MS E QA+CFF+GANSIF GD LLT  NP  N+D  
Sbjct: 245 VRMVATTRIVMPQTQVRLSAGRTQMSREGQAMCFFAGANSIFAGDKLLTTPNPDVNEDME 304

Query: 316 LFNRLGLIPD 325
           +F  LGL P 
Sbjct: 305 MFKALGLNPQ 314


>gi|153010147|ref|YP_001371361.1| biotin synthase [Ochrobactrum anthropi ATCC 49188]
 gi|254810762|sp|A6X2S8|BIOB_OCHA4 RecName: Full=Biotin synthase
 gi|151562035|gb|ABS15532.1| biotin synthase [Ochrobactrum anthropi ATCC 49188]
          Length = 336

 Score =  314 bits (805), Expect = 1e-83,   Method: Composition-based stats.
 Identities = 210/317 (66%), Positives = 257/317 (81%)

Query: 7   VPEENPTKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCP 66
           V +     +   WT      +Y++PFNDLLF +  VHR NF+PN +QLSKLLNIKTGGCP
Sbjct: 12  VEKTASKSEQDAWTLASARLLYDLPFNDLLFEAQNVHRANFDPNRVQLSKLLNIKTGGCP 71

Query: 67  ENCGYCNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIV 126
           E+CGYC+QS H+ S LKASKL+++D VL+EA+ AK++GATRYCMGAAWR PK RD   I 
Sbjct: 72  EDCGYCSQSAHHASGLKASKLMSLDTVLEEAQKAKDSGATRYCMGAAWRSPKPRDEPAIA 131

Query: 127 DMIKGVKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRL 186
           +M+K VK+LGLETCMTLGMLS +QAQ  ++AGLDYYNHNIDTSERFYP V TT +F+DRL
Sbjct: 132 EMVKQVKALGLETCMTLGMLSPDQAQTFAEAGLDYYNHNIDTSERFYPQVITTRSFDDRL 191

Query: 187 QTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEE 246
           +TL +VR++GIKVC GGILGLGE  DDRIDML+TLANL TPPES+PIN+LIP+PGS+ E+
Sbjct: 192 ETLAHVREAGIKVCSGGILGLGETEDDRIDMLVTLANLPTPPESVPINMLIPMPGSRLEK 251

Query: 247 NKKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAK 306
              VDPI  VRII++AR++MP+S +RL AGR  MSDE+QALCFF+GANSIF+GDTLLTA 
Sbjct: 252 ASPVDPIAFVRIIALARLMMPQSHVRLTAGRNSMSDEMQALCFFAGANSIFIGDTLLTAA 311

Query: 307 NPSYNKDTILFNRLGLI 323
           NP  ++DT L  RLGL 
Sbjct: 312 NPGEDRDTSLMRRLGLT 328


>gi|288940275|ref|YP_003442515.1| biotin synthase [Allochromatium vinosum DSM 180]
 gi|288895647|gb|ADC61483.1| biotin synthase [Allochromatium vinosum DSM 180]
          Length = 347

 Score =  314 bits (805), Expect = 1e-83,   Method: Composition-based stats.
 Identities = 169/322 (52%), Positives = 228/322 (70%)

Query: 1   MSRSTVVPEENPTKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNI 60
           MS+      ++P      W+  E+  I + PFNDLLF + +VHR +F+PN IQ+S LL+I
Sbjct: 1   MSQIHTTAFQSPPALRHDWSLDEIEAILDQPFNDLLFTAQSVHRAHFDPNTIQVSTLLSI 60

Query: 61  KTGGCPENCGYCNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKER 120
           KTG CPE+CGYC QS  + + ++  +++ +D VL+ A+ AK  GATR+CMGAAWR P +R
Sbjct: 61  KTGACPEDCGYCGQSARHATDVEPERILPLDTVLEAARTAKSQGATRFCMGAAWRNPTDR 120

Query: 121 DLSIIVDMIKGVKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTH 180
            L  ++ M++G+ +LGLETC+TLGML+ EQA+ L  AGLDYYNHN+DTS  FY  V +T 
Sbjct: 121 HLEQVIAMVEGIHALGLETCVTLGMLTAEQARRLKDAGLDYYNHNLDTSPEFYGQVISTR 180

Query: 181 TFEDRLQTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIP 240
           T++DRL TLE++R  G+K C GGILG+GE   DR  ML  L NL   PES+PINLL+ + 
Sbjct: 181 TYQDRLDTLEHIRAVGLKTCSGGILGMGESRRDRASMLRQLTNLPAHPESVPINLLVQVE 240

Query: 241 GSKFEENKKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGD 300
           G+       +DP E VR+++ ARI+MP+S +RL+AGR+ MSDELQALCF +GANSIF G+
Sbjct: 241 GTPLFGVDALDPFEFVRVVAAARIIMPRSHVRLSAGRSEMSDELQALCFLAGANSIFYGE 300

Query: 301 TLLTAKNPSYNKDTILFNRLGL 322
            LLTA N   ++D  LF RLGL
Sbjct: 301 RLLTAPNAESDRDRRLFERLGL 322


>gi|315499254|ref|YP_004088058.1| biotin synthase [Asticcacaulis excentricus CB 48]
 gi|315417266|gb|ADU13907.1| biotin synthase [Asticcacaulis excentricus CB 48]
          Length = 326

 Score =  314 bits (804), Expect = 1e-83,   Method: Composition-based stats.
 Identities = 172/314 (54%), Positives = 227/314 (72%), Gaps = 4/314 (1%)

Query: 16  PKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQS 75
              WT  E+  ++ +PF +L++ + +VHR++F+P+ IQLS+LL+IKTGGC ENCGYC+QS
Sbjct: 12  RHDWTKTEIAALFELPFMELVYKAASVHRQSFDPSEIQLSQLLSIKTGGCAENCGYCSQS 71

Query: 76  VHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSL 135
            H+ + LKASKL+ VD+VL  AK A+E GA R+CMGAAWR+ K+RD+  +  MI  VK+L
Sbjct: 72  AHHNTGLKASKLMPVDEVLSAAKAAREGGAQRFCMGAAWRDLKDRDVPALAAMISEVKAL 131

Query: 136 GLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKS 195
           GLETC TLGM++ +QA  L  AGLDYYNHN+DTS  +Y  V TT T+++RL+TL+ VR  
Sbjct: 132 GLETCATLGMITADQATALKSAGLDYYNHNLDTSPEYYDQVVTTRTYDERLETLKAVRDV 191

Query: 196 GIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKK----VD 251
           G+K CCGGILG+GE  +DR+  L  LANL + P+S+PIN L+P+  +   E  K    V 
Sbjct: 192 GMKTCCGGILGMGESREDRVSFLQQLANLPSHPDSLPINNLVPVANTPLGERSKGKGEVS 251

Query: 252 PIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYN 311
           PIE VR ++VARI+ PKS +RL+AGR  MS+ELQALCF +GANSIFVG+ LLT  NP   
Sbjct: 252 PIEFVRTVAVARIVCPKSMVRLSAGRNEMSEELQALCFLAGANSIFVGNQLLTTPNPEPG 311

Query: 312 KDTILFNRLGLIPD 325
            D  L   LGL P 
Sbjct: 312 SDAHLMQTLGLRPM 325


>gi|293608306|ref|ZP_06690609.1| conserved hypothetical protein [Acinetobacter sp. SH024]
 gi|292828879|gb|EFF87241.1| conserved hypothetical protein [Acinetobacter sp. SH024]
          Length = 333

 Score =  314 bits (804), Expect = 1e-83,   Method: Composition-based stats.
 Identities = 170/310 (54%), Positives = 229/310 (73%)

Query: 16  PKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQS 75
              W  +E+  +Y  PF DL+F +  VHR++F  N IQ+S LL+IKTG CPE+C YC+QS
Sbjct: 8   RNDWNREEIQALYEQPFLDLVFKAQQVHREHFTANSIQVSTLLSIKTGKCPEDCKYCSQS 67

Query: 76  VHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSL 135
            H +SKL+A K I V++V+ EAK AK++G++R+CMGAAWR P ERD+  +++M++ VK+L
Sbjct: 68  AHYESKLEAEKRIAVEKVISEAKAAKDSGSSRFCMGAAWRNPHERDMPYVLEMVREVKAL 127

Query: 136 GLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKS 195
           GLETCMTLGML+  QA+ L  AGLDYYNHN+DTS  +Y H+ +T TF+DRL TL+ VR++
Sbjct: 128 GLETCMTLGMLNQSQAERLKVAGLDYYNHNLDTSREYYSHIISTRTFDDRLNTLDYVRQA 187

Query: 196 GIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEH 255
           G+KVC GGI+GLGE  +DRI +L  LA L   PES+PIN+L+PI G+   + +K+D IE 
Sbjct: 188 GMKVCSGGIVGLGESREDRIGLLHELATLPIHPESVPINMLVPIEGTPLADVEKLDVIEW 247

Query: 256 VRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTI 315
           +R I+VARI+MP S +RL+AGR  +SD  QAL F +GANS+F GD LLT  N    KD  
Sbjct: 248 IRTIAVARIIMPHSYIRLSAGRESLSDSDQALAFMAGANSLFSGDKLLTTPNAGEGKDQA 307

Query: 316 LFNRLGLIPD 325
           LFN+LGL  +
Sbjct: 308 LFNKLGLTAE 317


>gi|84622076|ref|YP_449448.1| biotin synthase [Xanthomonas oryzae pv. oryzae MAFF 311018]
 gi|122879020|ref|YP_199094.6| biotin synthase [Xanthomonas oryzae pv. oryzae KACC10331]
 gi|188578945|ref|YP_001915874.1| biotin synthase [Xanthomonas oryzae pv. oryzae PXO99A]
 gi|123752826|sp|Q2P8F3|BIOB_XANOM RecName: Full=Biotin synthase
 gi|254811608|sp|B2SS67|BIOB_XANOP RecName: Full=Biotin synthase
 gi|254812940|sp|Q5H5R1|BIOB_XANOR RecName: Full=Biotin synthase
 gi|84366016|dbj|BAE67174.1| biotin synthase [Xanthomonas oryzae pv. oryzae MAFF 311018]
 gi|188523397|gb|ACD61342.1| biotin synthase [Xanthomonas oryzae pv. oryzae PXO99A]
          Length = 344

 Score =  314 bits (804), Expect = 1e-83,   Method: Composition-based stats.
 Identities = 162/311 (52%), Positives = 220/311 (70%)

Query: 16  PKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQS 75
              W  KE+  ++++PF +LL  + +VHR +F+P  +Q+S LL++KTGGCPE+C YC Q+
Sbjct: 6   RHDWDHKELQALFDLPFPELLHRAASVHRAHFDPAEVQVSTLLSVKTGGCPEDCAYCPQA 65

Query: 76  VHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSL 135
               + + A KL+  ++V+ +A+ AK  GA+R+CMGAAWR PKERD+  +  MI+ VK++
Sbjct: 66  QRYDTGVTAQKLLETEEVVAKARQAKAAGASRFCMGAAWRSPKERDIPKVAAMIREVKAM 125

Query: 136 GLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKS 195
           GLETC TLGML   QA+ L  AGLDYYNHN+DT+  +Y  +  T  ++DRL TLE+VR  
Sbjct: 126 GLETCATLGMLDAGQARALKDAGLDYYNHNLDTAPDYYDTIIHTRQYQDRLNTLEHVRDV 185

Query: 196 GIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEH 255
           G+K CCGGI+G+GE  D RI +LL LA L   P+S+PIN L+ +PG+     +++DP E 
Sbjct: 186 GLKTCCGGIVGMGETRDHRIGLLLALATLPAHPDSVPINQLVQVPGTPLHGTQQLDPFEF 245

Query: 256 VRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTI 315
           VR+I+VARI MPKS +RL+AGR  MSDELQALCF +GANSIF G+ LLT  NP   +D  
Sbjct: 246 VRMIAVARIAMPKSMVRLSAGREAMSDELQALCFLAGANSIFYGEKLLTTGNPDTERDQT 305

Query: 316 LFNRLGLIPDL 326
           LF RLGL P  
Sbjct: 306 LFQRLGLRPMQ 316


>gi|315619774|gb|EFV00293.1| biotin synthase [Escherichia coli 3431]
          Length = 327

 Score =  314 bits (804), Expect = 1e-83,   Method: Composition-based stats.
 Identities = 164/296 (55%), Positives = 219/296 (73%)

Query: 33  NDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQSVHNKSKLKASKLINVDQ 92
            DLLF +  VHR++F+P  +Q+S LL+IKTG CPE+C YC QS   K+ L+A +L+ V+Q
Sbjct: 2   LDLLFEAQQVHRQHFDPRQVQVSTLLSIKTGACPEDCKYCPQSSRYKTGLEAERLMEVEQ 61

Query: 93  VLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLGLETCMTLGMLSFEQAQ 152
           VL+ A+ AK  G+TR+CMGAAW+ P ERD+  +  M++GVK++GLE CMTLG LS  QAQ
Sbjct: 62  VLESARKAKAAGSTRFCMGAAWKNPHERDMPYLEQMVQGVKAMGLEACMTLGTLSESQAQ 121

Query: 153 ILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSGIKVCCGGILGLGEMID 212
            L+ AGLDYYNHN+DTS  FY ++ TT T+++RL TLE VR +GIKVC GGI+GLGE + 
Sbjct: 122 RLANAGLDYYNHNLDTSPEFYGNIITTRTYQERLDTLEKVRDAGIKVCSGGIVGLGETVK 181

Query: 213 DRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEHVRIISVARILMPKSRLR 272
           DR  +LL LANL TPPES+PIN+L+ + G+   +N  VD  + +R I+VARI+MP S +R
Sbjct: 182 DRAGLLLQLANLPTPPESVPINMLVKVKGTPLADNDDVDAFDFIRTIAVARIMMPTSYVR 241

Query: 273 LAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTILFNRLGLIPDLSA 328
           L+AGR  M+++ QA+CF +GANSIF G  LLT  NP  +KD  LF +LGL P  +A
Sbjct: 242 LSAGREQMNEQTQAMCFMAGANSIFYGCKLLTTPNPEEDKDLQLFRKLGLNPQQTA 297


>gi|53804505|ref|YP_113595.1| biotin synthetase [Methylococcus capsulatus str. Bath]
 gi|53758266|gb|AAU92557.1| biotin synthetase [Methylococcus capsulatus str. Bath]
          Length = 333

 Score =  314 bits (804), Expect = 1e-83,   Method: Composition-based stats.
 Identities = 167/316 (52%), Positives = 229/316 (72%)

Query: 8   PEENPTKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPE 67
                      WT  E   ++ +PFN+LLF + T+HR++F+PN +Q+S LL+IKTG C E
Sbjct: 12  ERAEEPVLRHDWTQGEAEALFALPFNELLFQAQTIHRRHFDPNEVQVSSLLSIKTGACSE 71

Query: 68  NCGYCNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVD 127
           +C YC QS H ++ +K   L++++ VL+ A+ A+E GATR+CMGAAWR P++ DL  I  
Sbjct: 72  DCAYCPQSAHYETGVKRESLMSLEDVLEAAQRAREEGATRFCMGAAWRSPRDGDLEAIAA 131

Query: 128 MIKGVKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQ 187
           M++GVK+LG+ETC+T GMLS EQA+ L +AGLDYYNHN+DTSE +Y  + TT T++DRL 
Sbjct: 132 MVEGVKALGMETCVTAGMLSDEQARRLKEAGLDYYNHNLDTSESYYGEIITTRTYQDRLD 191

Query: 188 TLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEEN 247
           TL+ VR +G+ VCCGGI+G+GE   DR  +L+ LANL   PES+PINLL+ + G+   + 
Sbjct: 192 TLQRVRDAGMHVCCGGIVGMGESAADRAGLLIGLANLPRHPESVPINLLVRVEGTPLADT 251

Query: 248 KKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKN 307
             +DP + VR ++VARI+MP SR+RL+AGR+ MSDE+QALCF +GANSIF GD LLT +N
Sbjct: 252 AALDPFDFVRTVAVARIMMPASRVRLSAGRSDMSDEMQALCFLAGANSIFYGDRLLTTEN 311

Query: 308 PSYNKDTILFNRLGLI 323
           P   +D  LF RLGL 
Sbjct: 312 PQAQRDRRLFARLGLR 327


>gi|262278860|ref|ZP_06056645.1| biotin synthetase [Acinetobacter calcoaceticus RUH2202]
 gi|262259211|gb|EEY77944.1| biotin synthetase [Acinetobacter calcoaceticus RUH2202]
          Length = 333

 Score =  314 bits (804), Expect = 1e-83,   Method: Composition-based stats.
 Identities = 170/310 (54%), Positives = 229/310 (73%)

Query: 16  PKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQS 75
              W  +E+  +Y  PF DL+F +  VHR++F  N IQ+S LL+IKTG CPE+C YC+QS
Sbjct: 8   RNDWNREEIQALYEQPFLDLVFKAQQVHREHFTANAIQVSTLLSIKTGKCPEDCKYCSQS 67

Query: 76  VHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSL 135
            H +SKL+A K I V++V+ EAK AK++G++R+CMGAAWR P ERD+  +++M++ VK+L
Sbjct: 68  AHYESKLEAEKRIAVEKVISEAKAAKDSGSSRFCMGAAWRNPHERDMPYVLEMVREVKAL 127

Query: 136 GLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKS 195
           GLETCMTLGML+  QA+ L  AGLDYYNHN+DTS  +Y H+ +T TF+DRL TL+ VR++
Sbjct: 128 GLETCMTLGMLNQSQAERLQVAGLDYYNHNLDTSREYYSHIISTRTFDDRLNTLDYVRQA 187

Query: 196 GIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEH 255
           G+KVC GGI+GLGE  DDR+ +L  LA L   PES+PIN+L+PI G+   + +K+D IE 
Sbjct: 188 GMKVCSGGIVGLGESRDDRVGLLHELATLPIHPESVPINMLVPIEGTPLADVEKLDVIEW 247

Query: 256 VRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTI 315
           +R I+VARI+MP S +RL+AGR  +SD  QAL F +GANS+F GD LLT  N    KD  
Sbjct: 248 IRTIAVARIIMPHSYIRLSAGRESLSDSDQALAFMAGANSLFSGDKLLTTPNAGEGKDQA 307

Query: 316 LFNRLGLIPD 325
           LFN+LGL  +
Sbjct: 308 LFNKLGLTAE 317


>gi|325121959|gb|ADY81482.1| biotin synthetase [Acinetobacter calcoaceticus PHEA-2]
          Length = 333

 Score =  314 bits (804), Expect = 1e-83,   Method: Composition-based stats.
 Identities = 169/310 (54%), Positives = 229/310 (73%)

Query: 16  PKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQS 75
              W  +E+  +Y  PF DL+F +  VHR++F  N IQ+S LL+IKTG CPE+C YC+QS
Sbjct: 8   RNDWNREEIQALYEQPFLDLVFKAQQVHREHFTANSIQVSTLLSIKTGKCPEDCKYCSQS 67

Query: 76  VHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSL 135
            H +SKL+A K I V++V+ EAK AK++G++R+CMGAAWR P ERD+  +++M++ VK+L
Sbjct: 68  AHYESKLEAEKRIAVEKVISEAKAAKDSGSSRFCMGAAWRNPHERDMPYVLEMVREVKAL 127

Query: 136 GLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKS 195
           G+ETCMTLGML+  QA+ L  AGLDYYNHN+DTS  +Y H+ +T TF+DRL TL+ VR++
Sbjct: 128 GMETCMTLGMLNQSQAERLKVAGLDYYNHNLDTSREYYSHIISTRTFDDRLNTLDYVRQA 187

Query: 196 GIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEH 255
           G+KVC GGI+GLGE  +DRI +L  LA L   PES+PIN+L+PI G+   + +K+D IE 
Sbjct: 188 GMKVCSGGIVGLGESREDRIGLLHELATLPIHPESVPINMLVPIEGTPLADVEKLDVIEW 247

Query: 256 VRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTI 315
           +R I+VARI+MP S +RL+AGR  +SD  QAL F +GANS+F GD LLT  N    KD  
Sbjct: 248 IRTIAVARIIMPHSYIRLSAGRESLSDSDQALAFMAGANSLFSGDKLLTTPNAGEGKDQA 307

Query: 316 LFNRLGLIPD 325
           LFN+LGL  +
Sbjct: 308 LFNKLGLTAE 317


>gi|110638853|ref|YP_679062.1| biotin synthase [Cytophaga hutchinsonii ATCC 33406]
 gi|123163385|sp|Q11S94|BIOB_CYTH3 RecName: Full=Biotin synthase
 gi|110281534|gb|ABG59720.1| biotin synthase [Cytophaga hutchinsonii ATCC 33406]
          Length = 337

 Score =  314 bits (803), Expect = 2e-83,   Method: Composition-based stats.
 Identities = 161/316 (50%), Positives = 216/316 (68%), Gaps = 1/316 (0%)

Query: 13  TKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYC 72
           T+    WT +E+  IYN P  DL++   TVHR+  +P  +Q+  LL+IKTGGCPE+C YC
Sbjct: 2   TEIRNNWTKEEISAIYNSPILDLMYRGATVHREFHDPQEVQVCTLLSIKTGGCPEDCSYC 61

Query: 73  NQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKE-RDLSIIVDMIKG 131
            Q+    + +K  KL++V  VL  A  AKE+G+TR+CMGAAWRE ++ +D   ++DM+KG
Sbjct: 62  PQAARYHTDVKVEKLMDVKDVLNSALEAKESGSTRFCMGAAWREVRDNKDFDKVIDMVKG 121

Query: 132 VKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLEN 191
           V ++G+E C TLGML+ EQA  L  AGL  YNHN+DTS   Y  V TT T++DRL+TL+N
Sbjct: 122 VSTMGMEVCCTLGMLTPEQADKLKDAGLYAYNHNLDTSAEHYDKVITTRTYDDRLETLDN 181

Query: 192 VRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVD 251
           VR + I VC GGI+G+GE   DR+ ML TLAN+   PES+P+N L+P+ G+  E+  +V 
Sbjct: 182 VRNAKISVCSGGIIGMGESHGDRVGMLHTLANMVEHPESVPVNALVPVEGTPLEDQPRVS 241

Query: 252 PIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYN 311
             E VR+I+ ARI+MPK+ +RL+AGR  M+ E QALCF +GANSIF GD LLT  NP  N
Sbjct: 242 VWEMVRMIATARIIMPKAMVRLSAGRVRMNTEEQALCFLAGANSIFAGDKLLTTPNPEVN 301

Query: 312 KDTILFNRLGLIPDLS 327
            D  +F  L L P  S
Sbjct: 302 ADKEMFQVLNLKPRQS 317


>gi|311087185|gb|ADP67265.1| biotin synthetase [Buchnera aphidicola str. JF99 (Acyrthosiphon
           pisum)]
          Length = 343

 Score =  314 bits (803), Expect = 2e-83,   Method: Composition-based stats.
 Identities = 167/309 (54%), Positives = 230/309 (74%)

Query: 17  KVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQSV 76
           K WT +E   ++  PF +L+F +   HRKNF+PN IQ+S LL+IKTG CPE+C YC QS 
Sbjct: 3   KKWTLEETKMLFKKPFFNLMFQAQEEHRKNFDPNTIQISTLLSIKTGSCPEDCKYCPQSS 62

Query: 77  HNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLG 136
             K+ LK   L+ ++Q+L  AK AK++G++R+CMGAAW+ PKE+D+  +  +IK +K +G
Sbjct: 63  RYKTGLKKEPLLEIEQILSAAKKAKDSGSSRFCMGAAWKNPKEKDMPYLEKIIKKIKEMG 122

Query: 137 LETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSG 196
           +ETCMTLG L+  QA+ L+ AGLD+YNHN+DTS+ FY ++ TT T+++RL TL  VR SG
Sbjct: 123 METCMTLGTLNSTQAKKLADAGLDFYNHNLDTSKNFYSNIITTRTYQERLHTLHAVRSSG 182

Query: 197 IKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEHV 256
           +KVC GGI+GLGE   DRI++L+ L+NLS  PES+PIN+L+ IPG+   +NK V+P + +
Sbjct: 183 MKVCSGGIIGLGEKKQDRIELLMELSNLSIQPESVPINMLVKIPGTPMADNKDVEPFDFI 242

Query: 257 RIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTIL 316
           RII+VARI+MPKS +RL+AGR  M+D+ QA+CF SGANSIF G  LLT+ NP    D  L
Sbjct: 243 RIIAVARIMMPKSYIRLSAGRHKMNDQTQAMCFMSGANSIFYGCKLLTSDNPEEKHDLEL 302

Query: 317 FNRLGLIPD 325
           F +L LIP+
Sbjct: 303 FKKLDLIPE 311


>gi|58424672|gb|AAW73709.1| biotin synthase [Xanthomonas oryzae pv. oryzae KACC10331]
          Length = 368

 Score =  314 bits (803), Expect = 2e-83,   Method: Composition-based stats.
 Identities = 162/311 (52%), Positives = 220/311 (70%)

Query: 16  PKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQS 75
              W  KE+  ++++PF +LL  + +VHR +F+P  +Q+S LL++KTGGCPE+C YC Q+
Sbjct: 30  RHDWDHKELQALFDLPFPELLHRAASVHRAHFDPAEVQVSTLLSVKTGGCPEDCAYCPQA 89

Query: 76  VHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSL 135
               + + A KL+  ++V+ +A+ AK  GA+R+CMGAAWR PKERD+  +  MI+ VK++
Sbjct: 90  QRYDTGVTAQKLLETEEVVAKARQAKAAGASRFCMGAAWRSPKERDIPKVAAMIREVKAM 149

Query: 136 GLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKS 195
           GLETC TLGML   QA+ L  AGLDYYNHN+DT+  +Y  +  T  ++DRL TLE+VR  
Sbjct: 150 GLETCATLGMLDAGQARALKDAGLDYYNHNLDTAPDYYDTIIHTRQYQDRLNTLEHVRDV 209

Query: 196 GIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEH 255
           G+K CCGGI+G+GE  D RI +LL LA L   P+S+PIN L+ +PG+     +++DP E 
Sbjct: 210 GLKTCCGGIVGMGETRDHRIGLLLALATLPAHPDSVPINQLVQVPGTPLHGTQQLDPFEF 269

Query: 256 VRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTI 315
           VR+I+VARI MPKS +RL+AGR  MSDELQALCF +GANSIF G+ LLT  NP   +D  
Sbjct: 270 VRMIAVARIAMPKSMVRLSAGREAMSDELQALCFLAGANSIFYGEKLLTTGNPDTERDQT 329

Query: 316 LFNRLGLIPDL 326
           LF RLGL P  
Sbjct: 330 LFQRLGLRPMQ 340


>gi|75451062|sp|Q93GG2|BIOB_ACICA RecName: Full=Biotin synthase
 gi|15419053|gb|AAK96892.1|AF239257_1 biotin synthase [Acinetobacter calcoaceticus]
          Length = 329

 Score =  314 bits (803), Expect = 2e-83,   Method: Composition-based stats.
 Identities = 170/312 (54%), Positives = 231/312 (74%)

Query: 16  PKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQS 75
              WT  E+  +Y+ PF DL+F + +VHR++F+ N IQ+S LL+IKTG CPE+C YC+QS
Sbjct: 4   RNDWTRDEIQALYDQPFLDLVFEAQSVHRQHFQANTIQVSTLLSIKTGKCPEDCKYCSQS 63

Query: 76  VHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSL 135
            H  SKL+A K I VD+V+ EA+ AKE+G++R+CMGAAWR P ERD+  +++M++ VK+L
Sbjct: 64  AHYDSKLEAEKRIAVDKVISEAQAAKESGSSRFCMGAAWRNPHERDMPYVLEMVREVKAL 123

Query: 136 GLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKS 195
           GLETCMTLGML+  QA+ L  AGLDYYNHN+DTS  +Y H+ +T TF+DRL TL++VR +
Sbjct: 124 GLETCMTLGMLNQSQAERLKDAGLDYYNHNLDTSREYYSHIISTRTFDDRLNTLDHVRHA 183

Query: 196 GIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEH 255
           G+KVC GGI+GLGE  +DRI +L  LA +   PES+PIN+L+PI G+   E +K+D  E 
Sbjct: 184 GMKVCSGGIVGLGESRNDRIGLLQELATMPVHPESVPINMLVPIEGTPLAEVEKLDVTEW 243

Query: 256 VRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTI 315
           +R I+VARI+MP S +RL+AGR  +SD  QAL F +GANS+F G+ LLT  N    KD I
Sbjct: 244 IRTIAVARIIMPHSYIRLSAGRESLSDSDQALAFMAGANSLFSGEKLLTTPNAGEGKDQI 303

Query: 316 LFNRLGLIPDLS 327
           LF +LGL  + +
Sbjct: 304 LFAKLGLTAEKA 315


>gi|313675195|ref|YP_004053191.1| biotin synthase [Marivirga tractuosa DSM 4126]
 gi|312941893|gb|ADR21083.1| biotin synthase [Marivirga tractuosa DSM 4126]
          Length = 334

 Score =  314 bits (803), Expect = 2e-83,   Method: Composition-based stats.
 Identities = 161/316 (50%), Positives = 221/316 (69%), Gaps = 1/316 (0%)

Query: 13  TKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYC 72
           T+    WT +E+ +IYN P  +L++ + TVHR+  +P+ +Q+  LL++KTGGCPE+C YC
Sbjct: 2   TEIRNDWTKEEIEKIYNQPILELIYQAATVHREFNDPSEVQVCTLLSVKTGGCPEDCAYC 61

Query: 73  NQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKE-RDLSIIVDMIKG 131
            Q+    + +K  KL+  +QVL+ A+ AKENG+TR+CMGAAWRE ++ RD   ++DM+KG
Sbjct: 62  PQAARYHTDVKVHKLLPTEQVLESARIAKENGSTRFCMGAAWREVRDNRDFDRVLDMVKG 121

Query: 132 VKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLEN 191
           +  L +E C TLGML+  QAQ L +AGL  YNHN+DTSE  Y  + +T T++DRL T+ N
Sbjct: 122 INELDMEVCCTLGMLTESQAQKLKEAGLYAYNHNLDTSEEHYDDIISTRTYDDRLDTIGN 181

Query: 192 VRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVD 251
           VRK+ I VC GGI+GLGE  +DR+ ML TLA +   PES+P+N L+P+PG+  E+  KV 
Sbjct: 182 VRKAKISVCSGGIIGLGEQHEDRVGMLHTLATMEEHPESVPVNALVPVPGTPLEKQPKVS 241

Query: 252 PIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYN 311
             E VR+I+ ARI MPK+ +RL+AGR  M+ E QALCF +GANSIF GD LLT  NP  N
Sbjct: 242 VWEMVRMIATARITMPKAMVRLSAGRVRMNQEEQALCFMAGANSIFAGDKLLTTPNPEVN 301

Query: 312 KDTILFNRLGLIPDLS 327
           +D  LF  L L P  +
Sbjct: 302 EDAELFQTLNLKPRKA 317


>gi|262377849|ref|ZP_06071064.1| biotin synthase [Acinetobacter lwoffii SH145]
 gi|262307239|gb|EEY88387.1| biotin synthase [Acinetobacter lwoffii SH145]
          Length = 329

 Score =  314 bits (803), Expect = 2e-83,   Method: Composition-based stats.
 Identities = 162/307 (52%), Positives = 225/307 (73%)

Query: 16  PKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQS 75
              W+  E+ +IY++P  DLLF +  +HR+NFEPN +Q+S LL+IKTG CPE+C YC+QS
Sbjct: 3   RNDWSHAEIQEIYDLPLMDLLFQAQQIHRQNFEPNTVQVSTLLSIKTGRCPEDCKYCSQS 62

Query: 76  VHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSL 135
            H  + L+  K + V + + EAK AK +G+TR+CMGAAWR P ERD+  ++++++ VK L
Sbjct: 63  AHYDTDLEIEKRVEVQKAIAEAKQAKASGSTRFCMGAAWRNPHERDMPYVLELVQEVKKL 122

Query: 136 GLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKS 195
           G+ETCMTLGML+  QA+ L  AGLDYYNHN+DTS  +Y +V +T +F+DRL TL++VR +
Sbjct: 123 GMETCMTLGMLNASQAERLKDAGLDYYNHNLDTSREYYANVISTRSFDDRLNTLDHVRNA 182

Query: 196 GIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEH 255
           GI VC GGI+GLGE + DR+ +L  LA +   P S+PIN+L+PI G+   + +K+D I+ 
Sbjct: 183 GINVCSGGIVGLGEGVQDRVGLLFELATMPIHPGSVPINMLVPIEGTPLADVEKLDVIDW 242

Query: 256 VRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTI 315
           +R I+VARI+MPKS +RL+AGR  +SD  QAL F +GANS+F GD LLTA N    KD +
Sbjct: 243 IRTIAVARIIMPKSYIRLSAGRESLSDSDQALAFMAGANSLFSGDKLLTAPNSGEGKDKV 302

Query: 316 LFNRLGL 322
           LF +LGL
Sbjct: 303 LFAKLGL 309


>gi|332291558|ref|YP_004430167.1| biotin synthase [Krokinobacter diaphorus 4H-3-7-5]
 gi|332169644|gb|AEE18899.1| biotin synthase [Krokinobacter diaphorus 4H-3-7-5]
          Length = 364

 Score =  313 bits (802), Expect = 2e-83,   Method: Composition-based stats.
 Identities = 147/314 (46%), Positives = 216/314 (68%), Gaps = 1/314 (0%)

Query: 13  TKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYC 72
           T+    WT +E+  IYN P   LL+ + T HR++ +PN +Q+S LL+IKTGGCPE+CGYC
Sbjct: 2   TEIRHNWTKEEILAIYNKPMMSLLYEAATTHREHHDPNTVQVSTLLSIKTGGCPEDCGYC 61

Query: 73  NQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKER-DLSIIVDMIKG 131
            Q+    + ++ + L++V QV  +A  AK +G++R CMGAAWR  K+  +   +++M++ 
Sbjct: 62  PQAARYHTDIEGNDLMSVQQVKAQALRAKSSGSSRVCMGAAWRNVKDGPEFDNVLEMVRT 121

Query: 132 VKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLEN 191
           +  L +E C TLGM++  QA+ L++AGL  YNHN+DTSE +Y  V +T  FEDRL T+ N
Sbjct: 122 INKLDMEVCCTLGMVTENQAERLAEAGLYAYNHNLDTSEDYYKDVISTRAFEDRLDTISN 181

Query: 192 VRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVD 251
           VRK+ + VC GGI+G+GE ++DR  ML+ LA L   PES PIN L+ +PG+  E+   + 
Sbjct: 182 VRKTNVTVCSGGIIGMGEAVEDRAGMLVALAKLDPQPESTPINALVAVPGTPMEDIDPIS 241

Query: 252 PIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYN 311
             E +R+++  RI++P++++RL+AGR  MS E QA+CFF+GANSIF GD LLT  NP  N
Sbjct: 242 IWEMIRMVATTRIVLPQTQVRLSAGRTEMSREGQAMCFFAGANSIFAGDKLLTTPNPDVN 301

Query: 312 KDTILFNRLGLIPD 325
           +D  +F+ LGL P 
Sbjct: 302 EDMKMFDLLGLTPQ 315


>gi|81587707|sp|Q8D8M9|BIOB_VIBVU RecName: Full=Biotin synthase
          Length = 350

 Score =  313 bits (802), Expect = 2e-83,   Method: Composition-based stats.
 Identities = 164/308 (53%), Positives = 230/308 (74%)

Query: 16  PKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQS 75
              WT  +V ++  MPF DLLF +  VHR+    N++Q+S LL+IKTG CPE+C YC QS
Sbjct: 4   RHNWTHAQVRELMEMPFMDLLFEAQQVHRQYHPKNYVQVSTLLSIKTGACPEDCKYCPQS 63

Query: 76  VHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSL 135
              ++ ++  +L+ V++VL  A+ AK  G+TR+CMGAAW+ PKERD+ ++ DMIKGVK +
Sbjct: 64  ARYQTDVEKERLMKVERVLDAAQKAKNAGSTRFCMGAAWKNPKERDMPLLTDMIKGVKDM 123

Query: 136 GLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKS 195
           GLETCMTLGML+ EQA+ L+ AGLDYYNHN+DTS  +Y ++ TT T++DRL TL +VR +
Sbjct: 124 GLETCMTLGMLTPEQAKQLASAGLDYYNHNLDTSPEYYGNIITTRTYQDRLDTLSHVRDA 183

Query: 196 GIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEH 255
           G+K+C GGI+G+GE  +DR  +L+ LANL T PES+PIN+L+ + G+  E  ++VDP + 
Sbjct: 184 GMKICSGGIIGMGESANDRAGLLVELANLPTHPESVPINMLVKVKGTPLETAEEVDPFDF 243

Query: 256 VRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTI 315
           +R+I+VARI+MP S +RL+AGR  M++++Q LCF +GANSIF G  LLT  NPS +KD  
Sbjct: 244 IRLIAVARIMMPTSAVRLSAGRENMNEQMQTLCFMAGANSIFYGCKLLTTPNPSEDKDMQ 303

Query: 316 LFNRLGLI 323
           LFN+LG+ 
Sbjct: 304 LFNKLGIN 311


>gi|149190998|ref|ZP_01869259.1| biotin synthase [Vibrio shilonii AK1]
 gi|148835132|gb|EDL52108.1| biotin synthase [Vibrio shilonii AK1]
          Length = 350

 Score =  313 bits (802), Expect = 2e-83,   Method: Composition-based stats.
 Identities = 164/313 (52%), Positives = 231/313 (73%)

Query: 16  PKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQS 75
              WT  EV  + N PF DLLF +  VHR+  + NH+Q+S LL+IKTG CPE+C YC QS
Sbjct: 4   RHDWTHAEVQALMNKPFMDLLFEAQLVHRQFQQTNHVQVSTLLSIKTGACPEDCKYCPQS 63

Query: 76  VHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSL 135
              K+ +++ +L+ V++VL  AK AK  G+TR+CMGAAW+ PKERD+ ++ DMIKGVK +
Sbjct: 64  ARYKTDVESERLMEVERVLDAAKKAKNAGSTRFCMGAAWKNPKERDMPLLTDMIKGVKDM 123

Query: 136 GLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKS 195
           GLETCMTLGML+ +QA  L++AGLDYYNHN+DTS  FY ++ TT T++DRL TL +VR +
Sbjct: 124 GLETCMTLGMLTPDQASHLAEAGLDYYNHNLDTSPEFYGNIITTRTYQDRLDTLSHVRDA 183

Query: 196 GIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEH 255
           G+K+C GGI+G+GE  +DR  +L+ LANL   PES+PIN+L+ + G+  EE   V+P + 
Sbjct: 184 GMKICSGGIIGMGESANDRAGLLMELANLPVQPESVPINMLVKVKGTPLEEVDDVEPFDF 243

Query: 256 VRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTI 315
           +R+I++ARI+MPKS +RL+AGR  M++++QALCF +GANS+F G  LLT  NP  + D  
Sbjct: 244 IRLIAIARIMMPKSAVRLSAGRENMNEQMQALCFMAGANSVFYGCKLLTTPNPDEDTDLQ 303

Query: 316 LFNRLGLIPDLSA 328
           LF +LG+  + ++
Sbjct: 304 LFKKLGINREETS 316


>gi|254251266|ref|ZP_04944584.1| Biotin synthase [Burkholderia dolosa AUO158]
 gi|124893875|gb|EAY67755.1| Biotin synthase [Burkholderia dolosa AUO158]
          Length = 339

 Score =  313 bits (802), Expect = 2e-83,   Method: Composition-based stats.
 Identities = 173/316 (54%), Positives = 227/316 (71%)

Query: 8   PEENPTKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPE 67
                   P+ W   +V  ++ +PFNDL+F +  VHR++F+ N +QLS LL+IKTGGC E
Sbjct: 13  AIAVAAPAPQRWRVADVVALFELPFNDLIFRAQQVHREHFDANAVQLSTLLSIKTGGCEE 72

Query: 68  NCGYCNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVD 127
           +CGYC+QS H+ + LKA KL++VD VL  A+ AK NGA+R+CMGAAWR PKER +  + +
Sbjct: 73  DCGYCSQSAHHDTGLKAEKLMDVDAVLDAARAAKANGASRFCMGAAWRNPKERHMPALTE 132

Query: 128 MIKGVKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQ 187
           M++GVK+LGLETCMTLGML  EQAQ L++AGLDYYNHN+DTS  FY  V +T T++DRL 
Sbjct: 133 MVRGVKALGLETCMTLGMLEDEQAQQLAEAGLDYYNHNLDTSPEFYGQVISTRTYQDRLD 192

Query: 188 TLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEEN 247
           TL+ VR +GI VCCGGI+G+GE   +R  ++  LANL+  PES+PIN L+ I G+     
Sbjct: 193 TLDRVRDAGINVCCGGIIGMGESRRERAGLISQLANLNPYPESVPINNLVAIEGTPLAGT 252

Query: 248 KKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKN 307
             +DP E VR I+VARI MPK+ +RL+AGR  + D +QALCF +GANS+F GD LLT  N
Sbjct: 253 APLDPFEFVRTIAVARITMPKAVVRLSAGREQLDDAMQALCFLAGANSMFYGDQLLTTSN 312

Query: 308 PSYNKDTILFNRLGLI 323
           P   KD  LF RLG+ 
Sbjct: 313 PQTQKDRQLFERLGIR 328


>gi|124266976|ref|YP_001020980.1| biotin synthase [Methylibium petroleiphilum PM1]
 gi|254810750|sp|A2SGQ6|BIOB_METPP RecName: Full=Biotin synthase
 gi|124259751|gb|ABM94745.1| biotin synthase [Methylibium petroleiphilum PM1]
          Length = 330

 Score =  313 bits (802), Expect = 2e-83,   Method: Composition-based stats.
 Identities = 164/328 (50%), Positives = 226/328 (68%), Gaps = 5/328 (1%)

Query: 1   MSRSTVVPEENPTK-----KPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLS 55
           M+ +  V    P         + W+ + +  ++ +PFNDL+F +  VHR++F+ N +Q S
Sbjct: 1   MTATQPVHLVRPAPVHVHPSSERWSVEAIEALFALPFNDLIFRAQQVHREHFDANAVQRS 60

Query: 56  KLLNIKTGGCPENCGYCNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWR 115
            LL+IKTGGCPE+C YC QSVH+ + ++A KL++V  V + A+ A   GATR+CMGAAWR
Sbjct: 61  TLLSIKTGGCPEDCAYCPQSVHHDTGVEADKLMDVATVRQAAQAAAAAGATRFCMGAAWR 120

Query: 116 EPKERDLSIIVDMIKGVKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPH 175
           EPK+RD+  +V++++ VKSLGLE C TLGMLS  QAQ L +AG+DYYNHN+DT+   Y  
Sbjct: 121 EPKDRDIEKVVELVREVKSLGLEACCTLGMLSKPQAQALKEAGVDYYNHNLDTAPEAYGR 180

Query: 176 VTTTHTFEDRLQTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINL 235
           + +T  +E+RLQTL +VR +G+ VCCGGI+G+GE   +R  ++  LANL   PES+PIN 
Sbjct: 181 IISTRVYEERLQTLAHVRDAGMNVCCGGIVGMGESRRERAGLVAQLANLDPHPESVPINE 240

Query: 236 LIPIPGSKFEENKKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANS 295
           L+ + G+    + K+DP E VR I+VARI MP + +RL+AGR  M D +QALCF +GANS
Sbjct: 241 LVQVEGTPLAGSDKLDPFEFVRTIAVARITMPTAYVRLSAGRQEMGDAIQALCFLAGANS 300

Query: 296 IFVGDTLLTAKNPSYNKDTILFNRLGLI 323
           IF GD LLT  NP   +D  LF RLGL 
Sbjct: 301 IFYGDKLLTTGNPDVERDEALFERLGLT 328


>gi|114562652|ref|YP_750165.1| biotin synthase [Shewanella frigidimarina NCIMB 400]
 gi|122300165|sp|Q084I8|BIOB_SHEFN RecName: Full=Biotin synthase
 gi|114333945|gb|ABI71327.1| biotin synthase [Shewanella frigidimarina NCIMB 400]
          Length = 350

 Score =  313 bits (802), Expect = 2e-83,   Method: Composition-based stats.
 Identities = 172/314 (54%), Positives = 230/314 (73%)

Query: 13  TKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYC 72
            +    W   ++  ++ +P NDLLF +H++HR+ F+PN +Q+S+LL+IKTG CPE+C YC
Sbjct: 4   AEVRHDWQKAQIEALFALPMNDLLFKAHSIHRETFDPNEVQISRLLSIKTGACPEDCKYC 63

Query: 73  NQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGV 132
            QS    + L+  +L+ +D+VL EAK+AK  GA+R+CMGAAWR P+++D+  +  M+K V
Sbjct: 64  PQSARYDTGLEKERLLEIDKVLTEAKSAKAAGASRFCMGAAWRNPRDKDMPYLTQMVKDV 123

Query: 133 KSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENV 192
           ++LG+ETCMTLGMLS EQA  L+ AGLDYYNHN+DTS  +Y  V TT T++ RL TL NV
Sbjct: 124 RALGMETCMTLGMLSSEQAGKLADAGLDYYNHNLDTSPEYYGDVITTRTYQSRLDTLTNV 183

Query: 193 RKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDP 252
           R SG+KVC GGI+G+GE   DR  +L  LANL   P+S+PIN+L+ + G+ FE    +DP
Sbjct: 184 RASGMKVCSGGIVGMGEKATDRAGLLQQLANLEQHPDSVPINMLVKVAGTPFENIDDLDP 243

Query: 253 IEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNK 312
           +E VR I+VARILMPKSR+RL+AGR  MSDELQ++CFF+GANSIF G  LLT  NP  N 
Sbjct: 244 LEFVRTIAVARILMPKSRVRLSAGRESMSDELQSMCFFAGANSIFYGCKLLTTPNPEEND 303

Query: 313 DTILFNRLGLIPDL 326
           D  LF RLGL P+ 
Sbjct: 304 DMSLFRRLGLHPEQ 317


>gi|12044303|gb|AAG47791.1|AF311738_7 BioB [Mesorhizobium loti R7A]
 gi|20804196|emb|CAD31399.1| BIOTIN SYNTHASE PROTEIN [Mesorhizobium loti R7A]
          Length = 331

 Score =  313 bits (801), Expect = 3e-83,   Method: Composition-based stats.
 Identities = 202/307 (65%), Positives = 249/307 (81%)

Query: 19  WTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQSVHN 78
           WT  E   +Y++PFNDLLF + T+HR NF+PN +QLS+LL+IKTGGCPE+CGYC+QS H+
Sbjct: 20  WTRAEAQAVYDLPFNDLLFQAQTLHRHNFDPNKVQLSRLLSIKTGGCPEDCGYCSQSAHH 79

Query: 79  KSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLGLE 138
           +S LKASKL+ V  V+ EA  A++ GATRYCMGAAWR PK RD+  +V M++GVK+LG+E
Sbjct: 80  ESGLKASKLMEVRHVIAEATKARDAGATRYCMGAAWRNPKARDMDAVVAMVEGVKALGME 139

Query: 139 TCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSGIK 198
           TCMTLGML  EQA  L +AGLDYYNHNIDTSER+Y  + +T TF DRL TL NVR SGIK
Sbjct: 140 TCMTLGMLDLEQAARLKEAGLDYYNHNIDTSERYYSEIISTRTFADRLDTLANVRDSGIK 199

Query: 199 VCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEHVRI 258
           VCCGGI+G+GE   DRIDML+TLANL   PES+PIN+LIPI G+   E K ++PIE VR+
Sbjct: 200 VCCGGIVGMGEEPVDRIDMLVTLANLPEHPESVPINMLIPIEGTPLAEAKPIEPIEFVRV 259

Query: 259 ISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTILFN 318
           I++ARI+MPKS +RL+AGR  M+DE+QALCFF+GANSIFVGDTLLTA NP  +KDT+LF 
Sbjct: 260 IALARIMMPKSHVRLSAGRTAMTDEMQALCFFAGANSIFVGDTLLTADNPGEDKDTLLFQ 319

Query: 319 RLGLIPD 325
           RLG+ P 
Sbjct: 320 RLGIEPM 326


>gi|296283718|ref|ZP_06861716.1| biotin synthase [Citromicrobium bathyomarinum JL354]
          Length = 339

 Score =  313 bits (801), Expect = 3e-83,   Method: Composition-based stats.
 Identities = 167/321 (52%), Positives = 229/321 (71%), Gaps = 6/321 (1%)

Query: 10  ENPTKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENC 69
           +N +K    WT +E+  ++++PF +LLF + +VHR+N  P  +QL  LL+IKTGGCPE+C
Sbjct: 2   QNLSKIRTDWTREEIAGLFDLPFTELLFRAASVHRENHPPEQVQLCTLLSIKTGGCPEDC 61

Query: 70  GYCNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMI 129
           GYC+QSV   S ++ASKL++V  VL+ A  AK+ G+ R+CMGAAWR PK+RD+  IV+++
Sbjct: 62  GYCSQSVKADSGVEASKLMDVRAVLQTAAQAKDAGSQRFCMGAAWRNPKDRDMPAIVEIV 121

Query: 130 KGVKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTL 189
           KGV+++GLETCMTLGML+ +QA +L +AGLDYYNHN+DT   +Y  V +T  ++DRL TL
Sbjct: 122 KGVRAMGLETCMTLGMLTPKQADMLKEAGLDYYNHNVDTGPEYYERVISTRNYQDRLDTL 181

Query: 190 ENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKK 249
           +NVR +GI VC GGI+G+GE  +DR+  + TLA L   PES+P+N L+P+ G+   +   
Sbjct: 182 QNVRDAGINVCSGGIVGMGETREDRVGFVHTLATLERHPESVPVNALVPVKGTVLGDMLA 241

Query: 250 VDP------IEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLL 303
             P      IE VR ++VARI MP S +RL+AGR  MS+  QALCF +GANSIF GD LL
Sbjct: 242 DTPLAKIDDIEFVRTVAVARICMPMSMVRLSAGRESMSEATQALCFLAGANSIFTGDKLL 301

Query: 304 TAKNPSYNKDTILFNRLGLIP 324
           TA N   + D  LF +LGL P
Sbjct: 302 TAPNAGDDSDGALFAKLGLTP 322


>gi|161486630|ref|NP_934120.2| biotin synthase [Vibrio vulnificus YJ016]
 gi|320156732|ref|YP_004189111.1| biotin synthase [Vibrio vulnificus MO6-24/O]
 gi|326424102|ref|NP_761747.2| biotin synthase [Vibrio vulnificus CMCP6]
 gi|254811610|sp|Q7MLV0|BIOB_VIBVY RecName: Full=Biotin synthase
 gi|319932044|gb|ADV86908.1| biotin synthase [Vibrio vulnificus MO6-24/O]
 gi|319999482|gb|AAO11274.2| biotin synthase [Vibrio vulnificus CMCP6]
          Length = 350

 Score =  313 bits (801), Expect = 3e-83,   Method: Composition-based stats.
 Identities = 164/308 (53%), Positives = 230/308 (74%)

Query: 16  PKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQS 75
              WT  +V ++  MPF DLLF +  VHR+    N++Q+S LL+IKTG CPE+C YC QS
Sbjct: 4   RHNWTHAQVRELMEMPFMDLLFEAQQVHRQYHPKNYVQVSTLLSIKTGACPEDCKYCPQS 63

Query: 76  VHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSL 135
              ++ ++  +L+ V++VL  A+ AK  G+TR+CMGAAW+ PKERD+ ++ DMIKGVK +
Sbjct: 64  ARYQTDVEKERLMEVERVLDAAQKAKNAGSTRFCMGAAWKNPKERDMPLLTDMIKGVKDM 123

Query: 136 GLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKS 195
           GLETCMTLGML+ EQA+ L+ AGLDYYNHN+DTS  +Y ++ TT T++DRL TL +VR +
Sbjct: 124 GLETCMTLGMLTPEQAKQLASAGLDYYNHNLDTSPEYYGNIITTRTYQDRLDTLSHVRDA 183

Query: 196 GIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEH 255
           G+K+C GGI+G+GE  +DR  +L+ LANL T PES+PIN+L+ + G+  E  ++VDP + 
Sbjct: 184 GMKICSGGIIGMGESANDRAGLLVELANLPTHPESVPINMLVKVKGTPLETAEEVDPFDF 243

Query: 256 VRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTI 315
           +R+I+VARI+MP S +RL+AGR  M++++Q LCF +GANSIF G  LLT  NPS +KD  
Sbjct: 244 IRLIAVARIMMPTSAVRLSAGRENMNEQMQTLCFMAGANSIFYGCKLLTTPNPSEDKDMQ 303

Query: 316 LFNRLGLI 323
           LFN+LG+ 
Sbjct: 304 LFNKLGIN 311


>gi|148982180|ref|ZP_01816622.1| biotin synthase [Vibrionales bacterium SWAT-3]
 gi|145960630|gb|EDK25979.1| biotin synthase [Vibrionales bacterium SWAT-3]
          Length = 350

 Score =  313 bits (801), Expect = 3e-83,   Method: Composition-based stats.
 Identities = 161/313 (51%), Positives = 222/313 (70%)

Query: 16  PKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQS 75
              WT  EV  +   PF DL+F +  VHR+  E NH+Q+S LL+IKTG CPE+C YC QS
Sbjct: 4   RHDWTVAEVKALLEKPFMDLMFEAQLVHRQYQEHNHVQVSTLLSIKTGACPEDCKYCPQS 63

Query: 76  VHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSL 135
            H ++ +   +L+ V++VL  A+ AK  G+TR+CMGAAW+ PKERD+  + DMIKGVK +
Sbjct: 64  AHYRTDVDKERLMEVERVLDAAQKAKNAGSTRFCMGAAWKNPKERDMPHLTDMIKGVKGM 123

Query: 136 GLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKS 195
           GLETCMTLGML+ EQA  L+ AGLDYYNHN+DTS  FY  + TT T++DRL TL +VR +
Sbjct: 124 GLETCMTLGMLTPEQAGELADAGLDYYNHNLDTSPEFYGSIITTRTYQDRLDTLSHVRDA 183

Query: 196 GIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEH 255
           G+K+C GGI+G+GE  +DR  +L+ LANL   PES+PIN+L+ + G+  E    V+  + 
Sbjct: 184 GMKICSGGIIGMGESTNDRAGLLVELANLPVHPESVPINMLVKVKGTPMENVDDVESFDF 243

Query: 256 VRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTI 315
           +++I++ARI+MPKS +RL+AGR  M++++QA+CF +GANSIF G  LLT  NP  + D  
Sbjct: 244 IKLIAIARIMMPKSAVRLSAGRENMNEQMQAMCFMAGANSIFYGCKLLTTPNPDEDTDMQ 303

Query: 316 LFNRLGLIPDLSA 328
           LF +LG+     A
Sbjct: 304 LFKKLGINSQEVA 316


>gi|209518230|ref|ZP_03267057.1| biotin synthase [Burkholderia sp. H160]
 gi|209501345|gb|EEA01374.1| biotin synthase [Burkholderia sp. H160]
          Length = 354

 Score =  313 bits (801), Expect = 3e-83,   Method: Composition-based stats.
 Identities = 168/327 (51%), Positives = 224/327 (68%), Gaps = 2/327 (0%)

Query: 1   MSRSTVVPEENPTKKP--KVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLL 58
           M++  +  +   T+      W   ++  +Y +PFNDLLF +   HR++F+ N +QLS LL
Sbjct: 1   MTQLNIAADTAATEAKPLARWRVADIVALYELPFNDLLFRAQQTHREHFDANAVQLSTLL 60

Query: 59  NIKTGGCPENCGYCNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPK 118
           +IKTGGC E+C YC QSVH+ + L A KL+ VD VL  A+ AK+NGATR+CMGAAWR PK
Sbjct: 61  SIKTGGCEEDCAYCPQSVHHDTGLVADKLMAVDDVLAAAQVAKQNGATRFCMGAAWRNPK 120

Query: 119 ERDLSIIVDMIKGVKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTT 178
           +R L  I DMI+GVK++GLETC+TLGML   QAQ L  AGLDYYNHN+DTS  FY  + +
Sbjct: 121 DRHLEPIKDMIRGVKAMGLETCVTLGMLETHQAQALRDAGLDYYNHNLDTSPEFYGQIIS 180

Query: 179 THTFEDRLQTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIP 238
           T T++DRL TLE VR +GI VCCGGI+G+GE   +R  ++  LAN+   PES+PIN L+ 
Sbjct: 181 TRTYQDRLDTLERVRDAGINVCCGGIVGMGESRRERAGLIAQLANMEPYPESVPINNLVQ 240

Query: 239 IPGSKFEENKKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFV 298
           + G+     + +DP E VR I++ RI MP++ +RL+AGR  M + LQA+CF +GANSIF 
Sbjct: 241 VQGTPLTGTEAIDPFEFVRTIAIVRITMPRAMVRLSAGREQMDEALQAMCFLAGANSIFY 300

Query: 299 GDTLLTAKNPSYNKDTILFNRLGLIPD 325
           GD LLT  NP    D  L  RLG+  +
Sbjct: 301 GDQLLTTSNPQAEADRKLLARLGIRAE 327


>gi|91793014|ref|YP_562665.1| biotin synthase [Shewanella denitrificans OS217]
 gi|123166183|sp|Q12NN4|BIOB_SHEDO RecName: Full=Biotin synthase
 gi|91715016|gb|ABE54942.1| biotin synthase [Shewanella denitrificans OS217]
          Length = 357

 Score =  313 bits (801), Expect = 3e-83,   Method: Composition-based stats.
 Identities = 175/311 (56%), Positives = 232/311 (74%)

Query: 16  PKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQS 75
              W   E+  ++ +P NDLLF +HT+HR++F+PN +Q+S+LL+IKTG CPE+C YC QS
Sbjct: 7   RHDWKKAEIEALFALPMNDLLFKAHTIHRESFDPNEVQISRLLSIKTGACPEDCKYCPQS 66

Query: 76  VHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSL 135
               + L+  +L+ +++VL EAK+AK  GA+R+CMGAAWR P++RD+  +  M+K VK+L
Sbjct: 67  ARYDTGLEKERLLEIEKVLTEAKSAKAAGASRFCMGAAWRNPRDRDMPYLTQMVKDVKAL 126

Query: 136 GLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKS 195
           GLETCMTLGMLS EQ+Q L+ AGLDYYNHN+DTS  +Y  V TT T++ RL TL NVR S
Sbjct: 127 GLETCMTLGMLSTEQSQKLAGAGLDYYNHNLDTSPEYYGDVITTRTYQSRLDTLSNVRAS 186

Query: 196 GIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEH 255
           G+KVC GGI+G+GE   DR  +L  LANL   P+S+PIN+L+ + G+ FE+   +DP+E 
Sbjct: 187 GMKVCSGGIVGMGEKASDRAGLLQQLANLEQHPDSVPINMLVKVAGTPFEKIDDLDPLEF 246

Query: 256 VRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTI 315
           VR I+VARI+MPKSR+RL+AGR  MSDELQ++CFF+GANSIF G  LLT  NP  N D  
Sbjct: 247 VRTIAVARIIMPKSRVRLSAGREKMSDELQSMCFFAGANSIFYGCKLLTTANPEENDDMS 306

Query: 316 LFNRLGLIPDL 326
           LF RLGL P+ 
Sbjct: 307 LFKRLGLRPEQ 317


>gi|239833335|ref|ZP_04681663.1| biotin synthase [Ochrobactrum intermedium LMG 3301]
 gi|239821398|gb|EEQ92967.1| biotin synthase [Ochrobactrum intermedium LMG 3301]
          Length = 336

 Score =  312 bits (800), Expect = 4e-83,   Method: Composition-based stats.
 Identities = 205/317 (64%), Positives = 255/317 (80%)

Query: 7   VPEENPTKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCP 66
             +     +   WT      +Y +PFNDLL  + +VHR NF+PN +QLSKLLNIKTGGCP
Sbjct: 12  AEKTASKSEQDAWTRASARLLYELPFNDLLLEAQSVHRANFDPNRVQLSKLLNIKTGGCP 71

Query: 67  ENCGYCNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIV 126
           E+CGYC+QS H+ S LKAS+L+++D VL+EA+ AK++GATRYCMGAAWR PK RD   IV
Sbjct: 72  EDCGYCSQSAHHASGLKASRLMSLDTVLEEAQKAKDSGATRYCMGAAWRSPKTRDEPAIV 131

Query: 127 DMIKGVKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRL 186
           +M+K VK+LGLETCMTLGMLS +QAQ  ++AGLDYYNHNIDTSERFYP V TT +F+DRL
Sbjct: 132 EMVKQVKALGLETCMTLGMLSPDQAQTFAEAGLDYYNHNIDTSERFYPQVITTRSFDDRL 191

Query: 187 QTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEE 246
           +TL +VR++GIKVC GGILGLGE  DDR+DML+TLANL  PPES+PIN+LIP+PGS+ E+
Sbjct: 192 ETLTHVREAGIKVCSGGILGLGETEDDRVDMLVTLANLPIPPESVPINMLIPMPGSRLEK 251

Query: 247 NKKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAK 306
              VDPI  VRII++AR++MP+S +RL AGR+ MSDE+QALCFF+GANSIF+GD LLTA 
Sbjct: 252 ASPVDPIAFVRIIALARLMMPQSHVRLTAGRSSMSDEMQALCFFAGANSIFIGDMLLTAA 311

Query: 307 NPSYNKDTILFNRLGLI 323
           NP  ++DT L  RLGL 
Sbjct: 312 NPGEDRDTSLMRRLGLT 328


>gi|237749140|ref|ZP_04579620.1| biotin synthase [Oxalobacter formigenes OXCC13]
 gi|229380502|gb|EEO30593.1| biotin synthase [Oxalobacter formigenes OXCC13]
          Length = 350

 Score =  312 bits (800), Expect = 4e-83,   Method: Composition-based stats.
 Identities = 154/317 (48%), Positives = 227/317 (71%)

Query: 11  NPTKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCG 70
           N     + W   E+  +Y +PFN+LLF +  +HR NF    ++L+ L+++KTG C E+CG
Sbjct: 14  NEVPAFETWPVAEILALYELPFNELLFRAQEIHRANFPEGDVELATLISLKTGACTEDCG 73

Query: 71  YCNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIK 130
           YC+QS+H+ ++++ SK+++++ V+  AK AKENGA R+CMGA+ R P +RD    +++++
Sbjct: 74  YCSQSIHHNTEVEPSKMLSLETVMAAAKKAKENGANRFCMGASGRSPNDRDFEKYLNIVR 133

Query: 131 GVKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLE 190
            VKSLGLETCMTLGML  EQA+ L +AGLDYYNHN+DT+   Y +V +T T++DRL TL 
Sbjct: 134 SVKSLGLETCMTLGMLKEEQAEQLKEAGLDYYNHNLDTAPSHYNNVISTRTYQDRLDTLG 193

Query: 191 NVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKV 250
            VRK+GIKVCCGGI+G+GE    R +++  LANL+  PE++PIN L+PIPG+     +++
Sbjct: 194 RVRKAGIKVCCGGIIGMGESRQQRAELIAQLANLNPYPEAVPINHLVPIPGTPLFGVEQL 253

Query: 251 DPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSY 310
           DP+E VR I+V RI+MP++R+R++AGR  + + +QALCF +GANSIF G+ LLT  N   
Sbjct: 254 DPLEFVRTIAVTRIVMPQARVRMSAGRHELGEAIQALCFLAGANSIFYGEKLLTTDNSEA 313

Query: 311 NKDTILFNRLGLIPDLS 327
            +D  +  +LGL    S
Sbjct: 314 EEDRAMLAKLGLKTRES 330


>gi|254469923|ref|ZP_05083328.1| biotin synthase [Pseudovibrio sp. JE062]
 gi|211961758|gb|EEA96953.1| biotin synthase [Pseudovibrio sp. JE062]
          Length = 348

 Score =  312 bits (800), Expect = 4e-83,   Method: Composition-based stats.
 Identities = 188/316 (59%), Positives = 244/316 (77%)

Query: 10  ENPTKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENC 69
           +N ++    WT +E   +YN+PFNDLLF +H VHR++F+PN +Q S+LL+IKTGGCPE+C
Sbjct: 20  QNSSEIRTNWTREEAEALYNLPFNDLLFKAHCVHREHFDPNEVQQSQLLSIKTGGCPEDC 79

Query: 70  GYCNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMI 129
            YC+QS  N ++L ASK++ V  VL+EAK AKE+GATRYCMGAAWR PK+RD+  I  M+
Sbjct: 80  AYCSQSARNNTELSASKMLEVQMVLEEAKKAKESGATRYCMGAAWRSPKDRDMRAIEMMV 139

Query: 130 KGVKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTL 189
           +GVK LG+E+CMTLGML+ EQ   L  AGLDYYNHNIDTSER+Y  + TT  F DR+ TL
Sbjct: 140 EGVKELGMESCMTLGMLTPEQILRLKDAGLDYYNHNIDTSERYYSEIITTRKFSDRIDTL 199

Query: 190 ENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKK 249
             V+++GIKVC GGI+G+GE   DR+DML++LA L   P+S+PIN+LIPI G+  ++ + 
Sbjct: 200 NLVKEAGIKVCSGGIVGMGEKDMDRLDMLVSLATLDEHPDSVPINMLIPIEGTPLQDAEP 259

Query: 250 VDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPS 309
           VDPI+ VR+I+VARI+MPKS +RL+AGR  MSDE QA+ FF+GANSIF GDTLLT  NP 
Sbjct: 260 VDPIDFVRLIAVARIMMPKSHVRLSAGRTEMSDETQAMSFFAGANSIFKGDTLLTTDNPE 319

Query: 310 YNKDTILFNRLGLIPD 325
            +KD  LF RLG+ P 
Sbjct: 320 DSKDAALFKRLGIRPM 335


>gi|71901873|ref|ZP_00683934.1| Biotin synthase [Xylella fastidiosa Ann-1]
 gi|71728361|gb|EAO30531.1| Biotin synthase [Xylella fastidiosa Ann-1]
          Length = 341

 Score =  312 bits (799), Expect = 4e-83,   Method: Composition-based stats.
 Identities = 162/308 (52%), Positives = 222/308 (72%)

Query: 18  VWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQSVH 77
            WT++E+  ++++   +LL+ + +VHR++F+P  IQ+S LL++KTGGCPE+C YC Q+  
Sbjct: 8   DWTAEELHALFDLSLPELLYRAASVHRQHFDPAEIQVSTLLSVKTGGCPEDCSYCPQAQR 67

Query: 78  NKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLGL 137
             + + A KL++V+ V+ +A+ AK  GA+R+CMGAAWR PK+RD+  IV MI+ VK+LGL
Sbjct: 68  YDTGVTAQKLMDVNAVVAKARQAKLAGASRFCMGAAWRSPKDRDIPKIVSMIREVKALGL 127

Query: 138 ETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSGI 197
           ETC TLGML+  QAQ L  AGLDYYNHN+DTS  FY  +  T  ++DRL TL +VR  G+
Sbjct: 128 ETCATLGMLNTCQAQALKDAGLDYYNHNVDTSPDFYDSIIHTRQYQDRLDTLAHVRDVGL 187

Query: 198 KVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEHVR 257
           K CCGGI+G+GE    R+ +LLTLA L   P+S+P+NLL+ + G+     + +DP E VR
Sbjct: 188 KTCCGGIVGMGETRQHRVGLLLTLATLPAHPDSVPVNLLVQVAGTPLHGAQTLDPFEFVR 247

Query: 258 IISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTILF 317
           +I+VARI MP+S +RL+AGR  MSDELQ LCF +GANSIF G+ LLT  NP   +D  LF
Sbjct: 248 MIAVARITMPRSMVRLSAGRETMSDELQLLCFMAGANSIFYGEKLLTTANPETERDQALF 307

Query: 318 NRLGLIPD 325
            RLGL P 
Sbjct: 308 QRLGLRPM 315


>gi|194367599|ref|YP_002030209.1| biotin synthase [Stenotrophomonas maltophilia R551-3]
 gi|254811592|sp|B4SM81|BIOB_STRM5 RecName: Full=Biotin synthase
 gi|194350403|gb|ACF53526.1| biotin synthase [Stenotrophomonas maltophilia R551-3]
          Length = 347

 Score =  312 bits (799), Expect = 5e-83,   Method: Composition-based stats.
 Identities = 163/314 (51%), Positives = 220/314 (70%)

Query: 12  PTKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGY 71
                  W   E+  ++++PF +LLF +  VHR++F+P  +Q+S LL++KTGGCPE+C Y
Sbjct: 2   AAAIRHDWQHDELQALFDLPFPELLFRAAAVHREHFDPAQVQVSTLLSVKTGGCPEDCAY 61

Query: 72  CNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKG 131
           C Q+    + + A KL+  D VL +A+ AK  GA+R+CMGAAWR PK+RD+  +  MI G
Sbjct: 62  CPQAQRYNTGVNAQKLMETDAVLAKARQAKAAGASRFCMGAAWRSPKDRDIPKVAAMIAG 121

Query: 132 VKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLEN 191
           VK+LGLETC TLGMLS  QA+ L  AGLDYYNHN+DT+  +Y  +  T  ++DRL TLE+
Sbjct: 122 VKALGLETCATLGMLSGGQARALKDAGLDYYNHNLDTAPDYYDSIIHTRQYQDRLDTLEH 181

Query: 192 VRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVD 251
           VR +G+K CCGGI+G+GE    R+ +LL LA L   P+S+PIN L+ + G+    + ++D
Sbjct: 182 VRDAGLKTCCGGIVGMGETRAQRVGLLLALATLPAHPDSVPINKLVQVAGTPLHGSAELD 241

Query: 252 PIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYN 311
           P E VR+I+VARI+MP+S +RL+AGR  MSDELQALCF +GANSIF GD LLT  NP   
Sbjct: 242 PFEFVRMIAVARIVMPRSMVRLSAGREAMSDELQALCFVAGANSIFYGDKLLTTGNPESE 301

Query: 312 KDTILFNRLGLIPD 325
           +D  LF RLGL P 
Sbjct: 302 RDLALFARLGLQPM 315


>gi|78067747|ref|YP_370516.1| biotin synthase [Burkholderia sp. 383]
 gi|123728895|sp|Q39CE4|BIOB_BURS3 RecName: Full=Biotin synthase
 gi|77968492|gb|ABB09872.1| Biotin synthase [Burkholderia sp. 383]
          Length = 340

 Score =  312 bits (799), Expect = 5e-83,   Method: Composition-based stats.
 Identities = 178/324 (54%), Positives = 233/324 (71%), Gaps = 2/324 (0%)

Query: 2   SRSTVVPEENPTKKP--KVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLN 59
           + +TV P+  P   P  + W   +V  ++ +PFNDLLF +  VHR++F+ N +QLS LL+
Sbjct: 6   TAATVQPDAIPVAAPVSQRWRVADVVALFELPFNDLLFRAQQVHREHFDANAVQLSTLLS 65

Query: 60  IKTGGCPENCGYCNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKE 119
           IKTGGC E+CGYC+QS H+ + LKA KL++VD VL  A+ AK NGA+R+CMGAAWR PKE
Sbjct: 66  IKTGGCEEDCGYCSQSSHHDTGLKAEKLMDVDAVLDAARAAKANGASRFCMGAAWRNPKE 125

Query: 120 RDLSIIVDMIKGVKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTT 179
           R +  + +M++GVK LGLETCMTLGML  EQAQ L+ AGLDYYNHN+DTS  FY  V +T
Sbjct: 126 RHMPALTEMVRGVKELGLETCMTLGMLEDEQAQELASAGLDYYNHNLDTSPEFYGQVIST 185

Query: 180 HTFEDRLQTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPI 239
            T++DRL TL+ VR +GI VCCGGI+G+GE   +R  ++  LANL+  P+S+PIN L+ I
Sbjct: 186 RTYQDRLDTLDRVRDAGINVCCGGIIGMGESRRERAGLISQLANLNPYPDSVPINNLVAI 245

Query: 240 PGSKFEENKKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVG 299
            G+  E    +DP E VR I+VARI MPK+ +RL+AGR  + D LQA+CF +GANS+F G
Sbjct: 246 EGTPLEGTAPLDPFEFVRTIAVARITMPKAVVRLSAGREQLDDGLQAMCFLAGANSMFYG 305

Query: 300 DTLLTAKNPSYNKDTILFNRLGLI 323
           D LLT  NP   KD  LF RLG+ 
Sbjct: 306 DQLLTTSNPQSQKDRALFERLGIR 329


>gi|86130847|ref|ZP_01049446.1| biotin synthase [Dokdonia donghaensis MED134]
 gi|85818258|gb|EAQ39418.1| biotin synthase [Dokdonia donghaensis MED134]
          Length = 364

 Score =  312 bits (799), Expect = 5e-83,   Method: Composition-based stats.
 Identities = 147/314 (46%), Positives = 215/314 (68%), Gaps = 1/314 (0%)

Query: 13  TKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYC 72
           T+    WT +E+  IYN P   LL+ + T HR++ +PN +Q+S LL+IKTGGCPE+CGYC
Sbjct: 2   TEIRHNWTKEEILAIYNKPMMTLLYEAATTHREHHDPNTVQVSTLLSIKTGGCPEDCGYC 61

Query: 73  NQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKER-DLSIIVDMIKG 131
            Q+    + ++ + L++V QV  +A  AK +G++R CMGAAWR  K+  +   +++M++ 
Sbjct: 62  PQAARYHTDIEGNDLMSVQQVKAQALRAKASGSSRVCMGAAWRNVKDGPEFDNVLEMVRT 121

Query: 132 VKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLEN 191
           +  L +E C TLGM++  QA+ L++AGL  YNHN+DTSE +Y  V +T  FEDRL T+ N
Sbjct: 122 INKLDMEVCCTLGMVTENQAERLAEAGLYAYNHNLDTSEDYYKDVISTRAFEDRLDTISN 181

Query: 192 VRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVD 251
           VRK+ + VC GGI+G+GE ++DR  ML  LA L   PES PIN L+ +PG+  E+   + 
Sbjct: 182 VRKTNVTVCSGGIIGMGEAVEDRAGMLAALAKLDPQPESTPINALVAVPGTPMEDIDPIS 241

Query: 252 PIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYN 311
             E +R+++  RI++P++++RL+AGR  MS E QA+CFF+GANSIF GD LLT  NP  N
Sbjct: 242 IWEMIRMVATTRIVLPQTQVRLSAGRTEMSREGQAMCFFAGANSIFAGDKLLTTPNPDVN 301

Query: 312 KDTILFNRLGLIPD 325
           +D  +F+ LGL P 
Sbjct: 302 EDMKMFDLLGLTPQ 315


>gi|190576256|ref|YP_001974101.1| putative biotin synthase [Stenotrophomonas maltophilia K279a]
 gi|254811593|sp|B2FLM4|BIOB_STRMK RecName: Full=Biotin synthase
 gi|190014178|emb|CAQ47822.1| putative biotin synthase [Stenotrophomonas maltophilia K279a]
          Length = 347

 Score =  312 bits (799), Expect = 5e-83,   Method: Composition-based stats.
 Identities = 164/314 (52%), Positives = 221/314 (70%)

Query: 12  PTKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGY 71
                  W   E+  ++++PF +LLF +  VHR++F+P  +Q+S LL++KTGGCPE+C Y
Sbjct: 2   AAAIRHDWQHDELQALFDLPFPELLFRAAAVHREHFDPAQVQVSTLLSVKTGGCPEDCAY 61

Query: 72  CNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKG 131
           C Q+    + + A KL+  D VL +A+ AK  GA+R+CMGAAWR PK+RD+  +  MI G
Sbjct: 62  CPQAQRYSTGVNAQKLMETDAVLAKARQAKAAGASRFCMGAAWRSPKDRDIPKVAAMIAG 121

Query: 132 VKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLEN 191
           VK+LGLETC TLGMLS EQA+ L  AGLDYYNHN+DT+  +Y  +  T  ++DRL TLE+
Sbjct: 122 VKALGLETCATLGMLSGEQARALKDAGLDYYNHNLDTAPDYYDSIIHTRQYQDRLDTLEH 181

Query: 192 VRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVD 251
           VR +G+K CCGGI+G+GE    R+ +LL LA+L   P+S+PIN L+ + G+    + ++D
Sbjct: 182 VRDAGLKTCCGGIVGMGETRAQRVGLLLALASLPAHPDSVPINKLVQVAGTPLHGSAELD 241

Query: 252 PIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYN 311
           P E VR+I+VARI MP+S +RL+AGR  MSDELQALCF +GANSIF GD LLT  NP   
Sbjct: 242 PFEFVRMIAVARIAMPRSMVRLSAGREAMSDELQALCFLAGANSIFYGDKLLTTGNPESE 301

Query: 312 KDTILFNRLGLIPD 325
           +D  LF RLGL P 
Sbjct: 302 RDLALFARLGLQPM 315


>gi|238920717|ref|YP_002934232.1| biotin synthase, [Edwardsiella ictaluri 93-146]
 gi|238870286|gb|ACR69997.1| biotin synthase, putative [Edwardsiella ictaluri 93-146]
          Length = 347

 Score =  312 bits (798), Expect = 6e-83,   Method: Composition-based stats.
 Identities = 158/310 (50%), Positives = 223/310 (71%)

Query: 18  VWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQSVH 77
            WT  +   ++  P  +L+F +  VHR++F+P  +Q+S LL+IKTG CPE+C YC QS  
Sbjct: 9   RWTQAQAQALFEQPLLELMFQAQQVHRQHFDPRQVQVSTLLSIKTGACPEDCKYCPQSAR 68

Query: 78  NKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLGL 137
            K+ L A +L+ V+QVL  A+ A+  G+TR+CMGAAW+ P ERD+  +  M++GVK+LG+
Sbjct: 69  YKTGLAAERLMEVEQVLDSARRARAAGSTRFCMGAAWKNPHERDMPYLEQMVRGVKALGM 128

Query: 138 ETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSGI 197
           ETCMTLG L+ +QAQ L++AGLDYYNHN+DTS  +Y ++ TT  ++DRL TL  VR++GI
Sbjct: 129 ETCMTLGALNADQAQRLAQAGLDYYNHNLDTSPEYYANIITTRRYQDRLDTLARVREAGI 188

Query: 198 KVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEHVR 257
           KVC GGI+GLGE + DR  +L+ LANL  PPES+PIN+L+ + G+   E   VDP + +R
Sbjct: 189 KVCSGGIVGLGEAVRDRAALLVALANLPMPPESVPINMLVKVAGTPLAETPDVDPFDFIR 248

Query: 258 IISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTILF 317
            I+ ARI+MP S +RL+AGR  M+++ QA+CF +GANS+F G  LLT  NPS ++D  LF
Sbjct: 249 TIAAARIMMPSSYVRLSAGREQMNEQTQAMCFMAGANSLFYGCRLLTTPNPSEDRDLQLF 308

Query: 318 NRLGLIPDLS 327
            +LGL P  +
Sbjct: 309 RKLGLNPRQT 318


>gi|83945796|ref|ZP_00958139.1| biotin synthase [Oceanicaulis alexandrii HTCC2633]
 gi|83850799|gb|EAP88661.1| biotin synthase [Oceanicaulis alexandrii HTCC2633]
          Length = 332

 Score =  312 bits (798), Expect = 6e-83,   Method: Composition-based stats.
 Identities = 173/321 (53%), Positives = 232/321 (72%), Gaps = 1/321 (0%)

Query: 4   STVVPEENPTKK-PKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKT 62
           ST++ + +   +    WT  EV  +++ PFNDL+F + ++HR+   PN +Q S+LL+IKT
Sbjct: 2   STLLTDLDRLAEPRHDWTRDEVAALHDAPFNDLIFAAQSLHRRVHRPNTVQKSRLLSIKT 61

Query: 63  GGCPENCGYCNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDL 122
           GGC E+CGYCNQS H  + LKASKL++ ++V K+A  AK +GATR+CMGAAWRE KERD 
Sbjct: 62  GGCAEDCGYCNQSAHFDTGLKASKLMDPEEVEKKAIEAKNSGATRFCMGAAWRELKERDE 121

Query: 123 SIIVDMIKGVKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTF 182
             I DMI+ VK LGLETCMTLGML   QA+ L++AGLDYYNHN+DTS  +Y  + TT T+
Sbjct: 122 PKIHDMIRRVKGLGLETCMTLGMLGEGQAERLAEAGLDYYNHNLDTSPEYYKQIITTRTW 181

Query: 183 EDRLQTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGS 242
           +DR+ TL  VR +G+K CCGGI+G+GE  +DRI +L  LA L   PES+P+N L+ + G+
Sbjct: 182 DDRIDTLAKVRAAGMKTCCGGIIGMGESKEDRIGLLTELATLPVHPESVPVNHLVDVAGT 241

Query: 243 KFEENKKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTL 302
               ++ +D ++ VR I+ AR++MPKS +RL+AGR  MS ELQALCF +GA SIFVGD L
Sbjct: 242 PLSGSESLDGLDFVRAIATARLIMPKSVVRLSAGRETMSRELQALCFLAGAGSIFVGDEL 301

Query: 303 LTAKNPSYNKDTILFNRLGLI 323
           LT  NP  + DT+LF  LGL 
Sbjct: 302 LTTPNPDQDTDTVLFRDLGLE 322


>gi|71275499|ref|ZP_00651785.1| Biotin synthase [Xylella fastidiosa Dixon]
 gi|71900747|ref|ZP_00682868.1| Biotin synthase [Xylella fastidiosa Ann-1]
 gi|170729294|ref|YP_001774727.1| biotin synthase [Xylella fastidiosa M12]
 gi|254813112|sp|B0U2A0|BIOB_XYLFM RecName: Full=Biotin synthase
 gi|71163799|gb|EAO13515.1| Biotin synthase [Xylella fastidiosa Dixon]
 gi|71729477|gb|EAO31587.1| Biotin synthase [Xylella fastidiosa Ann-1]
 gi|167964087|gb|ACA11097.1| Biotin synthase [Xylella fastidiosa M12]
          Length = 341

 Score =  312 bits (798), Expect = 6e-83,   Method: Composition-based stats.
 Identities = 163/308 (52%), Positives = 221/308 (71%)

Query: 18  VWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQSVH 77
            WT++E+  ++++   +LL+ + +VHR++F+P  IQ+S LL++KTGGCPE+C YC Q+  
Sbjct: 8   DWTAEELHALFDLSLPELLYRAASVHRQHFDPAEIQVSTLLSVKTGGCPEDCSYCPQAQR 67

Query: 78  NKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLGL 137
             + + A KL++VD V+ +A+ AK  GA+R+CMGAAWR PK+RD+  I  MI+ VK+LGL
Sbjct: 68  YDTGVTAQKLMDVDAVVAKARQAKLAGASRFCMGAAWRSPKDRDIPKIASMIREVKALGL 127

Query: 138 ETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSGI 197
           ETC TLGML+  QAQ L  AGLDYYNHN+DTS  FY  V  T  ++DRL TL +VR  G+
Sbjct: 128 ETCATLGMLNTCQAQALKDAGLDYYNHNVDTSPDFYDSVIHTRQYQDRLDTLAHVRDVGL 187

Query: 198 KVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEHVR 257
           K CCGGI+G+GE    R+ +LLTLA L   P+S+P+NLL+ + G+     + +DP E VR
Sbjct: 188 KTCCGGIVGMGETRQHRVGLLLTLATLPAHPDSVPVNLLVQVAGTPLHGTQTLDPFEFVR 247

Query: 258 IISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTILF 317
           +I+VARI MP+S +RL+AGR  MSDELQ LCF +GANSIF G+ LLT  NP   +D  LF
Sbjct: 248 MIAVARITMPRSMVRLSAGRESMSDELQLLCFMAGANSIFYGEKLLTTANPETERDQALF 307

Query: 318 NRLGLIPD 325
            RLGL P 
Sbjct: 308 QRLGLRPM 315


>gi|34499836|ref|NP_904051.1| biotin synthase [Chromobacterium violaceum ATCC 12472]
 gi|81654054|sp|Q7NPW1|BIOB_CHRVO RecName: Full=Biotin synthase
 gi|34105686|gb|AAQ62040.1| biotin synthase [Chromobacterium violaceum ATCC 12472]
          Length = 327

 Score =  312 bits (798), Expect = 6e-83,   Method: Composition-based stats.
 Identities = 158/326 (48%), Positives = 217/326 (66%), Gaps = 2/326 (0%)

Query: 1   MSRSTVVPEENPTKKPKV--WTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLL 58
           M  +T+V +   T  P+   W+  +V  +  +PF +L+F +  +HR+ F+P  +QLS L+
Sbjct: 1   MHSATMVFKRAATPHPEKAEWSVDDVEALLGLPFMELVFRAAEIHRQFFDPTKVQLSTLV 60

Query: 59  NIKTGGCPENCGYCNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPK 118
           +IKTGGCPE+CGYC QSVH+ + +    ++ VD+V+  A+ AK NGA R+CMGAAWR PK
Sbjct: 61  SIKTGGCPEDCGYCPQSVHHDTPVADQPMMTVDEVVAAARQAKANGAGRFCMGAAWRGPK 120

Query: 119 ERDLSIIVDMIKGVKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTT 178
           + DL   +DM++ VK+LGLETC T G+L   QA+ L  AGLDYYNHN+DT+   Y  +  
Sbjct: 121 DADLQKTLDMVREVKALGLETCATFGLLRDGQAEQLKDAGLDYYNHNLDTAPDKYGDIIQ 180

Query: 179 THTFEDRLQTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIP 238
           T  +EDRL TL  VRK+G+ VCCGGI+G+ E   DR  +++ LANL   PES+P+N L+ 
Sbjct: 181 TREYEDRLDTLGKVRKAGLSVCCGGIVGMNETRRDRAGLIVQLANLDPQPESVPVNNLVQ 240

Query: 239 IPGSKFEENKKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFV 298
           + G+  E  +++D  E VR I+VARI MP S +RL+AGR  M +  QALCF +GANSIF 
Sbjct: 241 VVGTPLEGAERLDWTEFVRTIAVARITMPASYVRLSAGRREMDEATQALCFLAGANSIFY 300

Query: 299 GDTLLTAKNPSYNKDTILFNRLGLIP 324
           GD LLT  NP    D  L  +L L P
Sbjct: 301 GDKLLTTGNPDVVADQSLMAKLNLQP 326


>gi|257091918|ref|YP_003165559.1| biotin synthase [Candidatus Accumulibacter phosphatis clade IIA
           str. UW-1]
 gi|257044442|gb|ACV33630.1| biotin synthase [Candidatus Accumulibacter phosphatis clade IIA
           str. UW-1]
          Length = 329

 Score =  312 bits (798), Expect = 6e-83,   Method: Composition-based stats.
 Identities = 164/321 (51%), Positives = 224/321 (69%)

Query: 4   STVVPEENPTKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTG 63
           +T+  + +PT     WT  EV  +Y +P  DL++ +  VHR+NF+ N IQ S LL++KTG
Sbjct: 8   ATLAQDCSPTTHSARWTVAEVEALYQLPLMDLIYRAQQVHRENFDANAIQRSTLLSVKTG 67

Query: 64  GCPENCGYCNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLS 123
           GC E+CGYC+Q+    +  +   L+ +D+V+  A+ AK+ GA+R+CMGAAWR PK++DL+
Sbjct: 68  GCSEDCGYCSQAARYTTGTEREALLPLDEVIAAAQAAKDKGASRFCMGAAWRGPKDKDLA 127

Query: 124 IIVDMIKGVKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFE 183
            + +MI+ VK LGL+TC+TLGML   QA  L +AGLDYYNHN+DT   FY  V TTH   
Sbjct: 128 KVTEMIRAVKGLGLQTCVTLGMLKEGQADELKEAGLDYYNHNLDTDASFYGQVITTHKHA 187

Query: 184 DRLQTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSK 243
           DR+ TL  VR++G+KVC GGI+G+GE   +R  +++ LANL+ PPES+PIN L+PIPG+ 
Sbjct: 188 DRIDTLGQVREAGLKVCSGGIIGMGESRRNRAALIVQLANLNPPPESVPINNLVPIPGTP 247

Query: 244 FEENKKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLL 303
                 +D  E VR I+ ARI MP S +RL+AGR  M++ELQALCF +GANSIF GD LL
Sbjct: 248 MAALAPIDNFEFVRTIAAARITMPASFVRLSAGRQAMAEELQALCFLAGANSIFYGDKLL 307

Query: 304 TAKNPSYNKDTILFNRLGLIP 324
           T  NP  ++D  LF +LGL P
Sbjct: 308 TTGNPEADRDEALFEKLGLRP 328


>gi|237746987|ref|ZP_04577467.1| biotin synthase [Oxalobacter formigenes HOxBLS]
 gi|229378338|gb|EEO28429.1| biotin synthase [Oxalobacter formigenes HOxBLS]
          Length = 350

 Score =  312 bits (798), Expect = 6e-83,   Method: Composition-based stats.
 Identities = 152/311 (48%), Positives = 226/311 (72%)

Query: 13  TKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYC 72
              P+ W  K++  +Y +PF++L+F +  +HR +F    ++L+ L+++KTG C E+CGYC
Sbjct: 16  VSPPETWPVKDILALYELPFHELMFRAQEIHRAHFPEGDVELATLISLKTGACTEDCGYC 75

Query: 73  NQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGV 132
           +QS+H+ + +  SK++++D V+  A+ A+ENGATR+CMGA+ R P +RD    + +++ V
Sbjct: 76  SQSIHHNTDVTPSKMLSLDTVVAAARKARENGATRFCMGASGRSPNDRDFEKYLQIVRAV 135

Query: 133 KSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENV 192
           KSLGLETCMTLGML  EQA+ L +AGLDYYNHN+DT+   Y H+ +T T++DRL TL  V
Sbjct: 136 KSLGLETCMTLGMLKEEQAEKLKEAGLDYYNHNLDTAPSHYTHIISTRTYQDRLDTLGRV 195

Query: 193 RKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDP 252
           RK+GIKVCCGGI+G+GE    R +++  LANL+  PE++PIN L+PI G+  ++ K +DP
Sbjct: 196 RKAGIKVCCGGIIGMGESRQQRAELISQLANLNPYPEAVPINHLVPIEGTPLQDVKPLDP 255

Query: 253 IEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNK 312
           +E VR I+V RI+MP++R+R++AGR  + + +QALCF +GANSIF G+ LLT  N   N+
Sbjct: 256 LEFVRTIAVTRIVMPEARVRMSAGRHELGEAIQALCFLAGANSIFYGEKLLTTDNSEANE 315

Query: 313 DTILFNRLGLI 323
           D  L  +LGL 
Sbjct: 316 DRALLAKLGLK 326


>gi|21672559|ref|NP_660626.1| biotin synthase [Buchnera aphidicola str. Sg (Schizaphis graminum)]
 gi|25008172|sp|Q8K9P1|BIOB_BUCAP RecName: Full=Biotin synthase
 gi|21623185|gb|AAM67837.1| biotin synthase [Buchnera aphidicola str. Sg (Schizaphis graminum)]
          Length = 342

 Score =  312 bits (798), Expect = 7e-83,   Method: Composition-based stats.
 Identities = 166/309 (53%), Positives = 228/309 (73%)

Query: 17  KVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQSV 76
           + W  ++  ++++ PF DL+F +   HR+ F PN IQ+S LL+IKTG CPE+C YC QS 
Sbjct: 3   RKWNLEDTKKLFSKPFFDLIFEAQKKHREYFNPNRIQISTLLSIKTGACPEDCKYCPQSS 62

Query: 77  HNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLG 136
             K+ LK   L+ ++Q+LK AK AK +G+TR+CMGAAW+ PKE+D+  +  ++K VK +G
Sbjct: 63  RYKTGLKKEPLLEIEQILKAAKKAKSSGSTRFCMGAAWKNPKEKDMPYLEKIVKEVKKMG 122

Query: 137 LETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSG 196
           +ETCMTLG L+  QA+ L+KAGLD+YNHN+DTS  FY  + TT T+E+RL TL+ VR SG
Sbjct: 123 METCMTLGTLNNSQAKKLAKAGLDFYNHNLDTSSNFYSSIITTRTYEERLSTLKKVRNSG 182

Query: 197 IKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEHV 256
           +K+C GGI+GLGE   DR+++L+ L+NLS  PES+PIN+L+ IPG+  E+N+ VDP E +
Sbjct: 183 MKICSGGIIGLGEKKQDRMELLMELSNLSIQPESVPINMLVKIPGTPMEKNENVDPFEFI 242

Query: 257 RIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTIL 316
           R+I+  RI+MPKS +RL+AGR  MSDE QA+CF +GANSIF G  LLT+ NP   KD  L
Sbjct: 243 RVIAATRIMMPKSYIRLSAGRENMSDETQAMCFMAGANSIFYGCKLLTSSNPKEEKDQKL 302

Query: 317 FNRLGLIPD 325
           F +L L PD
Sbjct: 303 FEKLDLFPD 311


>gi|86147109|ref|ZP_01065426.1| biotin synthase [Vibrio sp. MED222]
 gi|218710020|ref|YP_002417641.1| biotin synthase [Vibrio splendidus LGP32]
 gi|254811609|sp|B7VH16|BIOB_VIBSL RecName: Full=Biotin synthase
 gi|85835174|gb|EAQ53315.1| biotin synthase [Vibrio sp. MED222]
 gi|218323039|emb|CAV19216.1| Biotin synthase [Vibrio splendidus LGP32]
          Length = 350

 Score =  311 bits (797), Expect = 7e-83,   Method: Composition-based stats.
 Identities = 160/313 (51%), Positives = 221/313 (70%)

Query: 16  PKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQS 75
              WT  EV  +   PF DL+F +  VHR+  E NH+Q+S LL+IKTG CPE+C YC QS
Sbjct: 4   RHDWTVAEVRALLEKPFMDLMFEAQVVHRQYQEHNHVQVSTLLSIKTGACPEDCKYCPQS 63

Query: 76  VHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSL 135
            H ++ +   +L+ V++VL  A+ AK  G+TR+CMGAAW+ PKERD+  + DMIKGVK +
Sbjct: 64  AHYRTDVDKERLMEVERVLDAAQKAKNAGSTRFCMGAAWKNPKERDMPHLTDMIKGVKGM 123

Query: 136 GLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKS 195
           GLETCMTLGML+ +QA  L+ AGLDYYNHN+DTS  FY  + TT T++DRL TL +VR +
Sbjct: 124 GLETCMTLGMLTPDQAGELADAGLDYYNHNLDTSPEFYGSIITTRTYQDRLDTLSHVRDA 183

Query: 196 GIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEH 255
           G+K+C GGI+G+GE  +DR  +L+ LANL   PES+PIN+L+ + G+  E    V+  + 
Sbjct: 184 GMKICSGGIIGMGESTNDRAGLLVELANLPVHPESVPINMLVKVKGTPMENVDDVESFDF 243

Query: 256 VRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTI 315
           V++I++ARI+MP S +RL+AGR  M++++QA+CF +GANSIF G  LLT  NP  + D  
Sbjct: 244 VKLIAIARIMMPMSAVRLSAGRENMNEQMQAMCFMAGANSIFYGCKLLTTPNPDEDTDMQ 303

Query: 316 LFNRLGLIPDLSA 328
           LF +LG+     A
Sbjct: 304 LFKKLGINSQQVA 316


>gi|149377511|ref|ZP_01895252.1| biotin synthase [Marinobacter algicola DG893]
 gi|149358203|gb|EDM46684.1| biotin synthase [Marinobacter algicola DG893]
          Length = 341

 Score =  311 bits (797), Expect = 7e-83,   Method: Composition-based stats.
 Identities = 166/304 (54%), Positives = 236/304 (77%)

Query: 22  KEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQSVHNKSK 81
           +E   ++ +PFNDLLF + +VHR++F+PN +Q+S LL+IKTG CPE+C YC QS H  + 
Sbjct: 2   QEARALFELPFNDLLFRAQSVHREHFDPNEVQISTLLSIKTGACPEDCKYCPQSGHYNTG 61

Query: 82  LKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLGLETCM 141
           L+  KL+ +++V+ EAK AK  GA+R+CMGAAWR P ++++  +VDM++ VKSLGLETCM
Sbjct: 62  LEKEKLLEIEKVVAEAKAAKAKGASRFCMGAAWRSPSKKNMEYVVDMVRQVKSLGLETCM 121

Query: 142 TLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSGIKVCC 201
           TLGML  EQA  L++AGLDYYNHN+DTSE++Y H+ TT T++DRL TLENVR +G+KVCC
Sbjct: 122 TLGMLEQEQADELAEAGLDYYNHNLDTSEKYYSHIITTRTYQDRLDTLENVRNAGMKVCC 181

Query: 202 GGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEHVRIISV 261
           GGI+G+GE  DDR+ +L+ L+NL   PES+P+N+L+ + G+  E+ + +DP + +R I+V
Sbjct: 182 GGIVGMGEDPDDRVGLLVQLSNLPHHPESVPVNMLVKVAGTPMEDVEDLDPFDFIRTIAV 241

Query: 262 ARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTILFNRLG 321
           ARI+MP S +RL+AGR  M++++Q+LCF +GANSIF G+ LLT  NP  + D  LF RLG
Sbjct: 242 ARIMMPASHVRLSAGRENMNEQMQSLCFLAGANSIFYGEKLLTTANPEADADRELFKRLG 301

Query: 322 LIPD 325
           + P+
Sbjct: 302 IRPE 305


>gi|134093392|ref|YP_001098467.1| biotin synthase [Herminiimonas arsenicoxydans]
 gi|254810719|sp|A4G1F1|BIOB_HERAR RecName: Full=Biotin synthase
 gi|133737295|emb|CAL60338.1| Biotin synthase [Herminiimonas arsenicoxydans]
          Length = 339

 Score =  311 bits (797), Expect = 7e-83,   Method: Composition-based stats.
 Identities = 156/326 (47%), Positives = 225/326 (69%), Gaps = 5/326 (1%)

Query: 3   RSTVVPEENPTKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKT 62
           ++ V P       P  W   +V  ++N+PFN+L+F + TVHR++F+P+ ++L+ LL+IKT
Sbjct: 9   QAPVAPIV-----PTAWPVDDVLALFNLPFNELMFRAQTVHREHFDPSEVELATLLSIKT 63

Query: 63  GGCPENCGYCNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDL 122
           GGCPE+CGYC Q+    + + A K++ +++VL  A+ AK +GATR+CMGAAWREPK+RDL
Sbjct: 64  GGCPEDCGYCPQAARYDTGVTAQKILPLEEVLTAAREAKAHGATRFCMGAAWREPKDRDL 123

Query: 123 SIIVDMIKGVKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTF 182
             + +M++ VK++G+ETC TLGML   QA+ L  AGLDYYNHN+DT+  FY +V +T  +
Sbjct: 124 EKVEEMVREVKAMGMETCATLGMLGEGQAEKLKNAGLDYYNHNLDTAPEFYSNVISTRDY 183

Query: 183 EDRLQTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGS 242
           ++R+ TL  VR  GIKVCCGGI+G+GE    R  ++  L N+   PES+P+N L+ + G+
Sbjct: 184 QNRIDTLARVRNVGIKVCCGGIVGMGESRLQRAGLIAQLCNMDPYPESVPVNNLVQVEGT 243

Query: 243 KFEENKKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTL 302
                  +DP+E VR ++VARI MPK+R+RL+AGR  M + +QALCF +GANSIF GD L
Sbjct: 244 PLHGTDPIDPLEFVRTVAVARITMPKARVRLSAGRREMGEAIQALCFVAGANSIFYGDKL 303

Query: 303 LTAKNPSYNKDTILFNRLGLIPDLSA 328
           LT  NP    D  L  +LG+    +A
Sbjct: 304 LTTGNPEALADQELLEKLGMHTRSTA 329


>gi|295698752|ref|YP_003603407.1| biotin synthase [Candidatus Riesia pediculicola USDA]
 gi|291157200|gb|ADD79645.1| biotin synthase [Candidatus Riesia pediculicola USDA]
          Length = 339

 Score =  311 bits (797), Expect = 8e-83,   Method: Composition-based stats.
 Identities = 162/311 (52%), Positives = 226/311 (72%)

Query: 17  KVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQSV 76
           K WT  +  +++N+PF +L+F +  +HR +F P  +Q+S LL+IKTG CPE+C YC+QS 
Sbjct: 3   KRWTVSQAEKLFNLPFFELIFEAQKIHRVHFNPQSVQISTLLSIKTGNCPEDCKYCSQSA 62

Query: 77  HNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLG 136
             ++ LKA KLI  D+V+  A+ AK+ GATR+CMGAAWR P +RD+  +  +++ VKSLG
Sbjct: 63  RYRTDLKAEKLIKFDKVMDSARQAKKAGATRFCMGAAWRNPNDRDIPYLQKIVREVKSLG 122

Query: 137 LETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSG 196
           LETCMTLG LS  QA  LS+AGLDYYNHN+DTSE FY  + TT  +++R++T+E V+K+G
Sbjct: 123 LETCMTLGTLSENQANSLSEAGLDYYNHNLDTSEEFYEKIITTRKYQERIETIERVQKAG 182

Query: 197 IKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEHV 256
           IKVC GGILGLGE + DR  +L+ LANL   PES+PIN+L+ I G+     KK+D  + V
Sbjct: 183 IKVCSGGILGLGETVKDRASLLVQLANLPKVPESVPINMLVQIKGTPLFNEKKIDFFDFV 242

Query: 257 RIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTIL 316
           R I+ ARI++P S +RL+AGR  M++++QALCF +GANS+F G  LLT  NP+  +D IL
Sbjct: 243 RTIAAARIMLPSSFIRLSAGRKNMNEQMQALCFIAGANSVFSGCKLLTTDNPNEQEDHIL 302

Query: 317 FNRLGLIPDLS 327
           F +L +  D +
Sbjct: 303 FKKLDINLDFT 313


>gi|28197987|ref|NP_778301.1| biotin synthase [Xylella fastidiosa Temecula1]
 gi|182680613|ref|YP_001828773.1| biotin synthase [Xylella fastidiosa M23]
 gi|81585832|sp|Q87F85|BIOB_XYLFT RecName: Full=Biotin synthase
 gi|254813111|sp|B2I672|BIOB_XYLF2 RecName: Full=Biotin synthase
 gi|28056047|gb|AAO27950.1| biotin synthase [Xylella fastidiosa Temecula1]
 gi|182630723|gb|ACB91499.1| biotin synthase [Xylella fastidiosa M23]
 gi|307579072|gb|ADN63041.1| biotin synthase [Xylella fastidiosa subsp. fastidiosa GB514]
          Length = 341

 Score =  311 bits (797), Expect = 8e-83,   Method: Composition-based stats.
 Identities = 163/308 (52%), Positives = 221/308 (71%)

Query: 18  VWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQSVH 77
            WT++E+  ++++   +LL+ + +VHR++F+P  IQ+S LL++KTGGCPE+C YC Q+  
Sbjct: 8   DWTAEELHALFDLSLPELLYRAASVHRQHFDPAEIQVSTLLSVKTGGCPEDCSYCPQAQR 67

Query: 78  NKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLGL 137
             + + A KL++VD V+ +A+ AK  GA+R+CMGAAWR PK+RD+  I  MI+ VK+LGL
Sbjct: 68  YDTGVTAQKLMDVDAVVAKARQAKLAGASRFCMGAAWRSPKDRDIPKIASMIREVKALGL 127

Query: 138 ETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSGI 197
           ETC TLGML+  QAQ L  AGLDYYNHN+DTS  FY  V  T  ++DRL TL +VR  G+
Sbjct: 128 ETCATLGMLNTCQAQALKDAGLDYYNHNVDTSPDFYDSVIHTRQYQDRLDTLAHVRDVGL 187

Query: 198 KVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEHVR 257
           K CCGGI+G+GE    R+ +LLTLA L   P+S+P+NLL+ + G+     + +DP E VR
Sbjct: 188 KTCCGGIVGMGETRQHRVGLLLTLATLPAHPDSVPVNLLVQVAGTPLHGTQTLDPFEFVR 247

Query: 258 IISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTILF 317
           +I+VARI MP+S +RL+AGR  MSDELQ LCF +GANSIF G+ LLT  NP   +D  LF
Sbjct: 248 MIAVARITMPRSMVRLSAGRESMSDELQLLCFMAGANSIFYGEKLLTTANPETERDQALF 307

Query: 318 NRLGLIPD 325
            RLGL P 
Sbjct: 308 QRLGLRPM 315


>gi|254524308|ref|ZP_05136363.1| biotin synthase [Stenotrophomonas sp. SKA14]
 gi|219721899|gb|EED40424.1| biotin synthase [Stenotrophomonas sp. SKA14]
          Length = 347

 Score =  311 bits (797), Expect = 9e-83,   Method: Composition-based stats.
 Identities = 164/314 (52%), Positives = 221/314 (70%)

Query: 12  PTKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGY 71
                  W   E+  ++++PF +LLF +  VHR++F+P+ +Q+S LL++KTGGCPE+C Y
Sbjct: 2   AAAIRHDWQHDELQALFDLPFPELLFRAAAVHREHFDPSQVQVSTLLSVKTGGCPEDCAY 61

Query: 72  CNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKG 131
           C Q+    + + A KL+  D VL +A+ AK  GA+R+CMGAAWR PK+RD+  +  MI G
Sbjct: 62  CPQAQRYSTGVNAQKLMETDAVLAKARQAKAAGASRFCMGAAWRSPKDRDIPKVAAMIAG 121

Query: 132 VKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLEN 191
           VK+LGLETC TLGMLS EQA+ L  AGLDYYNHN+DT+  +Y  +  T  ++DRL TLE+
Sbjct: 122 VKALGLETCATLGMLSGEQARALKDAGLDYYNHNLDTAPDYYDSIIHTRQYQDRLDTLEH 181

Query: 192 VRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVD 251
           VR +G+K CCGGI+G+GE    R+ +LL LA L   P+S+PIN L+ + G+    + ++D
Sbjct: 182 VRDAGLKTCCGGIVGMGETRAQRVGLLLALATLPAHPDSVPINKLVQVAGTPLHGSAELD 241

Query: 252 PIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYN 311
           P E VR+I+VARI MP+S +RL+AGR  MSDELQALCF +GANSIF GD LLT  NP   
Sbjct: 242 PFEFVRMIAVARIAMPRSMVRLSAGREAMSDELQALCFIAGANSIFYGDKLLTTGNPESE 301

Query: 312 KDTILFNRLGLIPD 325
           +D  LF RLGL P 
Sbjct: 302 RDLALFARLGLQPM 315


>gi|150024344|ref|YP_001295170.1| biotin synthase [Flavobacterium psychrophilum JIP02/86]
 gi|254810687|sp|A6GW77|BIOB_FLAPJ RecName: Full=Biotin synthase
 gi|149770885|emb|CAL42350.1| Biotin synthase [Flavobacterium psychrophilum JIP02/86]
          Length = 362

 Score =  311 bits (796), Expect = 1e-82,   Method: Composition-based stats.
 Identities = 148/311 (47%), Positives = 216/311 (69%), Gaps = 1/311 (0%)

Query: 16  PKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQS 75
              WT +E+  IYN P  DLL+ + ++HR+  +PN +Q+S LL+IKTGGCPE+CGYC Q+
Sbjct: 5   RNNWTKEEIIAIYNKPLMDLLYEAASIHREYHDPNVVQVSTLLSIKTGGCPEDCGYCPQA 64

Query: 76  VHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKER-DLSIIVDMIKGVKS 134
               + ++ + L++V QV  +A  AK +G++R CMGAAWR  K+  +   +++M++ +  
Sbjct: 65  ARYHTDIEGNDLMSVQQVKAQALRAKSSGSSRVCMGAAWRNVKDGPEFDQVLEMVRTINK 124

Query: 135 LGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRK 194
           L +E C TLGM++  QA  L++AGL  YNHN+DTSE +Y  V +T  FEDR++T+ NVRK
Sbjct: 125 LDMEVCCTLGMITENQAHRLAEAGLYAYNHNLDTSEEYYKEVISTRGFEDRIETIANVRK 184

Query: 195 SGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIE 254
           + + VC GGI+G+GE I DR  ML+ L+ LS  PES+PIN L+ + G+  EE K V+  E
Sbjct: 185 TNVTVCSGGIIGMGESIGDRAGMLVALSTLSPQPESVPINALVAVEGTPMEEEKPVEIWE 244

Query: 255 HVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDT 314
            +R+++  RI+MP++++RL+AGR  M+ E QA+CFF+GANSIF GD LLT  NP  N+D 
Sbjct: 245 MIRMVATTRIIMPETQVRLSAGRMNMTREGQAMCFFAGANSIFAGDKLLTTPNPDVNEDM 304

Query: 315 ILFNRLGLIPD 325
            +F  LGL P 
Sbjct: 305 KMFEMLGLNPQ 315


>gi|258544889|ref|ZP_05705123.1| biotin synthase [Cardiobacterium hominis ATCC 15826]
 gi|258519809|gb|EEV88668.1| biotin synthase [Cardiobacterium hominis ATCC 15826]
          Length = 338

 Score =  311 bits (796), Expect = 1e-82,   Method: Composition-based stats.
 Identities = 159/308 (51%), Positives = 226/308 (73%)

Query: 19  WTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQSVHN 78
           WT  +   +Y++PF +LL+ + TVHR + +P  IQ+S LL+IKTG CPE+C YC QS   
Sbjct: 4   WTLAQAQALYDLPFMELLYQAQTVHRAHHDPQQIQISTLLSIKTGACPEDCKYCPQSARY 63

Query: 79  KSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLGLE 138
            + +    L+ +D++   A+ A+E GATR+CMGAAWR+PKE+D+  +V++++ VK+LGLE
Sbjct: 64  HTGVAREALLKIDEITAAAERAREQGATRFCMGAAWRDPKEKDMPYLVEVVRRVKALGLE 123

Query: 139 TCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSGIK 198
           TCMTLGML   +AQ L+ AGLDYYNHN+DTS R+Y  + TT  ++DRL TL++VR +G+K
Sbjct: 124 TCMTLGMLDETKAQTLADAGLDYYNHNLDTSRRYYGEIITTRNYDDRLHTLQHVRNAGMK 183

Query: 199 VCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEHVRI 258
           +C GGILG+GE  DDR+ ML+ LANL  PPES+PIN L+ + G+   +   ++P + +R+
Sbjct: 184 ICSGGILGMGEGEDDRLAMLVELANLDPPPESVPINQLVRVKGTPLAQADDLEPFDFIRV 243

Query: 259 ISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTILFN 318
           I+VARILMPKS +RL+AGR  M++++QALCF +GANSIF G  LLT  NP  ++D  LF 
Sbjct: 244 IAVARILMPKSAVRLSAGRESMNEQMQALCFMAGANSIFYGCKLLTTPNPEEDRDAALFA 303

Query: 319 RLGLIPDL 326
           +L L P +
Sbjct: 304 KLDLNPQM 311


>gi|148244608|ref|YP_001219302.1| biotin synthetase [Candidatus Vesicomyosocius okutanii HA]
 gi|254811604|sp|A5CWW0|BIOB_VESOH RecName: Full=Biotin synthase
 gi|146326435|dbj|BAF61578.1| biotin synthetase [Candidatus Vesicomyosocius okutanii HA]
          Length = 322

 Score =  311 bits (796), Expect = 1e-82,   Method: Composition-based stats.
 Identities = 173/311 (55%), Positives = 236/311 (75%)

Query: 13  TKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYC 72
           T++   WT KEV  ++ +PFNDLLF +H++HRKNF+PN +Q+S LLNIKTG CPE+C YC
Sbjct: 2   TQQRHNWTLKEVEALFTLPFNDLLFQAHSIHRKNFDPNQVQISSLLNIKTGACPEDCLYC 61

Query: 73  NQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGV 132
           +QS    + L+  KL+ +D VLK+AK A++NGATR+CMGAAWR P ++ ++ ++ MI+GV
Sbjct: 62  SQSSKYDTGLEREKLMEIDLVLKQAKQAQDNGATRFCMGAAWRNPTDKSINKVIPMIQGV 121

Query: 133 KSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENV 192
           K +G+ETC+TLGML+ +QA +L + GLDYYNHNIDTS+  Y ++ TT  F+DRL TLE+V
Sbjct: 122 KDMGMETCVTLGMLTQKQAFVLKEVGLDYYNHNIDTSKENYSNIVTTRNFQDRLNTLESV 181

Query: 193 RKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDP 252
           + + I+VC GGILGLGE   DR  ML +L+NL+  P+S+P+NLL+PIPG+ FE  +    
Sbjct: 182 QNANIRVCSGGILGLGEDQTDRASMLRSLSNLAIHPDSVPLNLLVPIPGTPFENIEPPTE 241

Query: 253 IEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNK 312
            E +R I+VARI+MPKS +RL+AGR  M D +QALCFF+GANSIF G+ LLT  NP+ + 
Sbjct: 242 SEFIRTIAVARIMMPKSVVRLSAGRTKMGDTMQALCFFAGANSIFYGEQLLTTDNPNTDS 301

Query: 313 DTILFNRLGLI 323
           D  LF RLG+ 
Sbjct: 302 DQDLFVRLGIN 312


>gi|15836669|ref|NP_297357.1| biotin synthase [Xylella fastidiosa 9a5c]
 gi|81623859|sp|Q9PH80|BIOB_XYLFA RecName: Full=Biotin synthase
 gi|9104834|gb|AAF82877.1|AE003860_4 biotin synthase [Xylella fastidiosa 9a5c]
          Length = 341

 Score =  311 bits (796), Expect = 1e-82,   Method: Composition-based stats.
 Identities = 163/308 (52%), Positives = 221/308 (71%)

Query: 18  VWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQSVH 77
            WT++E+  ++++   +LL+ + +VHR++F+P  IQ+S LL++KTGGCPE+C YC Q+  
Sbjct: 8   DWTAEELHALFDLSLPELLYRAASVHRQHFDPAEIQVSTLLSVKTGGCPEDCSYCPQAQR 67

Query: 78  NKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLGL 137
             + + A KL++VD V+ +A+ AK  GA+R+CMGAAWR PK+RD+  I  MI+ VK+LGL
Sbjct: 68  YDTGVTAQKLMDVDAVVAKARQAKLAGASRFCMGAAWRSPKDRDIPKIAAMIREVKALGL 127

Query: 138 ETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSGI 197
           ETC TLGML+  QAQ L  AGLDYYNHN+DTS  FY  V  T  ++DRL TL +VR  G+
Sbjct: 128 ETCATLGMLNTCQAQALKDAGLDYYNHNVDTSPDFYDSVIHTRQYQDRLDTLAHVRDVGL 187

Query: 198 KVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEHVR 257
           K CCGGI+G+GE    R+ +LLTLA L   P+S+P+NLL+ + G+     + +DP E VR
Sbjct: 188 KTCCGGIVGMGETRQHRVGLLLTLATLPAHPDSVPVNLLVQVAGTPLHGTQTLDPFEFVR 247

Query: 258 IISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTILF 317
           +I+VARI MP+S +RL+AGR  MSDELQ LCF +GANSIF G+ LLT  NP   +D  LF
Sbjct: 248 MIAVARITMPRSMVRLSAGRESMSDELQLLCFMAGANSIFYGEKLLTTANPETERDQALF 307

Query: 318 NRLGLIPD 325
            RLGL P 
Sbjct: 308 QRLGLRPM 315


>gi|126740059|ref|ZP_01755749.1| biotin synthetase [Roseobacter sp. SK209-2-6]
 gi|126718878|gb|EBA15590.1| biotin synthetase [Roseobacter sp. SK209-2-6]
          Length = 326

 Score =  311 bits (796), Expect = 1e-82,   Method: Composition-based stats.
 Identities = 189/313 (60%), Positives = 241/313 (76%)

Query: 11  NPTKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCG 70
           +       WT +E  +IYN PF DLLF + +VHR++++PN +Q SKLL+IKTGGC E+C 
Sbjct: 3   DAAPIRSDWTREEAEEIYNQPFMDLLFQAQSVHRQHYDPNQVQKSKLLSIKTGGCAEDCA 62

Query: 71  YCNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIK 130
           YC+QS  N +KL ASKLI V++V+ EA+ AKE GATRYCMGAAWR PKERD+  +  M++
Sbjct: 63  YCSQSARNGAKLSASKLIEVERVIAEARKAKEGGATRYCMGAAWRSPKERDMPALEAMVE 122

Query: 131 GVKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLE 190
           GVK+LG+ETCMTLGML  +Q   L  AGLDYYNHNIDTSER+Y  + TT TF DR+ TL 
Sbjct: 123 GVKALGMETCMTLGMLEEDQVFRLRDAGLDYYNHNIDTSERYYKEIITTRTFADRIDTLN 182

Query: 191 NVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKV 250
            VR++GIKVC GGI+G+GE   DRIDM+L LA L   P+S+P+N+LIPI  +   +  K+
Sbjct: 183 KVREAGIKVCSGGIVGMGEQQLDRIDMMLALATLDVHPDSVPVNMLIPIADTPLADVAKL 242

Query: 251 DPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSY 310
           DPIE VR +++ARILMPKS +RL+AGR  MSDELQA+CFF+GANSIFVGDTLLTA NP  
Sbjct: 243 DPIEFVRTVALARILMPKSHVRLSAGRTDMSDELQAMCFFAGANSIFVGDTLLTADNPEE 302

Query: 311 NKDTILFNRLGLI 323
           +KD +LF++LG+ 
Sbjct: 303 DKDQVLFDKLGIT 315


>gi|253995945|ref|YP_003048009.1| biotin synthase [Methylotenera mobilis JLW8]
 gi|253982624|gb|ACT47482.1| biotin synthase [Methylotenera mobilis JLW8]
          Length = 355

 Score =  311 bits (796), Expect = 1e-82,   Method: Composition-based stats.
 Identities = 157/306 (51%), Positives = 215/306 (70%)

Query: 18  VWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQSVH 77
            W+  E+ +++ +PF+DL+  + TVHR+NF+PN +Q+S LL+IKTGGC E+CGYC Q+  
Sbjct: 48  RWSVAEIVELFELPFSDLMHRAQTVHRENFDPNAVQVSTLLSIKTGGCSEDCGYCPQAAR 107

Query: 78  NKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLGL 137
             + +++  L+ +D VL  A+ AK+NGA+R+CMGAAWR PK+RDL  ++ MI  VK++GL
Sbjct: 108 YHTDVESEPLMALDDVLAAAQEAKDNGASRFCMGAAWRGPKQRDLEPVLKMIAEVKAMGL 167

Query: 138 ETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSGI 197
           ETC TLGML   QA+ L  AGLDYYNHN+DT+  FY  V TT T++DRL+TL+ VR   I
Sbjct: 168 ETCATLGMLKEGQAEQLKDAGLDYYNHNLDTAPEFYGEVITTRTYQDRLETLDRVRSVDI 227

Query: 198 KVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEHVR 257
            VC GGI+G+GE  + R  +L  LAN+  PPES+PINLL  + G+      ++DP+E VR
Sbjct: 228 NVCSGGIIGMGESRNQRAGLLAQLANMERPPESVPINLLTQVEGTPLHGTDELDPLEFVR 287

Query: 258 IISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTILF 317
            I+ ARI MP S +RL+AGR  M + +Q LCF +GANSIF G+ LLT  NP    D  LF
Sbjct: 288 TIAAARITMPNSFVRLSAGRQSMHEGIQTLCFLAGANSIFYGEKLLTTGNPEAETDKQLF 347

Query: 318 NRLGLI 323
            +LG+ 
Sbjct: 348 AKLGIN 353


>gi|163738672|ref|ZP_02146086.1| thiamine biosynthesis protein ThiC [Phaeobacter gallaeciensis
           BS107]
 gi|163741640|ref|ZP_02149031.1| biotin synthase [Phaeobacter gallaeciensis 2.10]
 gi|161385374|gb|EDQ09752.1| biotin synthase [Phaeobacter gallaeciensis 2.10]
 gi|161388000|gb|EDQ12355.1| thiamine biosynthesis protein ThiC [Phaeobacter gallaeciensis
           BS107]
          Length = 325

 Score =  311 bits (796), Expect = 1e-82,   Method: Composition-based stats.
 Identities = 190/313 (60%), Positives = 238/313 (76%)

Query: 11  NPTKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCG 70
           +       WT +E   IYN PF DLLF +HTVHR+ F+PN +Q SKLL+IKTGGC E+C 
Sbjct: 3   DAAPIRTDWTREEAEAIYNTPFMDLLFQAHTVHRQYFDPNQVQKSKLLSIKTGGCAEDCA 62

Query: 71  YCNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIK 130
           YC+QS  N ++L ASKLI V +V+ EA+ AKE GATRYCMGAAWR PK+RD++ +  M++
Sbjct: 63  YCSQSARNGAQLSASKLIEVQRVIAEARKAKEGGATRYCMGAAWRSPKDRDMAALEAMVQ 122

Query: 131 GVKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLE 190
           GVK LG+ETCMTLGML  +Q   L  AGLDYYNHNIDTSER+Y  + TT TF DR+ TL 
Sbjct: 123 GVKDLGMETCMTLGMLEEDQVFRLRDAGLDYYNHNIDTSERYYSEIITTRTFADRIDTLN 182

Query: 191 NVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKV 250
            VR++GIKVC GGI+G+GE   DRIDM+L LA L   P+S+P+N+LIPI  +     +K+
Sbjct: 183 RVREAGIKVCSGGIVGMGEQQLDRIDMMLALATLEVHPDSVPVNMLIPIADTPLANVEKL 242

Query: 251 DPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSY 310
           DPIE VR +++ARILMPKS +RL+AGR  MSDE+QA+CFF+GANSIFVGDTLLTA NP  
Sbjct: 243 DPIEFVRSVALARILMPKSHVRLSAGRTDMSDEMQAMCFFAGANSIFVGDTLLTADNPEE 302

Query: 311 NKDTILFNRLGLI 323
           +KD  LF+RLG+ 
Sbjct: 303 DKDQQLFDRLGIT 315


>gi|161523551|ref|YP_001578563.1| biotin synthase [Burkholderia multivorans ATCC 17616]
 gi|189351679|ref|YP_001947307.1| biotin synthetase [Burkholderia multivorans ATCC 17616]
 gi|221199842|ref|ZP_03572885.1| biotin synthase [Burkholderia multivorans CGD2M]
 gi|221207489|ref|ZP_03580498.1| biotin synthase [Burkholderia multivorans CGD2]
 gi|254810582|sp|A9AE44|BIOB_BURM1 RecName: Full=Biotin synthase
 gi|160340980|gb|ABX14066.1| biotin synthase [Burkholderia multivorans ATCC 17616]
 gi|189335701|dbj|BAG44771.1| biotin synthetase [Burkholderia multivorans ATCC 17616]
 gi|221172692|gb|EEE05130.1| biotin synthase [Burkholderia multivorans CGD2]
 gi|221180081|gb|EEE12485.1| biotin synthase [Burkholderia multivorans CGD2M]
          Length = 339

 Score =  310 bits (795), Expect = 1e-82,   Method: Composition-based stats.
 Identities = 173/316 (54%), Positives = 226/316 (71%)

Query: 8   PEENPTKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPE 67
                   P+ W   +V  ++ +PFNDL+F +  VHR++F+ N +QLS LL+IKTGGC E
Sbjct: 13  AIPVAAPSPQRWRVADVVALFELPFNDLIFRAQQVHREHFDANAVQLSTLLSIKTGGCEE 72

Query: 68  NCGYCNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVD 127
           +CGYC+QS H+ + LKA KL++VD VL  A+ AK NGA+R+CMGAAWR PKER +  + +
Sbjct: 73  DCGYCSQSAHHDTGLKAEKLMDVDAVLDAARAAKANGASRFCMGAAWRNPKERHMPALTE 132

Query: 128 MIKGVKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQ 187
           M++GVK+LGLETCMTLGML  EQA+ L+ AGLDYYNHN+DTS  FY  V +T T++DRL 
Sbjct: 133 MVRGVKALGLETCMTLGMLEDEQAKQLADAGLDYYNHNLDTSPEFYGQVISTRTYQDRLD 192

Query: 188 TLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEEN 247
           TL+ VR +GI VCCGGI+G+GE   +R  ++  LANL+  PES+PIN L+ I G+     
Sbjct: 193 TLDRVRDAGINVCCGGIIGMGESRRERAGLISQLANLNPYPESVPINNLVAIEGTPLAGT 252

Query: 248 KKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKN 307
             +DP E VR I+VARI MPK+ +RL+AGR  + D LQALCF +GANS+F GD LLT  N
Sbjct: 253 APLDPFEFVRTIAVARITMPKAVVRLSAGREQLDDGLQALCFLAGANSMFYGDQLLTTSN 312

Query: 308 PSYNKDTILFNRLGLI 323
           P   KD  LF RLG+ 
Sbjct: 313 PQTQKDRALFERLGIR 328


>gi|153872027|ref|ZP_02001038.1| biotin synthetase [Beggiatoa sp. PS]
 gi|152071507|gb|EDN68962.1| biotin synthetase [Beggiatoa sp. PS]
          Length = 318

 Score =  310 bits (795), Expect = 1e-82,   Method: Composition-based stats.
 Identities = 172/312 (55%), Positives = 222/312 (71%)

Query: 11  NPTKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCG 70
                   W   EV ++ + PFNDL+F +  +HR  F PN +QL  LLNIKTG C E+C 
Sbjct: 3   EKPDLRHDWHHDEVIELLSRPFNDLIFSAQNIHRFYFNPNQVQLCTLLNIKTGACSEDCA 62

Query: 71  YCNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIK 130
           YC+QSV  +++++   L+ +  V+  AK AK NGATR+CMGAAWR PK +D   ++++IK
Sbjct: 63  YCSQSVRFETQVEPQPLMELSTVVNAAKEAKANGATRFCMGAAWRNPKSKDFGNVLEIIK 122

Query: 131 GVKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLE 190
            VK+LGLETCMTLGML+ EQAQ L   GLDYYNHN+DTS  +Y  +T+THT++DRL+TL 
Sbjct: 123 AVKALGLETCMTLGMLNSEQAQQLKAIGLDYYNHNLDTSADYYHKITSTHTYQDRLETLT 182

Query: 191 NVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKV 250
           NVR + +KVC GGI+GLGE + DR  +L TLANL   PES+PIN L+P+ G+   E   V
Sbjct: 183 NVRAANLKVCSGGIIGLGENLADRAALLQTLANLPVHPESVPINQLVPVAGTPLAETPSV 242

Query: 251 DPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSY 310
           DP + VR I+VARILMP S +RL+AGR  MSDELQALCF +GANSIF G+ LLT  N + 
Sbjct: 243 DPFDIVRCIAVARILMPNSHIRLSAGRQDMSDELQALCFLAGANSIFYGEKLLTTGNRAT 302

Query: 311 NKDTILFNRLGL 322
            +D  LFNRLG+
Sbjct: 303 EQDIQLFNRLGI 314


>gi|89889615|ref|ZP_01201126.1| biotin synthase [Flavobacteria bacterium BBFL7]
 gi|89517888|gb|EAS20544.1| biotin synthase [Flavobacteria bacterium BBFL7]
          Length = 362

 Score =  310 bits (795), Expect = 1e-82,   Method: Composition-based stats.
 Identities = 146/311 (46%), Positives = 214/311 (68%), Gaps = 1/311 (0%)

Query: 16  PKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQS 75
              WT +EV +IYN P   LL+ + T+HR++  PN +Q+S LL+IKTGGCPE+CGYC Q+
Sbjct: 2   RHDWTKEEVLEIYNKPLMHLLYEAATIHRESHNPNQVQVSTLLSIKTGGCPEDCGYCPQA 61

Query: 76  VHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKER-DLSIIVDMIKGVKS 134
               + ++ + L++V QV  +A  AK +G++R CMGAAWR  K+  +   +++M++ +  
Sbjct: 62  ARYHTDVEGNDLMSVQQVKAQALRAKSSGSSRVCMGAAWRNVKDGPEFDQVLEMVRTINK 121

Query: 135 LGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRK 194
           L +E C TLGM++  QA  L++AGL  YNHN+D+SE +Y  V +T  ++DRL T++NVRK
Sbjct: 122 LDMEVCCTLGMITENQAHRLAEAGLYAYNHNLDSSEEYYKEVISTRGYQDRLDTIDNVRK 181

Query: 195 SGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIE 254
           + + VC GGI+G+GE  +DR  ML+ LA+LS  PES PIN L+ + G+  EE   V   +
Sbjct: 182 TNVTVCSGGIIGMGESAEDRAGMLVALASLSPQPESTPINALVAVEGTPLEEQVPVSIWD 241

Query: 255 HVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDT 314
            VR+++  RI+MP++++RL+AGR  M+ E QA+CFF+GANSIF GD LLT  NP  N+D 
Sbjct: 242 MVRMVATTRIVMPQTQVRLSAGRTQMTREGQAMCFFAGANSIFAGDKLLTTPNPDVNEDM 301

Query: 315 ILFNRLGLIPD 325
            +F  LGL P 
Sbjct: 302 EMFKLLGLEPM 312


>gi|254506138|ref|ZP_05118282.1| biotin synthase [Vibrio parahaemolyticus 16]
 gi|219550956|gb|EED27937.1| biotin synthase [Vibrio parahaemolyticus 16]
          Length = 352

 Score =  310 bits (795), Expect = 1e-82,   Method: Composition-based stats.
 Identities = 161/311 (51%), Positives = 229/311 (73%)

Query: 13  TKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYC 72
            +    WT  EV ++   PF DLLF +  VHR+  + NH+Q+S LL+IKTG CPE+C YC
Sbjct: 3   VEVRHNWTVAEVRELMEKPFMDLLFEAQLVHRQYQQHNHVQVSTLLSIKTGACPEDCKYC 62

Query: 73  NQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGV 132
            QS   K+ ++  +L+ V++VL  A+ AK  G+TR+CMGAAW+ PKERD+  +  MI+GV
Sbjct: 63  PQSARYKTDVEKERLMEVERVLDAAQKAKSAGSTRFCMGAAWKNPKERDMPHLKKMIEGV 122

Query: 133 KSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENV 192
           K +GLETCMTLGML+ +QA  L+ AGLDYYNHN+DTS  FY ++ TT T++DRL TL +V
Sbjct: 123 KGMGLETCMTLGMLTPDQANELADAGLDYYNHNLDTSPEFYGNIITTRTYQDRLDTLSHV 182

Query: 193 RKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDP 252
           R +G+K+C GGI+G+GE ++DR  + + LANL   PES+PIN+L+ + G+  EE   V+P
Sbjct: 183 RDAGMKICSGGIIGMGESVNDRAGLFVELANLPVHPESVPINMLVKVKGTPLEEVDDVEP 242

Query: 253 IEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNK 312
            + +R+I++ARI+MPKS +RL+AGR  M++++QALCF +GANS+F G  LLT  NPS +K
Sbjct: 243 FDFIRLIAIARIMMPKSAVRLSAGRENMNEQMQALCFMAGANSVFYGCKLLTTPNPSEDK 302

Query: 313 DTILFNRLGLI 323
           D +LF++LG+ 
Sbjct: 303 DMLLFDKLGIN 313


>gi|119945615|ref|YP_943295.1| biotin synthase [Psychromonas ingrahamii 37]
 gi|254810786|sp|A1SW31|BIOB_PSYIN RecName: Full=Biotin synthase
 gi|119864219|gb|ABM03696.1| biotin synthase [Psychromonas ingrahamii 37]
          Length = 351

 Score =  310 bits (795), Expect = 1e-82,   Method: Composition-based stats.
 Identities = 170/316 (53%), Positives = 223/316 (70%)

Query: 10  ENPTKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENC 69
            N T+  + WT  EV Q++ MPF DL+F + T HR NF  N +Q+S LL+IKTG CPE+C
Sbjct: 2   INNTEIRQNWTVAEVDQLFEMPFMDLVFQAQTTHRANFPLNEVQVSTLLSIKTGACPEDC 61

Query: 70  GYCNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMI 129
            YC QS    + L   +LI V +V+K AK AK  G+TR+CMGAAW+ PK+RD+  ++DMI
Sbjct: 62  KYCPQSARYNTGLAKEQLIEVAKVVKAAKEAKATGSTRFCMGAAWKNPKQRDMPYLLDMI 121

Query: 130 KGVKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTL 189
           K V++LGLE+CMTLGML   QA+ LS AGLDYYNHN+DTS  +Y  + TT T++DRL TL
Sbjct: 122 KEVRALGLESCMTLGMLDNNQAEQLSNAGLDYYNHNLDTSPEYYDKIITTRTYQDRLDTL 181

Query: 190 ENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKK 249
           ENVR SG+KVC GGI+GLGE   DR  +L+ LANL   PES+PIN L+ + G+  E    
Sbjct: 182 ENVRNSGMKVCSGGIVGLGEAGSDRSGLLVQLANLPQQPESVPINKLVKVKGTPLENADD 241

Query: 250 VDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPS 309
           +D    ++ I++AR+LMPKS +RL+AGR  M+++ QALCF +GANSIF G  LLT  NP 
Sbjct: 242 LDDFTFIKTIAIARLLMPKSHVRLSAGRDDMNEQTQALCFMAGANSIFYGCKLLTTANPD 301

Query: 310 YNKDTILFNRLGLIPD 325
            N DT LF +LG+  +
Sbjct: 302 ENSDTRLFEKLGINKE 317


>gi|254466291|ref|ZP_05079702.1| biotin synthase [Rhodobacterales bacterium Y4I]
 gi|206687199|gb|EDZ47681.1| biotin synthase [Rhodobacterales bacterium Y4I]
          Length = 325

 Score =  310 bits (795), Expect = 2e-82,   Method: Composition-based stats.
 Identities = 192/313 (61%), Positives = 238/313 (76%)

Query: 11  NPTKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCG 70
           +       WT +E   IYN PF DLLF +HTVHR+ F+PN +Q SKLL+IKTGGC E+C 
Sbjct: 3   DAAPIRTDWTREEAEAIYNKPFMDLLFQAHTVHRQYFDPNQVQKSKLLSIKTGGCAEDCA 62

Query: 71  YCNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIK 130
           YC+QS  N ++L ASKLI V +V+ EAK AKE GATRYCMGAAWR PK+RD++ +  M++
Sbjct: 63  YCSQSARNGAQLSASKLIEVQRVIAEAKKAKEGGATRYCMGAAWRSPKDRDMAALEAMVQ 122

Query: 131 GVKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLE 190
           GVK LG+ETCMTLGML  EQ   L  AGLDYYNHNIDTSER+Y  + TT TF DR+ TL 
Sbjct: 123 GVKDLGMETCMTLGMLDEEQVFRLRDAGLDYYNHNIDTSERYYSEIITTRTFADRIDTLN 182

Query: 191 NVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKV 250
            VR++GIKVC GGI+G+GE   DRIDM+L LA L   P+S+P+N+LIPI  +     +K+
Sbjct: 183 RVREAGIKVCSGGIVGMGEQQLDRIDMMLALATLEVHPDSVPVNMLIPIADTPLANVEKL 242

Query: 251 DPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSY 310
           DPIE VR +++ARILMPKS +RL+AGR  MSDE+QA+CFF+GANSIFVGDTLLTA NP  
Sbjct: 243 DPIEFVRSVALARILMPKSHVRLSAGRTDMSDEMQAMCFFAGANSIFVGDTLLTADNPEE 302

Query: 311 NKDTILFNRLGLI 323
           +KD  LF+RLG+ 
Sbjct: 303 DKDQQLFDRLGIT 315


>gi|332519281|ref|ZP_08395748.1| biotin synthase [Lacinutrix algicola 5H-3-7-4]
 gi|332045129|gb|EGI81322.1| biotin synthase [Lacinutrix algicola 5H-3-7-4]
          Length = 364

 Score =  310 bits (794), Expect = 2e-82,   Method: Composition-based stats.
 Identities = 148/314 (47%), Positives = 221/314 (70%), Gaps = 1/314 (0%)

Query: 13  TKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYC 72
           ++    WT++++ +IYN P  +LL+ + TVHR + +PN +Q+S LL+IKTGGCPE+CGYC
Sbjct: 2   SEIKHNWTTEQILEIYNKPLMELLYEAATVHRLHHDPNTVQVSTLLSIKTGGCPEDCGYC 61

Query: 73  NQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKE-RDLSIIVDMIKG 131
            Q+    + ++ + L++V QV  +A  AK +G++R CMGAAWR  K+  +   +++M++ 
Sbjct: 62  PQAARYHTDIEGNDLMSVQQVKAQALRAKSSGSSRVCMGAAWRNVKDGEEFDQVLEMVRT 121

Query: 132 VKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLEN 191
           +  L +E C TLGM++  QAQ L++AGL  YNHN+D+SE +Y  V +T  FEDRL+T++N
Sbjct: 122 INKLDMEVCCTLGMITENQAQRLAEAGLYAYNHNLDSSEDYYKEVISTRGFEDRLETIDN 181

Query: 192 VRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVD 251
           VRK+ + VC GGI+G+GE I+DR  ML+ LA L+  PES+PIN L+ + G+   E K V 
Sbjct: 182 VRKTNVTVCSGGIIGMGEAIEDRAGMLVALATLNPQPESVPINALVAVEGTPLAEEKPVS 241

Query: 252 PIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYN 311
             + +R+++  RI+MP++++RL+AGR  MS E QA+CFF+GANSIF GD LLT  NP  N
Sbjct: 242 IWDMIRMVATTRIVMPETQVRLSAGRTEMSREGQAMCFFAGANSIFAGDKLLTTPNPDVN 301

Query: 312 KDTILFNRLGLIPD 325
           +D  +F  LGL P 
Sbjct: 302 EDMKMFEMLGLNPQ 315


>gi|325519298|gb|EGC98736.1| biotin synthase [Burkholderia sp. TJI49]
          Length = 339

 Score =  310 bits (794), Expect = 2e-82,   Method: Composition-based stats.
 Identities = 175/322 (54%), Positives = 231/322 (71%), Gaps = 2/322 (0%)

Query: 2   SRSTVVPEENPTKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIK 61
           +++  +P   P   P+ W   +V  ++ +PFNDL+F +  VHR++F+ N +QLS LL+IK
Sbjct: 9   AQTDAIPVAAPA--PQRWRVADVVALFELPFNDLIFRAQQVHREHFDANAVQLSTLLSIK 66

Query: 62  TGGCPENCGYCNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERD 121
           TGGC E+CGYC+QS H+ + LKA KL++VD VL  A+ AK NGA+R+CMGAAWR PKER 
Sbjct: 67  TGGCEEDCGYCSQSSHHDTGLKAEKLMDVDAVLDAARAAKANGASRFCMGAAWRNPKERH 126

Query: 122 LSIIVDMIKGVKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHT 181
           +  + +M++GVK LGLETCMTLGML  EQAQ L+ AGLDYYNHN+DTS  FY  V +T T
Sbjct: 127 MPALTEMVRGVKELGLETCMTLGMLEQEQAQQLASAGLDYYNHNLDTSPEFYGQVISTRT 186

Query: 182 FEDRLQTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPG 241
           ++DRL TL+ VR +GI VCCGGI+G+GE   +R  ++  LANL+  P+S+PIN L+ I G
Sbjct: 187 YQDRLDTLDRVRDAGINVCCGGIIGMGESRRERAGLISQLANLNPYPDSVPINNLVAIEG 246

Query: 242 SKFEENKKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDT 301
           +       +DP E VR I+VARI MPK+ +RL+AGR  + D LQALCF +GANS+F GD 
Sbjct: 247 TPLAGTAPLDPFEFVRTIAVARITMPKAVVRLSAGREQLDDGLQALCFLAGANSMFYGDQ 306

Query: 302 LLTAKNPSYNKDTILFNRLGLI 323
           LLT  NP   KD  LF RLG+ 
Sbjct: 307 LLTTSNPQSQKDRALFERLGIR 328


>gi|134297120|ref|YP_001120855.1| biotin synthase [Burkholderia vietnamiensis G4]
 gi|254810585|sp|A4JIB7|BIOB_BURVG RecName: Full=Biotin synthase
 gi|134140277|gb|ABO56020.1| biotin synthase [Burkholderia vietnamiensis G4]
          Length = 339

 Score =  310 bits (794), Expect = 2e-82,   Method: Composition-based stats.
 Identities = 176/322 (54%), Positives = 232/322 (72%), Gaps = 2/322 (0%)

Query: 4   STVVPEENPT--KKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIK 61
           + V P+  P     P+ W   +V  ++ +PFNDL+F +  VHR++F+ N +QLS LL+IK
Sbjct: 7   AAVQPDAIPVAAPTPQRWRVADVVALFELPFNDLMFRAQQVHREHFDANAVQLSTLLSIK 66

Query: 62  TGGCPENCGYCNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERD 121
           TGGC E+CGYC+QS H+ + LKA KL++VD VL+ A+ AK +GA+R+CMGAAWR PKER 
Sbjct: 67  TGGCEEDCGYCSQSSHHDTGLKAEKLMDVDAVLEAARAAKASGASRFCMGAAWRNPKERH 126

Query: 122 LSIIVDMIKGVKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHT 181
           +  + +M++GVK LGLETCMTLGML  EQAQ L+ AGLDYYNHN+DTS  FY  V +T T
Sbjct: 127 MPALTEMVRGVKELGLETCMTLGMLEDEQAQQLAHAGLDYYNHNLDTSPEFYGQVISTRT 186

Query: 182 FEDRLQTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPG 241
           ++DRL TL+ VR +GI VCCGGI+G+GE   +R  ++  LANL+  P+S+PIN L+ I G
Sbjct: 187 YQDRLDTLDRVRDAGINVCCGGIIGMGESRRERAGLISQLANLNPYPDSVPINNLVAIEG 246

Query: 242 SKFEENKKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDT 301
           +  E    +DP E VR I+VARI MPK+ +RL+AGR  + D LQALCF +GANS+F GD 
Sbjct: 247 TPLEGTAPLDPFEFVRTIAVARITMPKAVVRLSAGREQLDDGLQALCFLAGANSMFYGDQ 306

Query: 302 LLTAKNPSYNKDTILFNRLGLI 323
           LLT  NP   KD  LF RLG+ 
Sbjct: 307 LLTTSNPQSQKDRALFERLGMR 328


>gi|300024698|ref|YP_003757309.1| biotin synthase [Hyphomicrobium denitrificans ATCC 51888]
 gi|299526519|gb|ADJ24988.1| biotin synthase [Hyphomicrobium denitrificans ATCC 51888]
          Length = 356

 Score =  310 bits (793), Expect = 2e-82,   Method: Composition-based stats.
 Identities = 189/313 (60%), Positives = 243/313 (77%)

Query: 12  PTKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGY 71
            +     WT  E   +Y++PF DLLF +  VHR +F+PN +Q+S+LL+IKTGGC E+CGY
Sbjct: 19  ASAPRHDWTRAEAMALYDLPFMDLLFRAQMVHRASFDPNKVQMSRLLSIKTGGCAEDCGY 78

Query: 72  CNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKG 131
           C+QS H+++ LKASKL+ V++V+ EAK AK  GATRYCMGAAWR PK RD+  +V M++G
Sbjct: 79  CSQSAHHETGLKASKLMEVERVINEAKKAKAAGATRYCMGAAWRSPKARDMDTVVAMVEG 138

Query: 132 VKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLEN 191
           VK LG+ETCMTLGML+      L  AGLDYYNHN+DTSE +Y  V TT T+ DRL TL  
Sbjct: 139 VKGLGMETCMTLGMLTDNDIVRLRDAGLDYYNHNVDTSEAYYNKVITTRTYADRLDTLAR 198

Query: 192 VRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVD 251
           VR +G+KVC GGI+G+GE  +DR+DML+TLANL   PES+PIN+LI IPG+  E  +++D
Sbjct: 199 VRDAGMKVCSGGIVGMGEEREDRVDMLVTLANLDEHPESVPINMLIAIPGTPLENAERID 258

Query: 252 PIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYN 311
           PI+ VR I+VARILMPKS +RL+AGR  M+DE+QALCFF+GANSIFVG+TLLTA NP  +
Sbjct: 259 PIDFVRTIAVARILMPKSFVRLSAGRTDMTDEMQALCFFAGANSIFVGETLLTADNPGED 318

Query: 312 KDTILFNRLGLIP 324
           KD++LF +LGL P
Sbjct: 319 KDSLLFAKLGLAP 331


>gi|85373811|ref|YP_457873.1| biotin synthase [Erythrobacter litoralis HTCC2594]
 gi|123293766|sp|Q2NB65|BIOB_ERYLH RecName: Full=Biotin synthase
 gi|84786894|gb|ABC63076.1| biotin synthase [Erythrobacter litoralis HTCC2594]
          Length = 341

 Score =  310 bits (793), Expect = 2e-82,   Method: Composition-based stats.
 Identities = 164/317 (51%), Positives = 221/317 (69%), Gaps = 6/317 (1%)

Query: 13  TKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYC 72
           T     W+  E+  ++  PF +LLF + TVHR    P  +QL  LL+IKTGGCPE+CGYC
Sbjct: 2   TPIRTNWSRDEIAALFEQPFTELLFQAATVHRAYHPPEQVQLCTLLSIKTGGCPEDCGYC 61

Query: 73  NQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGV 132
           +QSV   S ++A+KL++V +VL+ A  AK+ G+ R+CMGAAWR PK+RD+  IV+++KGV
Sbjct: 62  SQSVKADSGVEATKLMDVQRVLQSAAQAKDAGSQRFCMGAAWRNPKDRDMPAIVEIVKGV 121

Query: 133 KSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENV 192
           + +GLETCMTLGML+ +QA +L  AGLDYYNHN+DT   +Y  V +T  ++DRL TL+NV
Sbjct: 122 RDMGLETCMTLGMLTPKQADMLKDAGLDYYNHNVDTGPEYYERVISTRNYQDRLDTLQNV 181

Query: 193 RKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDP 252
           R +GI VC GGI+G+GE  +DR+  + TLA L   PES+P+N L+P+ G+   +     P
Sbjct: 182 RDAGINVCSGGIVGMGETREDRVGFVHTLATLERHPESVPVNALVPVKGTVLGDMLADTP 241

Query: 253 ------IEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAK 306
                 IE VR ++VARI MP S +RL+AGR  MS+  QALCF +GANSIF GD LLTA 
Sbjct: 242 LAKIDDIEFVRTVAVARITMPLSMVRLSAGRESMSEATQALCFMAGANSIFTGDKLLTAA 301

Query: 307 NPSYNKDTILFNRLGLI 323
           N   +KD  LF++LGL 
Sbjct: 302 NAGDDKDAALFDKLGLT 318


>gi|312116145|ref|YP_004013741.1| biotin synthase [Rhodomicrobium vannielii ATCC 17100]
 gi|311221274|gb|ADP72642.1| biotin synthase [Rhodomicrobium vannielii ATCC 17100]
          Length = 339

 Score =  310 bits (793), Expect = 2e-82,   Method: Composition-based stats.
 Identities = 188/315 (59%), Positives = 246/315 (78%)

Query: 11  NPTKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCG 70
             +++   WT +E  ++Y+ PFNDL+F +H++HR+ FEPN +Q+S+LL+IKTGGCPE+C 
Sbjct: 3   RTSEERHDWTREEAQKLYDQPFNDLIFQAHSLHRRYFEPNKVQISRLLSIKTGGCPEDCA 62

Query: 71  YCNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIK 130
           YC+QS H+K+ L A KL+ V++V++EA+ AK  GA+RYCMGAA+R PKERDL +I  M+ 
Sbjct: 63  YCSQSAHHKTGLSAEKLMEVERVIEEARKAKAAGASRYCMGAAFRSPKERDLDMICAMVT 122

Query: 131 GVKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLE 190
           GVK+LG+ETCMTLGMLS   A+ L+  GLDYYNHNIDTSER+Y  + TT TF DRL+TL+
Sbjct: 123 GVKALGMETCMTLGMLSDAHAKRLAAVGLDYYNHNIDTSERYYKEIITTRTFADRLETLD 182

Query: 191 NVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKV 250
            VR +GIK+CCGGILG+GE  +DR DML+TLANL  PPES+PIN L+P+ G+  E    +
Sbjct: 183 RVRAAGIKICCGGILGMGEEPEDRFDMLVTLANLPQPPESVPINQLVPVEGTPLENVPPM 242

Query: 251 DPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSY 310
           DPI  VR +++ARI+MP+S +RL+AGRA MSDE QALCFF+GANSIF+GDTLLT +N   
Sbjct: 243 DPIAFVRTVALARIMMPRSMVRLSAGRAEMSDETQALCFFAGANSIFMGDTLLTTENTEE 302

Query: 311 NKDTILFNRLGLIPD 325
             D  LF RLGL P 
Sbjct: 303 GSDAHLFARLGLSPM 317


>gi|152980099|ref|YP_001351813.1| biotin synthetase [Janthinobacterium sp. Marseille]
 gi|254810721|sp|A6SU66|BIOB_JANMA RecName: Full=Biotin synthase
 gi|151280176|gb|ABR88586.1| biotin synthetase [Janthinobacterium sp. Marseille]
          Length = 339

 Score =  310 bits (793), Expect = 2e-82,   Method: Composition-based stats.
 Identities = 159/326 (48%), Positives = 225/326 (69%), Gaps = 5/326 (1%)

Query: 3   RSTVVPEENPTKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKT 62
           ++ V P       P  W   +V  ++N+PFNDL+F + TVHR+NF+P  ++L+ LL+IKT
Sbjct: 9   QAPVAPII-----PTAWPVDDVLALFNLPFNDLIFRAQTVHRENFDPTEVELATLLSIKT 63

Query: 63  GGCPENCGYCNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDL 122
           GGCPE+CGYC Q+    + + A K++ +++VL  A+ AK +GATR+CMGAAWREPK+RDL
Sbjct: 64  GGCPEDCGYCPQAARYDTGVTAQKILPLEEVLTAAREAKAHGATRFCMGAAWREPKDRDL 123

Query: 123 SIIVDMIKGVKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTF 182
             + +M++ VK++GLETC TLGML   QA+ L  AGLDYYNHN+DT+  FY +V +T  +
Sbjct: 124 EKVEEMVREVKAMGLETCATLGMLGEGQAEKLKNAGLDYYNHNLDTAPEFYSNVISTRDY 183

Query: 183 EDRLQTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGS 242
           ++R+ TL  VR +GIKVCCGGI+G+GE    R  ++  L N+   PES+P+N L+ + G+
Sbjct: 184 QNRIDTLGRVRGAGIKVCCGGIVGMGESRLQRAGLIAQLCNMDPYPESVPVNNLVQVEGT 243

Query: 243 KFEENKKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTL 302
                  +DP+E VR ++VARI MPK+R+RL+AGR  M + +QALCF +GANSIF GD L
Sbjct: 244 PLHGTDPIDPLEFVRTVAVARITMPKARVRLSAGRREMGEAIQALCFVAGANSIFYGDKL 303

Query: 303 LTAKNPSYNKDTILFNRLGLIPDLSA 328
           LT  NP    D  L  +LG+    +A
Sbjct: 304 LTTGNPEAMADQELLEKLGMHTRSTA 329


>gi|320102673|ref|YP_004178264.1| biotin synthase [Isosphaera pallida ATCC 43644]
 gi|319749955|gb|ADV61715.1| biotin synthase [Isosphaera pallida ATCC 43644]
          Length = 347

 Score =  309 bits (792), Expect = 3e-82,   Method: Composition-based stats.
 Identities = 163/329 (49%), Positives = 230/329 (69%), Gaps = 1/329 (0%)

Query: 1   MSRSTVVPEENPTKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNI 60
           ++R +V          + W+   V  +Y+ P  +L+  +  VHR++ +P+ +Q+  LL+I
Sbjct: 3   LARPSVSSPSPTGVSAERWSRDAVRALYHTPLLELVVRASEVHRRHHDPSKVQVCVLLSI 62

Query: 61  KTGGCPENCGYCNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKER 120
           KTGGCPE+C YC Q+    + +KA  L+ V++VL+ A+ A+E GATR+CMGAAWRE ++ 
Sbjct: 63  KTGGCPEDCAYCPQAARYHTNVKAQPLLAVEEVLESARRARERGATRFCMGAAWREVRDN 122

Query: 121 -DLSIIVDMIKGVKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTT 179
                +++MI+GVK+LGLE C TLGM + +QA+ + +AGLD YNHN+D+SE FY  + +T
Sbjct: 123 AHFDRVLEMIRGVKALGLEVCCTLGMATADQARKMKEAGLDAYNHNLDSSEDFYGDIIST 182

Query: 180 HTFEDRLQTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPI 239
            T++DRL+TL +VR++GI VC GGILGLGE  +DRI +L TLANL TPPES+PIN L+P+
Sbjct: 183 RTYQDRLETLRHVREAGITVCSGGILGLGESHEDRISLLWTLANLPTPPESVPINALVPV 242

Query: 240 PGSKFEENKKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVG 299
           PG+      +V   + VR I+ ARILMP S +RL+AGR  MS+  QALCF +GANSIF G
Sbjct: 243 PGTPLGHRPRVPIFDMVRAIATARILMPTSMVRLSAGRVSMSESDQALCFLAGANSIFAG 302

Query: 300 DTLLTAKNPSYNKDTILFNRLGLIPDLSA 328
           +TLLT  NP ++ DT LF  LGL P  S+
Sbjct: 303 ETLLTTPNPDFDADTRLFEALGLEPLPSS 331


>gi|254476932|ref|ZP_05090318.1| biotin synthase [Ruegeria sp. R11]
 gi|214031175|gb|EEB72010.1| biotin synthase [Ruegeria sp. R11]
          Length = 325

 Score =  309 bits (792), Expect = 3e-82,   Method: Composition-based stats.
 Identities = 192/313 (61%), Positives = 242/313 (77%)

Query: 11  NPTKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCG 70
           + T     WT +E  +IYN PF DLLF + +VHR++F+PN +Q SKLL+IKTGGC E+C 
Sbjct: 3   DATPIRTDWTREEAEKIYNQPFMDLLFEAQSVHRQHFDPNQVQKSKLLSIKTGGCAEDCA 62

Query: 71  YCNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIK 130
           YC+QS  N +KL ASKLI V++V+ EA+ AKE GATRYCMGAAWR PK+RD++ +  MI 
Sbjct: 63  YCSQSARNGAKLSASKLIEVERVIAEARKAKEGGATRYCMGAAWRSPKDRDMAALEAMIH 122

Query: 131 GVKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLE 190
           GVK LG+ETCMTLGML  +Q   L  AGLDYYNHNIDTSER+Y  + TT TF DR++TL 
Sbjct: 123 GVKELGMETCMTLGMLEDDQVFRLRDAGLDYYNHNIDTSERYYSEIITTRTFADRIETLN 182

Query: 191 NVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKV 250
            VR++GIKVC GGI+G+GE   DRIDMLL LA L   P+S+P+N+LIPI  +   +  K+
Sbjct: 183 RVREAGIKVCAGGIVGMGEQQMDRIDMLLALATLEEHPDSVPVNMLIPIADTPLADVAKL 242

Query: 251 DPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSY 310
           DPIE VR +++ARILMPKS +RL+AGR  MSDE+QA+CFF+GANSIFVGDTLLTA NP  
Sbjct: 243 DPIEFVRTVALARILMPKSHVRLSAGRTDMSDEMQAMCFFAGANSIFVGDTLLTADNPEE 302

Query: 311 NKDTILFNRLGLI 323
           +KD+ LF+RLG+ 
Sbjct: 303 DKDSQLFDRLGIT 315


>gi|144898554|emb|CAM75418.1| Biotin synthase and related enzymes [Magnetospirillum
           gryphiswaldense MSR-1]
          Length = 324

 Score =  309 bits (792), Expect = 3e-82,   Method: Composition-based stats.
 Identities = 173/321 (53%), Positives = 224/321 (69%), Gaps = 2/321 (0%)

Query: 4   STVVPEENPTKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTG 63
           + + P  +       W ++EV   + MPF DL+F +  VHR NF+ N IQ+S+L++IKTG
Sbjct: 5   AQIKPLGDGL--RHDWQAEEVQAFFAMPFMDLMFQAQQVHRANFDANKIQVSRLISIKTG 62

Query: 64  GCPENCGYCNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLS 123
            CPE+C YC QS H  + L+  KL+ V++V+  A+ AKE GA+R+CMGAAWR PK  D  
Sbjct: 63  SCPEDCTYCPQSAHYATGLEKEKLMAVEEVVAAARQAKEEGASRFCMGAAWRGPKGDDFE 122

Query: 124 IIVDMIKGVKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFE 183
           + V MI+GVK+LG++TC T G+L   QAQ L  AGLDYYNHNIDTS   Y  V TT TF+
Sbjct: 123 VAVAMIEGVKALGMQTCATFGLLDKWQAQRLKDAGLDYYNHNIDTSPEHYKEVITTRTFQ 182

Query: 184 DRLQTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSK 243
           DRL TL+ VR+ G+ VC GGI+GLGE  +DR  MLLTLAN+   P+S+PINLLI IPG+ 
Sbjct: 183 DRLDTLDTVREVGLHVCSGGIVGLGETNNDRAKMLLTLANMEKHPDSVPINLLIAIPGTP 242

Query: 244 FEENKKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLL 303
            E  +K D  + +R I+ ARI+MP+S +RL+AGR  MS+E+QALCF +GANSIF G  LL
Sbjct: 243 LENAEKPDNFDFIRTIAAARIMMPQSYVRLSAGREGMSEEMQALCFMAGANSIFCGHKLL 302

Query: 304 TAKNPSYNKDTILFNRLGLIP 324
           TAKN +   D  LF RLGL P
Sbjct: 303 TAKNAAPGSDKSLFGRLGLSP 323


>gi|13475019|ref|NP_106577.1| biotin synthase [Mesorhizobium loti MAFF303099]
 gi|14025764|dbj|BAB52363.1| biotin synthase [Mesorhizobium loti MAFF303099]
          Length = 422

 Score =  309 bits (792), Expect = 3e-82,   Method: Composition-based stats.
 Identities = 201/319 (63%), Positives = 256/319 (80%)

Query: 7   VPEENPTKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCP 66
           +PE +     ++WT ++   +++ PFN+LLF + TVHR+NF+PN +QLS+LL+IKTGGCP
Sbjct: 1   MPEGHTFDGHQMWTLEKARALHDAPFNNLLFLAQTVHRENFDPNKVQLSRLLSIKTGGCP 60

Query: 67  ENCGYCNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIV 126
           E+CGYC+QS H++S LKASKL+ V +V+ EA  A++ GATRYCMGAAWR PK RD+  +V
Sbjct: 61  EDCGYCSQSAHHESGLKASKLMEVRRVIAEATKARDAGATRYCMGAAWRNPKARDMDAVV 120

Query: 127 DMIKGVKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRL 186
            M++GVK+LG+ETCMTLGML  EQA  L +AGLDYYNHNIDTSER+Y  + +T TF DRL
Sbjct: 121 AMVEGVKALGMETCMTLGMLDLEQAARLKQAGLDYYNHNIDTSERYYSEIISTRTFADRL 180

Query: 187 QTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEE 246
            TL NVR SGIKVCCGGI+G+GE   DRIDML+TLANL   PES+PIN+LIPI G+   E
Sbjct: 181 DTLANVRDSGIKVCCGGIVGMGEEPVDRIDMLVTLANLPEHPESVPINMLIPIEGTPLAE 240

Query: 247 NKKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAK 306
            K ++PIE VR+I++ARI+MPKS +RL+AGR  M+DE+QALCFF+GANSIFVGDTLLTA 
Sbjct: 241 AKPIEPIEFVRVIALARIMMPKSHVRLSAGRTAMTDEMQALCFFAGANSIFVGDTLLTAD 300

Query: 307 NPSYNKDTILFNRLGLIPD 325
           NP  +KD +LF RLG+ P 
Sbjct: 301 NPGEDKDILLFRRLGMEPM 319


>gi|149184263|ref|ZP_01862581.1| biotin synthase [Erythrobacter sp. SD-21]
 gi|148831583|gb|EDL50016.1| biotin synthase [Erythrobacter sp. SD-21]
          Length = 341

 Score =  309 bits (792), Expect = 3e-82,   Method: Composition-based stats.
 Identities = 165/323 (51%), Positives = 226/323 (69%), Gaps = 6/323 (1%)

Query: 7   VPEENPTKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCP 66
           + ++  T     WT +E+  ++N+PF +LLF + TVHR+   P  IQL  LL+IKTGGCP
Sbjct: 1   MSQKEATALRTDWTREEIADLFNLPFTELLFRAATVHREYHPPEQIQLCTLLSIKTGGCP 60

Query: 67  ENCGYCNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIV 126
           E+CGYC+QSV   S ++A+KL+ V  VL+ A  AK+ G+ R+CMGAAWR PK+RD+  IV
Sbjct: 61  EDCGYCSQSVKADSGVEATKLMEVQSVLQRAAQAKDQGSQRFCMGAAWRNPKDRDMPAIV 120

Query: 127 DMIKGVKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRL 186
           +++KGV+++GLETCMTLGML+ +QA +L +AGLDYYNHN+DT   +Y  V +T  ++DRL
Sbjct: 121 EIVKGVRAMGLETCMTLGMLTPKQADMLKEAGLDYYNHNVDTGPEYYERVISTRNYQDRL 180

Query: 187 QTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEE 246
            TL+NVR +GI VC GGI+G+GE  +DR+  + TLA L   PES+P+N L+P+ G+   +
Sbjct: 181 DTLQNVRDAGINVCSGGIVGMGETREDRVGFVHTLATLERHPESVPVNALVPVKGTVLGD 240

Query: 247 NKKVDP------IEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGD 300
                P      IE VR ++VAR+ MP S +RL+AGR  MS+  QALCF +GANSIF GD
Sbjct: 241 MLADTPLAKIDDIEFVRTVAVARMTMPMSMVRLSAGRESMSEATQALCFMAGANSIFTGD 300

Query: 301 TLLTAKNPSYNKDTILFNRLGLI 323
            LLTA N   + D  LF +LGL 
Sbjct: 301 KLLTAPNAGDDSDAALFAKLGLT 323


>gi|84394181|ref|ZP_00992912.1| biotin synthase [Vibrio splendidus 12B01]
 gi|84375201|gb|EAP92117.1| biotin synthase [Vibrio splendidus 12B01]
          Length = 350

 Score =  309 bits (791), Expect = 4e-82,   Method: Composition-based stats.
 Identities = 159/313 (50%), Positives = 220/313 (70%)

Query: 16  PKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQS 75
              WT  EV  +   PF DL+F +  VHR+  E NH+Q+S LL+IKTG CPE+C YC QS
Sbjct: 4   RHDWTVAEVTALLEKPFMDLMFEAQVVHRRYQEHNHVQVSTLLSIKTGACPEDCKYCPQS 63

Query: 76  VHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSL 135
            H ++ +   +L+ V++VL  A  AK  G+TR+CMGAAW+ PKERD+  + DMIKGVK +
Sbjct: 64  AHYRTDVDKERLMEVERVLDAALKAKNAGSTRFCMGAAWKNPKERDMPHLTDMIKGVKGM 123

Query: 136 GLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKS 195
           GLETCMTLGML+ +QA  L+ AGLDYYNHN+DTS  FY  + TT T++DRL TL +VR +
Sbjct: 124 GLETCMTLGMLTPDQAGELADAGLDYYNHNLDTSPEFYGSIITTRTYQDRLDTLSHVRDA 183

Query: 196 GIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEH 255
           G+K+C GGI+G+GE  +DR  +L+ LANL   PES+PIN+L+ + G+  E    V+  + 
Sbjct: 184 GMKICSGGIIGMGESTNDRAGLLVELANLPVHPESVPINMLVKVKGTPMENVDDVESFDF 243

Query: 256 VRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTI 315
           +++I++ARI+MP S +RL+AGR  M++++QA+CF +GANSIF G  LLT  NP  + D  
Sbjct: 244 IKLIAIARIMMPMSAVRLSAGRENMNEQMQAMCFMAGANSIFYGCKLLTTPNPDEDTDMQ 303

Query: 316 LFNRLGLIPDLSA 328
           LF +LG+     A
Sbjct: 304 LFKKLGINSQQVA 316


>gi|262369651|ref|ZP_06062979.1| biotin synthase [Acinetobacter johnsonii SH046]
 gi|262315719|gb|EEY96758.1| biotin synthase [Acinetobacter johnsonii SH046]
          Length = 330

 Score =  309 bits (791), Expect = 4e-82,   Method: Composition-based stats.
 Identities = 170/312 (54%), Positives = 227/312 (72%)

Query: 16  PKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQS 75
              WT  E+  +Y  PF DLLF +  +HR+ FE N IQ+S LL+IKTG CPE+C YC+QS
Sbjct: 4   RNDWTRAEIQALYQQPFLDLLFQAQQIHRQYFEANAIQVSTLLSIKTGKCPEDCKYCSQS 63

Query: 76  VHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSL 135
               SKL+A K I V++V+ EA+ AK +G+TR+CMGAAWR P ERD+  ++DM++ VK+L
Sbjct: 64  ARYDSKLEAEKRIAVEKVISEAQQAKASGSTRFCMGAAWRNPYERDMPYVLDMVREVKAL 123

Query: 136 GLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKS 195
           GLETCMTLGML+  QA+ L  AGLDYYNHN+DTS  +YP+V +T +F+DRL TL +VR++
Sbjct: 124 GLETCMTLGMLNASQAERLKGAGLDYYNHNLDTSREYYPNVISTRSFDDRLDTLSHVREA 183

Query: 196 GIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEH 255
           G+KVC GGI+GLGE   DRI +L  LA L   PES+PIN+L+P+ G+   E +K+D  E 
Sbjct: 184 GLKVCSGGIVGLGEETKDRIGLLFELATLPIHPESVPINMLVPMQGTPLAEVEKLDVTEW 243

Query: 256 VRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTI 315
           +R I+VARI+MPKS +RL+AGR  +SD  QAL F +GANS+F G+ LLT  N +  KD  
Sbjct: 244 IRTIAVARIIMPKSYIRLSAGRESLSDADQALAFMAGANSLFSGEKLLTTPNTAQGKDQQ 303

Query: 316 LFNRLGLIPDLS 327
           LF +LGL  + +
Sbjct: 304 LFQKLGLHAEKA 315


>gi|115353034|ref|YP_774873.1| biotin synthase [Burkholderia ambifaria AMMD]
 gi|170698539|ref|ZP_02889609.1| biotin synthase [Burkholderia ambifaria IOP40-10]
 gi|122322091|sp|Q0BBD4|BIOB_BURCM RecName: Full=Biotin synthase
 gi|115283022|gb|ABI88539.1| biotin synthase [Burkholderia ambifaria AMMD]
 gi|170136544|gb|EDT04802.1| biotin synthase [Burkholderia ambifaria IOP40-10]
          Length = 339

 Score =  309 bits (791), Expect = 4e-82,   Method: Composition-based stats.
 Identities = 177/322 (54%), Positives = 232/322 (72%), Gaps = 2/322 (0%)

Query: 4   STVVPEENPTKKP--KVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIK 61
           +TV P+  P   P  + W   +V  ++ +PFNDL+F +  VHR++F+ N +QLS LL+IK
Sbjct: 7   ATVQPDAIPVAAPASQRWRVADVVALFELPFNDLIFRAQQVHREHFDANAVQLSTLLSIK 66

Query: 62  TGGCPENCGYCNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERD 121
           TGGC E+CGYC+QS H+ + LKA KL++VD VL  A+ AK NGA+R+CMGAAWR PKER 
Sbjct: 67  TGGCEEDCGYCSQSSHHDTGLKAEKLMDVDAVLDAARAAKANGASRFCMGAAWRNPKERH 126

Query: 122 LSIIVDMIKGVKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHT 181
           +  + +M++GVK LGLETCMTLGML  EQAQ L+ AGLDYYNHN+DTS  FY  V +T T
Sbjct: 127 MPALTEMVRGVKELGLETCMTLGMLEDEQAQELANAGLDYYNHNLDTSPEFYGQVISTRT 186

Query: 182 FEDRLQTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPG 241
           ++DRL TL+ VR +GI VCCGGI+G+GE   +R  ++  LANL+  P+S+PIN L+ I G
Sbjct: 187 YQDRLDTLDRVRDAGINVCCGGIIGMGESRRERAGLISQLANLNPYPDSVPINNLVAIEG 246

Query: 242 SKFEENKKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDT 301
           +  E    +DP E VR I+VARI MPK+ +RL+AGR  + D LQA+CF +GANS+F GD 
Sbjct: 247 TPLEGTAPLDPFEFVRTIAVARITMPKAVVRLSAGREQLDDGLQAMCFLAGANSMFYGDQ 306

Query: 302 LLTAKNPSYNKDTILFNRLGLI 323
           LLT  NP   KD  LF RLG+ 
Sbjct: 307 LLTTSNPQSQKDRALFERLGIR 328


>gi|326334913|ref|ZP_08201114.1| biotin synthase [Capnocytophaga sp. oral taxon 338 str. F0234]
 gi|325692950|gb|EGD34888.1| biotin synthase [Capnocytophaga sp. oral taxon 338 str. F0234]
          Length = 355

 Score =  309 bits (790), Expect = 5e-82,   Method: Composition-based stats.
 Identities = 153/311 (49%), Positives = 218/311 (70%), Gaps = 1/311 (0%)

Query: 14  KKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCN 73
           +    WTS+E+  IYN P  DLL+ + TVHR+  +PN +Q+S LL++KTGGC E+C YC+
Sbjct: 3   EIRHNWTSEEIMAIYNKPLMDLLYQAATVHRQYHDPNSVQVSTLLSVKTGGCSEDCCYCS 62

Query: 74  QSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKER-DLSIIVDMIKGV 132
           QS    + ++   ++++ QV  +A  AK +G++R CMGAAWR  K+  +   +++M++ +
Sbjct: 63  QSSRYHTDVEIEPMMSISQVKAQALRAKASGSSRVCMGAAWRNVKDGPEFDQVLEMVRTI 122

Query: 133 KSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENV 192
             L +E C TLGML+  QA+ LS+AGL  YNHN+DTSE +Y  + TT ++EDRL+T++NV
Sbjct: 123 NKLDMEVCCTLGMLTENQAKRLSEAGLYAYNHNLDTSEDYYKEIVTTRSYEDRLKTIDNV 182

Query: 193 RKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDP 252
           RK+ I +C GGI+G+GE ++DR  ML+TL++L   PES+PIN LIPI G+  EE   VD 
Sbjct: 183 RKTNITICSGGIIGMGESLEDRAKMLVTLSSLDPQPESVPINALIPIAGTPLEELPPVDI 242

Query: 253 IEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNK 312
            E VR+I+ ARI+MP S++RL+AGR  MS E QALCFF+GANSIF GD LLT  NP   +
Sbjct: 243 WEMVRMIATARIVMPHSQVRLSAGRTHMSREGQALCFFAGANSIFAGDKLLTTPNPDIKE 302

Query: 313 DTILFNRLGLI 323
           D  +   LG+ 
Sbjct: 303 DMHMLEALGMR 313


>gi|94676895|ref|YP_588696.1| biotin synthase [Baumannia cicadellinicola str. Hc (Homalodisca
           coagulata)]
 gi|123384139|sp|Q1LTL8|BIOB_BAUCH RecName: Full=Biotin synthase
 gi|94220045|gb|ABF14204.1| biotin synthase [Baumannia cicadellinicola str. Hc (Homalodisca
           coagulata)]
          Length = 342

 Score =  309 bits (790), Expect = 5e-82,   Method: Composition-based stats.
 Identities = 157/309 (50%), Positives = 224/309 (72%)

Query: 17  KVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQSV 76
           + W  ++   ++N PF DLLF +  VHRK F    +Q+S LL+IKTG C E+C YC QS 
Sbjct: 5   QRWNREQAISLFNKPFFDLLFQAQQVHRKYFRLGQVQISTLLSIKTGNCAEDCKYCPQSS 64

Query: 77  HNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLG 136
           H ++KL    L+ + QVL  AK A + G+TR+C+GAAW++  +RD+ ++  ++ GVK++G
Sbjct: 65  HYETKLDNEPLVQLPQVLAAAKKASDAGSTRFCIGAAWKKIHDRDMPLLEQIVTGVKAIG 124

Query: 137 LETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSG 196
           LETCMTLG+L  +QAQ L+KAGLD+YNHN+DTS  FY  + TT +++DRL T+ENVRK+G
Sbjct: 125 LETCMTLGILKPQQAQRLAKAGLDFYNHNLDTSPEFYHSIVTTRSYQDRLNTIENVRKAG 184

Query: 197 IKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEHV 256
           IK+C GGI+GLGE I DR  +L+ LANL  PP S+PIN+L+ + G+   +NK VDP + +
Sbjct: 185 IKICSGGIIGLGETISDRAGLLVELANLPEPPSSVPINMLVKVRGTPMFDNKDVDPFDLI 244

Query: 257 RIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTIL 316
           R+I+V RI+MP S +RL+AGR  M+++ QA+CF +GANSIF G  LLT+ NP+ + D  L
Sbjct: 245 RMIAVTRIMMPTSYVRLSAGREQMNEQTQAICFMAGANSIFYGRKLLTSSNPTEDSDKRL 304

Query: 317 FNRLGLIPD 325
           F +LG+  +
Sbjct: 305 FRKLGMQIE 313


>gi|206559062|ref|YP_002229822.1| biotin synthase [Burkholderia cenocepacia J2315]
 gi|254810581|sp|B4E9L4|BIOB_BURCJ RecName: Full=Biotin synthase
 gi|198035099|emb|CAR50973.1| biotin synthase [Burkholderia cenocepacia J2315]
          Length = 339

 Score =  309 bits (790), Expect = 5e-82,   Method: Composition-based stats.
 Identities = 173/328 (52%), Positives = 233/328 (71%), Gaps = 5/328 (1%)

Query: 1   MSRSTVVPEEN-----PTKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLS 55
           M+++  V  ++         P+ W   +V  ++ +PFNDL+F +  VHR++F+ N +QLS
Sbjct: 1   MTQAQTVAVQSDAIPMAAPAPQRWRVADVVALFELPFNDLMFRAQQVHREHFDANAVQLS 60

Query: 56  KLLNIKTGGCPENCGYCNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWR 115
            LL+IKTGGC E+CGYC+QS H+ + LKA KL++VD VL  A+ AK NGA+R+CMGAAWR
Sbjct: 61  TLLSIKTGGCEEDCGYCSQSSHHDTGLKAEKLMDVDTVLDAARAAKANGASRFCMGAAWR 120

Query: 116 EPKERDLSIIVDMIKGVKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPH 175
            PKER +  + +M++GVK LGLETCMTLGML  EQA+ L+ AGLDYYNHN+DTS  FY  
Sbjct: 121 NPKERHMPALTEMVRGVKELGLETCMTLGMLEDEQARQLADAGLDYYNHNLDTSPEFYGQ 180

Query: 176 VTTTHTFEDRLQTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINL 235
           V +T T++DRL TL+ VR +GI VCCGGI+G+GE   +R  ++  LANL+  PES+PIN 
Sbjct: 181 VISTRTYQDRLDTLDRVRDAGINVCCGGIIGMGESRRERAGLISQLANLNPYPESVPINN 240

Query: 236 LIPIPGSKFEENKKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANS 295
           L+ I G+  E    +DP E VR I+VARI MPK+ +RL+AGR  + D +QA+CF +GANS
Sbjct: 241 LVAIEGTPLEGTAPLDPFEFVRTIAVARITMPKAVVRLSAGREQLDDAMQAMCFLAGANS 300

Query: 296 IFVGDTLLTAKNPSYNKDTILFNRLGLI 323
           +F GD LLT  NP   +D  LF RLG+ 
Sbjct: 301 MFYGDQLLTTSNPQTQRDRALFERLGIR 328


>gi|319952654|ref|YP_004163921.1| biotin synthase [Cellulophaga algicola DSM 14237]
 gi|319421314|gb|ADV48423.1| Biotin synthase [Cellulophaga algicola DSM 14237]
          Length = 363

 Score =  309 bits (790), Expect = 5e-82,   Method: Composition-based stats.
 Identities = 147/314 (46%), Positives = 218/314 (69%), Gaps = 1/314 (0%)

Query: 13  TKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYC 72
           ++K   WT +E+ +IYN P  +LL+ + T+HR+N +PN +Q+S LL+IKTGGCPE+CGYC
Sbjct: 2   SEKRYNWTKEEILEIYNKPMMELLYDAATIHRENHDPNTVQVSTLLSIKTGGCPEDCGYC 61

Query: 73  NQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKER-DLSIIVDMIKG 131
            Q+    + L+ + L+ V  V  +A  AK +G++R CMGAAWR  K+  +   +++M++ 
Sbjct: 62  PQAARYHTGLEGNDLMTVPHVKAQALRAKASGSSRVCMGAAWRNVKDGPEFDQVLEMVRT 121

Query: 132 VKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLEN 191
           +  L +E C TLGM++  QA+ L++AGL  YNHN+DTSE +Y  V +T  FEDRL T+ N
Sbjct: 122 INKLDMEVCCTLGMITENQAKRLAEAGLYAYNHNLDTSEDYYKDVISTRAFEDRLDTISN 181

Query: 192 VRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVD 251
           VRK+ + VC GGI+G+GE ++DR  ML+ LA+L+  PES PIN L+ + G+  E+ + + 
Sbjct: 182 VRKTNVTVCSGGIIGMGEKLEDRAGMLVALASLNPQPESTPINALVAVEGTPMEDIEPIA 241

Query: 252 PIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYN 311
             + +R+++  RI+MP++++RL+AGR  MS E QA+CFF+GANSIF GD LLT  NP  N
Sbjct: 242 IWDMLRMVATTRIVMPETQVRLSAGRTEMSREGQAMCFFAGANSIFAGDKLLTTPNPDVN 301

Query: 312 KDTILFNRLGLIPD 325
            D  +F  LGL P 
Sbjct: 302 DDMEMFKLLGLNPQ 315


>gi|209809623|ref|YP_002265162.1| biotin synthase [Aliivibrio salmonicida LFI1238]
 gi|254810544|sp|B6ESC7|BIOB_ALISL RecName: Full=Biotin synthase
 gi|208011186|emb|CAQ81614.1| biotin synthase [Aliivibrio salmonicida LFI1238]
          Length = 350

 Score =  309 bits (790), Expect = 5e-82,   Method: Composition-based stats.
 Identities = 159/306 (51%), Positives = 226/306 (73%)

Query: 16  PKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQS 75
              WT  EV  + + PF DL+F +  VHR+  E N++Q+S LL+IKTG CPE+C YC QS
Sbjct: 4   RHNWTVVEVKALMDKPFMDLVFEAQLVHRQYQEANYVQVSTLLSIKTGACPEDCKYCPQS 63

Query: 76  VHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSL 135
            H ++ +   +L+ V+ VL  AK AK++G+TR+CMGAAW+ PKERD+  ++DMIKGVK +
Sbjct: 64  AHYRTDVDRERLMEVESVLDAAKKAKDSGSTRFCMGAAWKNPKERDMPYLLDMIKGVKDI 123

Query: 136 GLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKS 195
           GLETCMTLGM++ +QA  LS AGLDYYNHN+DTS  FY ++ TT T++DRL TL +VR +
Sbjct: 124 GLETCMTLGMITSDQAGELSGAGLDYYNHNLDTSPEFYGNIITTRTYQDRLDTLSHVRDA 183

Query: 196 GIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEH 255
           G+K+C GGI+G+GE ++DR  + + LANL   PES+P+N+L+ + G+  E+ + VDP + 
Sbjct: 184 GMKICSGGIIGMGESVNDRAGLFVELANLPQHPESVPVNMLVKVKGTPLEDAEDVDPFDF 243

Query: 256 VRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTI 315
           +R+I+VARI+MP+S +RL+AGR  M++++QALCF +G NS+F G  LLT  NP  + D  
Sbjct: 244 IRLIAVARIMMPESAVRLSAGRESMNEQMQALCFMAGTNSVFYGCKLLTTPNPDEDSDMQ 303

Query: 316 LFNRLG 321
           LF +LG
Sbjct: 304 LFKKLG 309


>gi|118602510|ref|YP_903725.1| biotin synthase [Candidatus Ruthia magnifica str. Cm (Calyptogena
           magnifica)]
 gi|254810793|sp|A1AWE7|BIOB_RUTMC RecName: Full=Biotin synthase
 gi|118567449|gb|ABL02254.1| biotin synthase [Candidatus Ruthia magnifica str. Cm (Calyptogena
           magnifica)]
          Length = 322

 Score =  308 bits (789), Expect = 6e-82,   Method: Composition-based stats.
 Identities = 176/308 (57%), Positives = 231/308 (75%)

Query: 16  PKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQS 75
              WT KEV  ++++PFNDLLF +H +HR+NF+PN IQ+S LLNIKTG CPE+C YC+QS
Sbjct: 5   RNDWTLKEVEILFSLPFNDLLFQAHRIHRQNFDPNQIQVSSLLNIKTGACPEDCSYCSQS 64

Query: 76  VHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSL 135
               + L+  KL+ +D VL++AK A++ GATR+CMGAAWR P ++ L+ ++ MI+GVK++
Sbjct: 65  SKYDTGLEREKLMEIDLVLQQAKEAQDIGATRFCMGAAWRNPTDKSLAKVILMIQGVKTM 124

Query: 136 GLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKS 195
           G+ETC+TLGML+ EQA IL +AGLDYYNHNIDTS+  Y +V TT  F+DRL TLE+V+ +
Sbjct: 125 GMETCVTLGMLTQEQAFILKEAGLDYYNHNIDTSKEHYSNVVTTRNFQDRLNTLESVQNA 184

Query: 196 GIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEH 255
            I VC GGILGL E   DR  ML +L+NL T P+S+P NLL+PIPG+ FE  +     E 
Sbjct: 185 NIHVCSGGILGLDESQTDRASMLRSLSNLRTHPDSVPFNLLVPIPGTPFENIEPPTESEF 244

Query: 256 VRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTI 315
           VR I+VARI+MPKS +RL+AGR  M + +QALCFF+GANSIF G+ LLT  NP+ N D  
Sbjct: 245 VRTIAVARIMMPKSVVRLSAGRTKMGEAMQALCFFAGANSIFYGEQLLTTDNPNINSDKD 304

Query: 316 LFNRLGLI 323
           LF RLG+ 
Sbjct: 305 LFARLGIN 312


>gi|114568612|ref|YP_755292.1| biotin synthase [Maricaulis maris MCS10]
 gi|122317043|sp|Q0ATN3|BIOB_MARMM RecName: Full=Biotin synthase
 gi|114339074|gb|ABI64354.1| biotin synthase [Maricaulis maris MCS10]
          Length = 334

 Score =  308 bits (789), Expect = 7e-82,   Method: Composition-based stats.
 Identities = 173/313 (55%), Positives = 223/313 (71%)

Query: 13  TKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYC 72
           ++    WT +   +IY  PFNDL+F + +VHR+    N +Q S+LL+IKTGGC E+CGYC
Sbjct: 11  SQVRTDWTRETAGEIYRAPFNDLIFAAQSVHRQCHPANQVQTSQLLSIKTGGCAEDCGYC 70

Query: 73  NQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGV 132
           NQS H  + LKASKL+ +D VL  AK AK+ GATR+CMGAAWRE K RD  +I DMI GV
Sbjct: 71  NQSAHFDTGLKASKLMPLDDVLDAAKKAKDGGATRFCMGAAWRELKTRDEDVICDMISGV 130

Query: 133 KSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENV 192
           KS+G+ETC+TLGML+  QA  L +AGLDYYNHN+DT+   Y  V +T T++DR+ TL  V
Sbjct: 131 KSMGMETCVTLGMLTDSQANKLREAGLDYYNHNLDTAPEDYGRVISTRTYQDRIDTLSRV 190

Query: 193 RKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDP 252
           R +GI VC GGI+G+GE    RI +L  LA++   PES+PIN L+ +P +   ++K +D 
Sbjct: 191 RGAGIHVCTGGIVGMGEDEAARIGLLTELASMDPHPESVPINHLVAVPNTPLGDSKPLDG 250

Query: 253 IEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNK 312
           IE VR I+ ARILMP+S +RL+AGR  MS ELQALCF +GANSIFVG+ LLT  NP  N+
Sbjct: 251 IEFVRTIATARILMPRSMVRLSAGREGMSRELQALCFLAGANSIFVGEELLTTPNPEQNE 310

Query: 313 DTILFNRLGLIPD 325
           D  LF  LG+ P 
Sbjct: 311 DFDLFKSLGIEPM 323


>gi|221211048|ref|ZP_03584027.1| biotin synthase [Burkholderia multivorans CGD1]
 gi|221168409|gb|EEE00877.1| biotin synthase [Burkholderia multivorans CGD1]
          Length = 324

 Score =  308 bits (789), Expect = 7e-82,   Method: Composition-based stats.
 Identities = 173/312 (55%), Positives = 226/312 (72%)

Query: 12  PTKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGY 71
               P+ W   +V  ++ +PFNDL+F +  VHR++F+ N +QLS LL+IKTGGC E+CGY
Sbjct: 2   AAPSPQRWRVADVVALFELPFNDLIFRAQQVHREHFDANAVQLSTLLSIKTGGCEEDCGY 61

Query: 72  CNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKG 131
           C+QS H+ + LKA KL++VD VL  A+ AK NGA+R+CMGAAWR PKER +  + +M++G
Sbjct: 62  CSQSAHHDTGLKAEKLMDVDAVLDAARAAKANGASRFCMGAAWRNPKERHMPALTEMVRG 121

Query: 132 VKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLEN 191
           VK+LGLETCMTLGML  EQA+ L+ AGLDYYNHN+DTS  FY  V +T T++DRL TL+ 
Sbjct: 122 VKALGLETCMTLGMLEDEQAKQLADAGLDYYNHNLDTSPEFYGQVISTRTYQDRLDTLDR 181

Query: 192 VRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVD 251
           VR +GI VCCGGI+G+GE   +R  ++  LANL+  PES+PIN L+ I G+       +D
Sbjct: 182 VRDAGINVCCGGIIGMGESRRERAGLISQLANLNPYPESVPINNLVAIEGTPLAGTAPLD 241

Query: 252 PIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYN 311
           P E VR I+VARI MPK+ +RL+AGR  + D LQALCF +GANS+F GD LLT  NP   
Sbjct: 242 PFEFVRTIAVARITMPKAVVRLSAGREQLDDGLQALCFLAGANSMFYGDQLLTTSNPQTQ 301

Query: 312 KDTILFNRLGLI 323
           KD  LF RLG+ 
Sbjct: 302 KDRALFERLGIR 313


>gi|282891664|ref|ZP_06300151.1| hypothetical protein pah_c188o039 [Parachlamydia acanthamoebae str.
           Hall's coccus]
 gi|281498454|gb|EFB40786.1| hypothetical protein pah_c188o039 [Parachlamydia acanthamoebae str.
           Hall's coccus]
          Length = 333

 Score =  308 bits (789), Expect = 7e-82,   Method: Composition-based stats.
 Identities = 156/313 (49%), Positives = 215/313 (68%), Gaps = 1/313 (0%)

Query: 12  PTKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGY 71
           P      W+ +E+  IY+ P  DL+F + +VHRK      IQL  LL+IKTGGCPENC Y
Sbjct: 2   PYPIRHNWSREEISSIYHSPLLDLIFEAASVHRKFHSSREIQLCTLLSIKTGGCPENCSY 61

Query: 72  CNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKER-DLSIIVDMIK 130
           C QS    + +KA  L+ +++VL  AKNAK  G+TR+CMGAAWR+ +   D   ++ M++
Sbjct: 62  CPQSARYNTDVKAEALMQLEEVLDAAKNAKNAGSTRFCMGAAWRQVRNSPDFERVLVMVR 121

Query: 131 GVKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLE 190
            V  LGLE C  LGML+ EQA+ L +AGL  YNHN+D+ E FYP + T+ T++DRL TLE
Sbjct: 122 EVSQLGLEVCCCLGMLTEEQAKKLKEAGLHSYNHNVDSGEEFYPSIITSRTYQDRLNTLE 181

Query: 191 NVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKV 250
           NVRK+ + VCCGGI+GLGE  +DRI ML TLA L T P+S+PIN+L+ + G+  +    +
Sbjct: 182 NVRKADLSVCCGGIIGLGEKSEDRISMLHTLATLPTHPDSVPINMLVSVKGTPLQNQAPI 241

Query: 251 DPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSY 310
              E +R+++ AR++MP+S +RL+AGR  +SD  QALCF +GANSIF GD LLT  NP +
Sbjct: 242 PVWEMLRMVATARLIMPQSMVRLSAGRLSLSDAEQALCFMAGANSIFTGDKLLTTPNPDF 301

Query: 311 NKDTILFNRLGLI 323
           ++D I+   LGL+
Sbjct: 302 DRDQIMLKTLGLV 314


>gi|148254230|ref|YP_001238815.1| biotin synthetase [Bradyrhizobium sp. BTAi1]
 gi|254810574|sp|A5EFG5|BIOB_BRASB RecName: Full=Biotin synthase
 gi|146406403|gb|ABQ34909.1| biotin synthetase (Biotin synthase) [Bradyrhizobium sp. BTAi1]
          Length = 350

 Score =  308 bits (789), Expect = 7e-82,   Method: Composition-based stats.
 Identities = 166/313 (53%), Positives = 226/313 (72%), Gaps = 1/313 (0%)

Query: 16  PKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQS 75
              WT +E   +Y +PF DL+F + +VHR++F+P  ++ + LL+IKTGGCPE+CGYC+QS
Sbjct: 19  RHDWTREEAEALYALPFPDLMFRAQSVHRRHFDPTRLETASLLSIKTGGCPEDCGYCSQS 78

Query: 76  VHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSL 135
            H  + LKA+KL++ D V+  A+ AK  GA R+CM AAWR PK+RDL  + DM+  VK L
Sbjct: 79  AHYDTGLKATKLMDRDTVVATAQRAKAAGAERFCMAAAWRSPKDRDLDQVCDMVSAVKDL 138

Query: 136 GLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKS 195
           G+ETC+TLGML+  QAQ L +AGLD+YNHN+DTS  FY  + TT T +DR+ TL +VR +
Sbjct: 139 GMETCVTLGMLTPPQAQRLKQAGLDFYNHNVDTSPEFYDRIITTRTLQDRIDTLAHVRDA 198

Query: 196 GIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEE-NKKVDPIE 254
           GIKVCCGGI+G+GE +DDR+ M++ LANL   P+S+PIN+   + G    +   + DPI 
Sbjct: 199 GIKVCCGGIIGMGEAVDDRLGMMVLLANLGAHPDSVPINMWNEVKGVPVNDTAARPDPIA 258

Query: 255 HVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDT 314
            VR+I+V RI+MP+S +RL+AGR  MSDELQ+LC  +GANSIF+GD LLT  NP  ++D 
Sbjct: 259 LVRLIAVTRIMMPQSVVRLSAGRQYMSDELQSLCLLAGANSIFIGDVLLTTANPQADRDA 318

Query: 315 ILFNRLGLIPDLS 327
            L  RLG+   LS
Sbjct: 319 ALLARLGMTSALS 331


>gi|161621306|ref|YP_582272.2| biotin synthase [Cupriavidus metallidurans CH34]
 gi|254810860|sp|Q1LS73|BIOB_RALME RecName: Full=Biotin synthase
          Length = 345

 Score =  308 bits (788), Expect = 9e-82,   Method: Composition-based stats.
 Identities = 167/312 (53%), Positives = 226/312 (72%)

Query: 14  KKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCN 73
           K+   W   +V  ++ +PFNDLLF +  VHR++F+ N +QLS LL+IKTGGC E+CGYC 
Sbjct: 30  KEGDAWRVDDVAALFALPFNDLLFRAQQVHREHFDANTVQLSTLLSIKTGGCEEDCGYCP 89

Query: 74  QSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVK 133
           QS H+ + +KA KL++++ VL  AK AK NGATR+CMGAAWREPKER L  ++DM++ VK
Sbjct: 90  QSAHHDAGVKAEKLMDLEAVLDAAKAAKANGATRFCMGAAWREPKERHLEPVIDMVREVK 149

Query: 134 SLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVR 193
           ++GLETC+TLGML  EQAQ L  AGLDYYNHN+DTS  FY  + TT T++DRL T+ +VR
Sbjct: 150 AMGLETCVTLGMLKAEQAQRLKDAGLDYYNHNLDTSPEFYGKIITTRTYQDRLDTIGHVR 209

Query: 194 KSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPI 253
           ++GI VCCGGI+G+GE  + R  ++  LAN+   PES+PIN L+ + G+     + +DP 
Sbjct: 210 EAGINVCCGGIVGMGEAREARAGLIAQLANMDPYPESVPINNLVQVEGTPLAGTEALDPF 269

Query: 254 EHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKD 313
           E VR I+VARI MP++ +RL+AGR  M + LQALCF +GANSIF G+ LLT  NP  ++D
Sbjct: 270 EFVRTIAVARITMPRAMVRLSAGREAMDEALQALCFMAGANSIFYGEKLLTTGNPQADRD 329

Query: 314 TILFNRLGLIPD 325
             L  RL +  +
Sbjct: 330 RALLARLDIRAE 341


>gi|119899107|ref|YP_934320.1| biotin synthase [Azoarcus sp. BH72]
 gi|254810557|sp|A1K9C8|BIOB_AZOSB RecName: Full=Biotin synthase
 gi|119671520|emb|CAL95433.1| biotin synthase [Azoarcus sp. BH72]
          Length = 326

 Score =  308 bits (788), Expect = 1e-81,   Method: Composition-based stats.
 Identities = 162/308 (52%), Positives = 224/308 (72%)

Query: 16  PKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQS 75
            K WT  EV  ++++PF DL+F +  VHR +F  N +Q S LL+IKTGGC E+CGYC+QS
Sbjct: 17  RKKWTVAEVQALFDLPFLDLVFQAQQVHRAHFAANEVQRSTLLSIKTGGCSEDCGYCSQS 76

Query: 76  VHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSL 135
               + L+  +L+ +D+VL+ A+ AK  G++R+CMGAAWR PK++D++ +++M++ VK L
Sbjct: 77  ARYDTGLERERLLPLDEVLEHARAAKAKGSSRFCMGAAWRGPKDKDMAPVLEMVREVKKL 136

Query: 136 GLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKS 195
           GLETC+TLGML   QA+ L++AGLDYYNHNIDT+  FY  + TTHT +DRL TL+ VR +
Sbjct: 137 GLETCVTLGMLKEGQAEQLAEAGLDYYNHNIDTAPEFYGQIVTTHTLQDRLDTLDKVRDA 196

Query: 196 GIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEH 255
           GI VCCGGI+G+GE    R  ++  LAN++ PP+S+PIN L+ IPG+   +   +D  + 
Sbjct: 197 GINVCCGGIVGMGETQTSRAGLIAQLANMTPPPDSVPINNLVAIPGTPLADGGTIDGFDF 256

Query: 256 VRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTI 315
           VR I+ ARI MP S +RL+AGR  MSDE+QALCF +GANSIF G+ LLT  NP  ++D +
Sbjct: 257 VRTIAAARITMPTSYVRLSAGRQQMSDEMQALCFMAGANSIFYGERLLTTDNPESDRDDV 316

Query: 316 LFNRLGLI 323
           LF RLGL 
Sbjct: 317 LFARLGLR 324


>gi|302697605|ref|XP_003038481.1| hypothetical protein SCHCODRAFT_64183 [Schizophyllum commune H4-8]
 gi|300112178|gb|EFJ03579.1| hypothetical protein SCHCODRAFT_64183 [Schizophyllum commune H4-8]
          Length = 394

 Score =  307 bits (787), Expect = 1e-81,   Method: Composition-based stats.
 Identities = 149/324 (45%), Positives = 214/324 (66%), Gaps = 2/324 (0%)

Query: 2   SRSTVVPEENPTKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIK 61
           + ++  P    T     WT +E+  IY+ P  DL+F +  VHR++ +P  +QL  L+NIK
Sbjct: 20  THASTAPPTPKTVTRHDWTKQEIQSIYDSPLLDLVFRAAAVHREHNDPRKVQLCTLMNIK 79

Query: 62  TGGCPENCGYCNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREP--KE 119
           TGGC ENC YC+QS    +  KAS L+ V+ VL+ A+ AK NG+TR+CMGAAWR+   ++
Sbjct: 80  TGGCSENCSYCSQSSRYSTSTKASPLLEVEPVLEAARKAKANGSTRFCMGAAWRDLAGRK 139

Query: 120 RDLSIIVDMIKGVKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTT 179
           R    I+ M++ V+ +G+E C TLGMLS EQA+ L +AGL  YNHN+DTS  FYP V T+
Sbjct: 140 RGFERILTMVREVRGMGMEVCTTLGMLSPEQARKLKEAGLTAYNHNLDTSREFYPEVITS 199

Query: 180 HTFEDRLQTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPI 239
            +++DRL T+  VR +GI VC GGILGLGE   DR+ ++  +AN+   PES P+N LIPI
Sbjct: 200 RSYDDRLDTISAVRDAGISVCSGGILGLGESDKDRVGLIWEVANMPEHPESFPVNALIPI 259

Query: 240 PGSKFEENKKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVG 299
           PG+  E+N+ V      R I+ ARI+MP + +R+AAGR +M +  Q +CF +GAN+IF G
Sbjct: 260 PGTPLEKNEMVPYHTLARTIATARIVMPTTIIRIAAGRNVMPESEQMMCFMAGANAIFTG 319

Query: 300 DTLLTAKNPSYNKDTILFNRLGLI 323
           + +LT     +++D  + +R GL 
Sbjct: 320 EQMLTTPCSPWDQDKAMMDRWGLE 343


>gi|238028782|ref|YP_002913013.1| Biotin synthase [Burkholderia glumae BGR1]
 gi|237877976|gb|ACR30309.1| Biotin synthase [Burkholderia glumae BGR1]
          Length = 359

 Score =  307 bits (787), Expect = 1e-81,   Method: Composition-based stats.
 Identities = 181/324 (55%), Positives = 234/324 (72%), Gaps = 2/324 (0%)

Query: 4   STVVPEENPTKKPK--VWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIK 61
           +T  PE  P   P    W   +V ++Y +PFNDLLF +  VHR++F+ N IQLS LL+IK
Sbjct: 11  ATTAPEAVPVGMPSAPRWRVADVVKLYELPFNDLLFRAQQVHREHFDANAIQLSTLLSIK 70

Query: 62  TGGCPENCGYCNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERD 121
           TGGC E+CGYC+QS H++++LKASKL++VD VL  A+ AK NGATR+CMGAAWR PKER 
Sbjct: 71  TGGCEEDCGYCSQSSHHETELKASKLMDVDAVLDAARAAKANGATRFCMGAAWRSPKERH 130

Query: 122 LSIIVDMIKGVKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHT 181
           +  + +MI+GVK +GLETCMTLGML   QAQ LS+AGLDYYNHN+DTS  FY  V +T T
Sbjct: 131 IEPLAEMIRGVKEMGLETCMTLGMLDDGQAQALSEAGLDYYNHNLDTSPEFYGQVISTRT 190

Query: 182 FEDRLQTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPG 241
           ++DRL TLE VR +GI VCCGGI+G+GE   +R  ++  LAN++  PES+PIN L+ I G
Sbjct: 191 YQDRLDTLERVRDAGINVCCGGIIGMGESRRERAGLITQLANMNPYPESVPINNLVAIKG 250

Query: 242 SKFEENKKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDT 301
           +  E    +DP+E VR I+VARI MPK+ +RL+AGR  + D +Q LCF +GANS+F GD 
Sbjct: 251 TPLENTAPLDPLEFVRTIAVARITMPKAMVRLSAGREQLDDAMQTLCFLAGANSMFYGDQ 310

Query: 302 LLTAKNPSYNKDTILFNRLGLIPD 325
           LLT  NP   KD  L  RLG+  +
Sbjct: 311 LLTTSNPQAQKDRDLLARLGMRAE 334


>gi|297537771|ref|YP_003673540.1| biotin synthase [Methylotenera sp. 301]
 gi|297257118|gb|ADI28963.1| biotin synthase [Methylotenera sp. 301]
          Length = 337

 Score =  307 bits (787), Expect = 1e-81,   Method: Composition-based stats.
 Identities = 154/306 (50%), Positives = 216/306 (70%)

Query: 18  VWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQSVH 77
            W+  ++  ++ +PF+DL++ + TVHR NF PN +Q+S LL+IKTGGC E+CGYC Q+  
Sbjct: 30  RWSVADIVALFELPFSDLMYQAQTVHRANFNPNAVQVSTLLSIKTGGCSEDCGYCPQAAR 89

Query: 78  NKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLGL 137
             ++++   L+ ++ V+  A+ AK+NGA+R+CMGAAWR PK+RDL  ++ MI  VK++GL
Sbjct: 90  YHTEVENEPLMKLEDVVAAAQEAKDNGASRFCMGAAWRGPKQRDLEPVLKMIAEVKAMGL 149

Query: 138 ETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSGI 197
           ETC TLGML   QA+ L +AGLDYYNHN+DT+  FY  V TT T++DRL TL+ VR   I
Sbjct: 150 ETCATLGMLKDGQAEQLKEAGLDYYNHNLDTAPEFYGDVITTRTYQDRLDTLDRVRSQDI 209

Query: 198 KVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEHVR 257
            VC GGI+G+GE  + R  +L  LAN+  PPES+PINLL  + G+     +++DP E VR
Sbjct: 210 HVCSGGIIGMGETRNQRAGLLAQLANMERPPESVPINLLTQVEGTPLHGTEELDPFEFVR 269

Query: 258 IISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTILF 317
            I+ ARI MP S +RL+AGR  MS+ +Q++CF +GANSIF G+ LLT  NP  + D  LF
Sbjct: 270 TIAAARITMPNSYVRLSAGRQSMSEGIQSMCFLAGANSIFYGEKLLTTANPEASTDKKLF 329

Query: 318 NRLGLI 323
            +LG+ 
Sbjct: 330 EKLGIN 335


>gi|171316998|ref|ZP_02906204.1| biotin synthase [Burkholderia ambifaria MEX-5]
 gi|171097854|gb|EDT42675.1| biotin synthase [Burkholderia ambifaria MEX-5]
          Length = 339

 Score =  307 bits (787), Expect = 1e-81,   Method: Composition-based stats.
 Identities = 174/322 (54%), Positives = 232/322 (72%), Gaps = 2/322 (0%)

Query: 4   STVVPEENPT--KKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIK 61
           + V P+  P     P+ W   +V  ++ +PFNDL+F +  VHR++F+ N +QLS LL+IK
Sbjct: 7   AAVQPDAIPVAAPAPQRWRVADVVALFELPFNDLMFRAQQVHREHFDANAVQLSTLLSIK 66

Query: 62  TGGCPENCGYCNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERD 121
           TGGC E+CGYC+QS H+++ LKA KL++VD VL  A+ AK NGA+R+CMGAAWR PKER 
Sbjct: 67  TGGCEEDCGYCSQSSHHETGLKAEKLMDVDTVLDAARAAKANGASRFCMGAAWRNPKERH 126

Query: 122 LSIIVDMIKGVKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHT 181
           +  + +M++GVK LGLETCMTLGML  EQA+ L+ AGLDYYNHN+DTS  FY  V +T T
Sbjct: 127 MPALTEMVRGVKELGLETCMTLGMLENEQARQLADAGLDYYNHNLDTSPEFYGQVISTRT 186

Query: 182 FEDRLQTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPG 241
           ++DRL TL+ VR +GI VCCGGI+G+GE   +R  ++  LANL+  PES+PIN L+ I G
Sbjct: 187 YQDRLDTLDRVRDAGINVCCGGIIGMGESRRERAGLISQLANLNPYPESVPINNLVAIEG 246

Query: 242 SKFEENKKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDT 301
           +  E    +DP E VR I+VARI MPK+ +RL+AGR  + D +QA+CF +GANS+F GD 
Sbjct: 247 TPLEGTAPLDPFEFVRTIAVARITMPKAVVRLSAGREQLDDAMQAMCFLAGANSMFYGDQ 306

Query: 302 LLTAKNPSYNKDTILFNRLGLI 323
           LLT  NP   +D  LF RLG+ 
Sbjct: 307 LLTTSNPQTQRDRALFERLGIR 328


>gi|91786799|ref|YP_547751.1| biotin synthase [Polaromonas sp. JS666]
 gi|122968165|sp|Q12F39|BIOB1_POLSJ RecName: Full=Biotin synthase 1
 gi|91696024|gb|ABE42853.1| biotin synthase [Polaromonas sp. JS666]
          Length = 337

 Score =  307 bits (787), Expect = 1e-81,   Method: Composition-based stats.
 Identities = 154/317 (48%), Positives = 214/317 (67%), Gaps = 2/317 (0%)

Query: 8   PEENPTKKPK--VWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGC 65
           P     +  +   W+  E+  ++N+PF +L+  + TVHR+NF+P  ++ + LL++KTGGC
Sbjct: 13  PPRPAVQPREHGRWSVDEIEALFNLPFPELMHRAQTVHRENFDPTRVEFATLLSVKTGGC 72

Query: 66  PENCGYCNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSII 125
            E+CGYC Q+    + ++ASKL+   +VL  A+ A+  GATR+CMGAAWR PK+RD+  +
Sbjct: 73  AEDCGYCPQAARYDTGVEASKLMEPAEVLAAAQRAQAAGATRFCMGAAWRSPKDRDIEKV 132

Query: 126 VDMIKGVKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDR 185
            ++++ VK+LGLETC TLGML    AQ L  AGLDYYNHN+D++  FY  + TT  ++DR
Sbjct: 133 AELVRTVKALGLETCATLGMLEDGHAQTLQSAGLDYYNHNLDSAPDFYGDIITTRDYQDR 192

Query: 186 LQTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFE 245
           L TL  VR +G+KVCCGGI+G+GE    R  ++  LANL+  PES+PIN L+ + G+   
Sbjct: 193 LDTLARVRSAGVKVCCGGIVGMGETRRQRAGLVAELANLTPYPESVPINNLVKVEGTPLA 252

Query: 246 ENKKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTA 305
               +DP E VR I+VARI MP +R+RL+AGR  M D +QALCF +GANSIF GD LLT 
Sbjct: 253 NQADLDPFEFVRTIAVARITMPTARVRLSAGRQQMGDGVQALCFLAGANSIFYGDKLLTT 312

Query: 306 KNPSYNKDTILFNRLGL 322
            NP    D  L  RLG+
Sbjct: 313 GNPDTEADVTLLQRLGM 329


>gi|39935114|ref|NP_947390.1| biotin synthase [Rhodopseudomonas palustris CGA009]
 gi|192290648|ref|YP_001991253.1| biotin synthase [Rhodopseudomonas palustris TIE-1]
 gi|81563057|sp|Q6N859|BIOB_RHOPA RecName: Full=Biotin synthase
 gi|254810790|sp|B3QCX3|BIOB_RHOPT RecName: Full=Biotin synthase
 gi|39648965|emb|CAE27486.1| biotin synthetase [Rhodopseudomonas palustris CGA009]
 gi|192284397|gb|ACF00778.1| biotin synthase [Rhodopseudomonas palustris TIE-1]
          Length = 336

 Score =  307 bits (787), Expect = 1e-81,   Method: Composition-based stats.
 Identities = 188/311 (60%), Positives = 240/311 (77%), Gaps = 1/311 (0%)

Query: 16  PKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQS 75
              WT +E   IY+ PF DL+F + T+HR+ F+PN +Q ++LLN+KTGGC E+CGYC+QS
Sbjct: 17  RHDWTREEAAAIYHAPFADLMFRAQTIHRQTFDPNQVQCNQLLNVKTGGCAEDCGYCSQS 76

Query: 76  VHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSL 135
            H+ + L ASKL+   +V++ AK A++ GATRYCMGAAWR PKERD++ +++M+KGVK+L
Sbjct: 77  AHHDTALPASKLMEPAKVIEAAKAARDAGATRYCMGAAWRSPKERDMAPVIEMVKGVKAL 136

Query: 136 GLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKS 195
           G+E CMTLGML+ +QA+ L+ AGLDYYNHNIDTSE FY  V  + +F DRL TLE V+ +
Sbjct: 137 GMEACMTLGMLTDDQAKQLADAGLDYYNHNIDTSEEFYASVVKSRSFGDRLDTLEKVQDA 196

Query: 196 GIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEE-NKKVDPIE 254
           GIKVCCGGILGLGE   DR++ML TLANL   PES+PIN+LIPI G+   +    VDP E
Sbjct: 197 GIKVCCGGILGLGEKPTDRVEMLRTLANLPQHPESVPINMLIPIEGTPIAKTATPVDPFE 256

Query: 255 HVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDT 314
            VR I++ARI+MPKS +RLAAGR  MSDE+QALCF +GANSIF+GDTLLT  NP  +KD 
Sbjct: 257 FVRTIALARIMMPKSDVRLAAGRTAMSDEMQALCFLAGANSIFIGDTLLTTPNPGDSKDR 316

Query: 315 ILFNRLGLIPD 325
            LFNRLG+ P 
Sbjct: 317 ALFNRLGITPR 327


>gi|254468746|ref|ZP_05082152.1| biotin synthase [beta proteobacterium KB13]
 gi|207087556|gb|EDZ64839.1| biotin synthase [beta proteobacterium KB13]
          Length = 326

 Score =  307 bits (787), Expect = 1e-81,   Method: Composition-based stats.
 Identities = 160/316 (50%), Positives = 219/316 (69%)

Query: 8   PEENPTKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPE 67
             +      +  + + +  ++  PFNDL+F SH VHR+NF PN +QLS LL+IKTGGC E
Sbjct: 9   KIDKNLSNDQSISIEYIRSLFEKPFNDLIFQSHQVHRENFNPNQVQLSTLLSIKTGGCSE 68

Query: 68  NCGYCNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVD 127
           +C YC QS    + ++  K++ +++V+  AK AK +GATR+CMGAAWR PK++DL ++ D
Sbjct: 69  DCAYCPQSARYDTDVENEKILALEEVIHAAKEAKSSGATRFCMGAAWRSPKQKDLDLVKD 128

Query: 128 MIKGVKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQ 187
           MI  VK LG+E+C TLGML  +QA+ L   GLDYYNHN+DTS  FY  + +T T+EDRL 
Sbjct: 129 MITEVKKLGMESCATLGMLDGDQAKQLKDVGLDYYNHNLDTSPEFYGDIISTRTYEDRLD 188

Query: 188 TLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEEN 247
           TL+NVR  GI VCCGGI+G+GE + +R  +L  L+NL+  PES+PINLL  + G+     
Sbjct: 189 TLKNVRDQGINVCCGGIVGMGESLTERAGLLAQLSNLTPQPESVPINLLTQVEGTPLFGQ 248

Query: 248 KKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKN 307
            ++D  + VR I+VARI+MPKS +RL+AGR  M++  QAL FF+GANSIF GD LLT  N
Sbjct: 249 TELDHFDFVRTIAVARIIMPKSYVRLSAGREKMNESTQALAFFAGANSIFYGDELLTTDN 308

Query: 308 PSYNKDTILFNRLGLI 323
           P+  KD  L  +LG+ 
Sbjct: 309 PASEKDQELLKKLGIK 324


>gi|172061886|ref|YP_001809538.1| biotin synthase [Burkholderia ambifaria MC40-6]
 gi|254810578|sp|B1YNS2|BIOB_BURA4 RecName: Full=Biotin synthase
 gi|171994403|gb|ACB65322.1| biotin synthase [Burkholderia ambifaria MC40-6]
          Length = 339

 Score =  307 bits (787), Expect = 1e-81,   Method: Composition-based stats.
 Identities = 175/322 (54%), Positives = 231/322 (71%), Gaps = 2/322 (0%)

Query: 4   STVVPEENPT--KKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIK 61
           + V P+  P     P+ W   +V  ++ +PFNDL+F +  VHR++F+ N +QLS LL+IK
Sbjct: 7   AAVQPDAIPVAAPAPQRWRVADVVALFELPFNDLMFRAQQVHREHFDANAVQLSTLLSIK 66

Query: 62  TGGCPENCGYCNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERD 121
           TGGC E+CGYC+QS H+ + LKA KL++VD VL  A+ AK NGA+R+CMGAAWR PKER 
Sbjct: 67  TGGCEEDCGYCSQSSHHDTGLKAEKLMDVDAVLDAARAAKANGASRFCMGAAWRNPKERH 126

Query: 122 LSIIVDMIKGVKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHT 181
           +  + +M++GVK LGLETCMTLGML  EQAQ L+ AGLDYYNHN+DTS  FY  V +T T
Sbjct: 127 MPALTEMVRGVKELGLETCMTLGMLEDEQAQELANAGLDYYNHNLDTSPEFYGQVISTRT 186

Query: 182 FEDRLQTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPG 241
           ++DRL TL+ VR +GI VCCGGI+G+GE   +R  ++  LANL+  PES+PIN L+ I G
Sbjct: 187 YQDRLDTLDRVRDAGINVCCGGIIGMGESRRERAGLISQLANLNPYPESVPINNLVAIEG 246

Query: 242 SKFEENKKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDT 301
           +  E    +DP E VR I+VARI MPK+ +RL+AGR  + D +QA+CF +GANS+F GD 
Sbjct: 247 TPLEGTAPLDPFEFVRTIAVARITMPKAVVRLSAGREQLDDAMQAMCFLAGANSMFYGDQ 306

Query: 302 LLTAKNPSYNKDTILFNRLGLI 323
           LLT  NP   +D  LF RLG+ 
Sbjct: 307 LLTTSNPQTQRDRALFERLGIR 328


>gi|93352914|gb|ABF07003.1| biotin synthase slightly down RPM proteomics BL (0,72)down also RWV
           BL (0.68) [Cupriavidus metallidurans CH34]
          Length = 358

 Score =  307 bits (786), Expect = 1e-81,   Method: Composition-based stats.
 Identities = 167/312 (53%), Positives = 226/312 (72%)

Query: 14  KKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCN 73
           K+   W   +V  ++ +PFNDLLF +  VHR++F+ N +QLS LL+IKTGGC E+CGYC 
Sbjct: 43  KEGDAWRVDDVAALFALPFNDLLFRAQQVHREHFDANTVQLSTLLSIKTGGCEEDCGYCP 102

Query: 74  QSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVK 133
           QS H+ + +KA KL++++ VL  AK AK NGATR+CMGAAWREPKER L  ++DM++ VK
Sbjct: 103 QSAHHDAGVKAEKLMDLEAVLDAAKAAKANGATRFCMGAAWREPKERHLEPVIDMVREVK 162

Query: 134 SLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVR 193
           ++GLETC+TLGML  EQAQ L  AGLDYYNHN+DTS  FY  + TT T++DRL T+ +VR
Sbjct: 163 AMGLETCVTLGMLKAEQAQRLKDAGLDYYNHNLDTSPEFYGKIITTRTYQDRLDTIGHVR 222

Query: 194 KSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPI 253
           ++GI VCCGGI+G+GE  + R  ++  LAN+   PES+PIN L+ + G+     + +DP 
Sbjct: 223 EAGINVCCGGIVGMGEAREARAGLIAQLANMDPYPESVPINNLVQVEGTPLAGTEALDPF 282

Query: 254 EHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKD 313
           E VR I+VARI MP++ +RL+AGR  M + LQALCF +GANSIF G+ LLT  NP  ++D
Sbjct: 283 EFVRTIAVARITMPRAMVRLSAGREAMDEALQALCFMAGANSIFYGEKLLTTGNPQADRD 342

Query: 314 TILFNRLGLIPD 325
             L  RL +  +
Sbjct: 343 RALLARLDIRAE 354


>gi|261252562|ref|ZP_05945135.1| biotin synthase [Vibrio orientalis CIP 102891]
 gi|260935953|gb|EEX91942.1| biotin synthase [Vibrio orientalis CIP 102891]
          Length = 350

 Score =  307 bits (786), Expect = 1e-81,   Method: Composition-based stats.
 Identities = 166/308 (53%), Positives = 226/308 (73%)

Query: 16  PKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQS 75
              WT  EV ++   PF DLLF +  VHR+  + NH+Q+S LL+IKTG CPE+C YC QS
Sbjct: 4   RHNWTVAEVRELMEKPFMDLLFEAQMVHRQYQQHNHVQVSTLLSIKTGACPEDCKYCPQS 63

Query: 76  VHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSL 135
               + ++  +L+ V++VL  A+ AK  G+TR+CMGAAW+ PKERD+  + DMIKGVK +
Sbjct: 64  ARYTTDIEKERLMEVERVLDAAQKAKNAGSTRFCMGAAWKNPKERDMPHLTDMIKGVKGM 123

Query: 136 GLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKS 195
           GLETCMTLGML+ +QA+ LS AGLDYYNHN+DTS  FY  + TT T++DRL TL +VR +
Sbjct: 124 GLETCMTLGMLTPDQAKSLSDAGLDYYNHNLDTSPEFYGSIITTRTYQDRLDTLSHVRDA 183

Query: 196 GIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEH 255
           G+K+C GGI+G+GE  +DR  + + LANL T PES+PIN+L+ + G+  EE   V+P + 
Sbjct: 184 GMKICSGGIIGMGESTNDRAGLFVELANLPTHPESVPINMLVKVKGTPLEEVDDVEPFDF 243

Query: 256 VRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTI 315
           VR+I+VARI+MP S +RL+AGR  M++++QALCF +GANS+F G  LLT  NPS +KD  
Sbjct: 244 VRLIAVARIMMPMSAVRLSAGREDMNEQMQALCFMAGANSVFYGCKLLTTPNPSEDKDMQ 303

Query: 316 LFNRLGLI 323
           LFN+LG+ 
Sbjct: 304 LFNKLGIN 311


>gi|187477336|ref|YP_785360.1| biotin synthase [Bordetella avium 197N]
 gi|123724968|sp|Q2KWF1|BIOB_BORA1 RecName: Full=Biotin synthase
 gi|115421922|emb|CAJ48442.1| biotin synthase [Bordetella avium 197N]
          Length = 323

 Score =  307 bits (786), Expect = 1e-81,   Method: Composition-based stats.
 Identities = 164/308 (53%), Positives = 218/308 (70%)

Query: 18  VWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQSVH 77
            W + +V  +Y +PF +LL  + +VHR++F+   IQLS LL+IKTGGCPE+CGYC+QS  
Sbjct: 14  RWRTADVVALYELPFPELLHRAQSVHREHFDATEIQLSSLLSIKTGGCPEDCGYCSQSAR 73

Query: 78  NKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLGL 137
           + S L A KL+ +D+VL EA+ AK  GA R+CMGAAWR PK   L  + +M++ VK+LGL
Sbjct: 74  HDSGLAAEKLMPLDEVLAEARAAKNAGAQRFCMGAAWRSPKPHHLEAVAEMVREVKALGL 133

Query: 138 ETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSGI 197
           ETC+TLGML   QA+ L +AGLDYYNHN+DTS  FY +V TT  ++DRL TL  VR +GI
Sbjct: 134 ETCVTLGMLQDGQAEQLKEAGLDYYNHNLDTSPEFYGNVVTTRGYQDRLDTLARVRNAGI 193

Query: 198 KVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEHVR 257
            VCCGGI+G+GE   DR  ++  LAN+   PES+PIN L+PIPG+   E   VD  E +R
Sbjct: 194 HVCCGGIIGMGESRRDRASLIAQLANMEPYPESVPINHLVPIPGTPLAEAAPVDVFEFIR 253

Query: 258 IISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTILF 317
            I+VARI MP++++RL+AGR  MS+  QALC  +GANSIF G +LLT  NP    D  L 
Sbjct: 254 TIAVARITMPRAKVRLSAGRQSMSEAEQALCLLAGANSIFYGASLLTTGNPQVQADRALM 313

Query: 318 NRLGLIPD 325
           ++LG+ P+
Sbjct: 314 SKLGMRPE 321


>gi|107023867|ref|YP_622194.1| biotin synthase [Burkholderia cenocepacia AU 1054]
 gi|116690952|ref|YP_836575.1| biotin synthase [Burkholderia cenocepacia HI2424]
 gi|170734282|ref|YP_001766229.1| biotin synthase [Burkholderia cenocepacia MC0-3]
 gi|254247044|ref|ZP_04940365.1| Biotin synthase [Burkholderia cenocepacia PC184]
 gi|122978659|sp|Q1BT34|BIOB_BURCA RecName: Full=Biotin synthase
 gi|254810579|sp|B1JZE1|BIOB_BURCC RecName: Full=Biotin synthase
 gi|254810580|sp|A0KB05|BIOB_BURCH RecName: Full=Biotin synthase
 gi|105894056|gb|ABF77221.1| biotin synthase [Burkholderia cenocepacia AU 1054]
 gi|116649041|gb|ABK09682.1| biotin synthase [Burkholderia cenocepacia HI2424]
 gi|124871820|gb|EAY63536.1| Biotin synthase [Burkholderia cenocepacia PC184]
 gi|169817524|gb|ACA92107.1| biotin synthase [Burkholderia cenocepacia MC0-3]
          Length = 339

 Score =  307 bits (786), Expect = 1e-81,   Method: Composition-based stats.
 Identities = 171/307 (55%), Positives = 225/307 (73%)

Query: 17  KVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQSV 76
           + W   +V  ++ +PFNDL+F +  VHR++F+ N +QLS LL+IKTGGC E+CGYC+QS 
Sbjct: 22  QRWRVADVVALFELPFNDLMFRAQQVHREHFDANAVQLSTLLSIKTGGCEEDCGYCSQSS 81

Query: 77  HNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLG 136
           H+ + LKA KL++VD VL  A+ AK NGA+R+CMGAAWR PKER +  + +M++GVK LG
Sbjct: 82  HHDTGLKAEKLMDVDTVLDAARAAKANGASRFCMGAAWRNPKERHMPALTEMVRGVKELG 141

Query: 137 LETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSG 196
           LETCMTLGML  EQAQ L+ AGLDYYNHN+DTS  FY  V +T T++DRL TL+ VR +G
Sbjct: 142 LETCMTLGMLEDEQAQQLADAGLDYYNHNLDTSPEFYGQVISTRTYQDRLDTLDRVRDAG 201

Query: 197 IKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEHV 256
           I VCCGGI+G+GE   +R  ++  LANL+  PES+PIN L+ I G+  E    +DP E V
Sbjct: 202 INVCCGGIIGMGESRRERAGLISQLANLNPYPESVPINNLVAIEGTPLEGTAPLDPFEFV 261

Query: 257 RIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTIL 316
           R I+VARI MPK+ +RL+AGR  + D +QA+CF +GANS+F GD LLT  NP   +D  L
Sbjct: 262 RTIAVARITMPKAVVRLSAGREQLDDAMQAMCFLAGANSMFYGDQLLTTSNPQTQRDRAL 321

Query: 317 FNRLGLI 323
           F RLG+ 
Sbjct: 322 FERLGIR 328


>gi|254810644|sp|Q5P7M6|BIOB_AZOSE RecName: Full=Biotin synthase
          Length = 326

 Score =  307 bits (786), Expect = 2e-81,   Method: Composition-based stats.
 Identities = 172/308 (55%), Positives = 224/308 (72%)

Query: 18  VWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQSVH 77
            WT  E  +++  PF DLLF +  VHR +F+PN +Q S LL+IKTGGC E+CGYC+QS  
Sbjct: 19  KWTVVEAVELFEQPFMDLLFRAQQVHRAHFDPNAVQRSTLLSIKTGGCSEDCGYCSQSTR 78

Query: 78  NKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLGL 137
           + + L   +L+ V +V++ AK AK  GA+R+CMGAAWR PK++D+  ++ M++ VK+LGL
Sbjct: 79  HNTGLDREQLLKVAEVVEHAKAAKAKGASRFCMGAAWRGPKDKDMETVLAMVREVKALGL 138

Query: 138 ETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSGI 197
           ETC+TLGML  +QA  L +AGLDYYNHN+DT+  FY  V TTHT  DRL TLE VR +GI
Sbjct: 139 ETCVTLGMLKGDQALQLKEAGLDYYNHNLDTAPEFYGQVITTHTLADRLDTLEQVRGAGI 198

Query: 198 KVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEHVR 257
            VC GGI+G+GE    R  +L+ LAN+++PPES+PIN L+P+PG+  E   K+DP E VR
Sbjct: 199 NVCSGGIVGMGEGRRSRAGLLVQLANMASPPESVPINNLVPVPGTPLENVDKIDPFEFVR 258

Query: 258 IISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTILF 317
            I+ ARI+MP S +RL+AGR  MSDELQALCF +GANSIF GD LLT  NP  ++D  LF
Sbjct: 259 TIAAARIMMPTSFVRLSAGRQQMSDELQALCFMAGANSIFYGDRLLTTDNPDTDRDEALF 318

Query: 318 NRLGLIPD 325
            RLGL P 
Sbjct: 319 ARLGLRPV 326


>gi|312881231|ref|ZP_07741029.1| biotin synthase [Vibrio caribbenthicus ATCC BAA-2122]
 gi|309371123|gb|EFP98577.1| biotin synthase [Vibrio caribbenthicus ATCC BAA-2122]
          Length = 350

 Score =  307 bits (785), Expect = 2e-81,   Method: Composition-based stats.
 Identities = 163/308 (52%), Positives = 226/308 (73%)

Query: 16  PKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQS 75
              WT ++V Q+   PF DLLF +  VHR   + NH+Q+S LL+IKTG CPE+C YC QS
Sbjct: 4   RHNWTIEQVRQLMQKPFMDLLFEAQQVHRAYQQHNHVQVSTLLSIKTGACPEDCKYCPQS 63

Query: 76  VHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSL 135
               + ++  +L+ V++VL  AK AK  G+TR+CMGAAW+ PK+RD+  + +MIKGVK +
Sbjct: 64  ARYTTDIEKERLMEVERVLDAAKKAKSAGSTRFCMGAAWKNPKQRDMPHLTEMIKGVKGM 123

Query: 136 GLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKS 195
           GLETCMTLGML+ EQA+ L+ AGLDYYNHN+DTS  FY  + TT T++DRL TL +VR +
Sbjct: 124 GLETCMTLGMLTPEQARSLADAGLDYYNHNLDTSPEFYGSIITTRTYQDRLDTLAHVRDA 183

Query: 196 GIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEH 255
           G+K+C GGI+G+GE  +DR  +L+ LANL T PES+PIN+L+ + G+  E    V+P + 
Sbjct: 184 GMKICSGGIIGMGESTNDRAGLLVELANLPTQPESVPINMLVKVKGTPLENVDDVEPFDF 243

Query: 256 VRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTI 315
           +R+I++ARI+MP S +RL+AGR  M++++QALCF +GANS+F G  LLT  NPS +KD  
Sbjct: 244 IRLIAIARIMMPMSAVRLSAGRENMNEQMQALCFMAGANSVFYGCKLLTTPNPSEDKDMQ 303

Query: 316 LFNRLGLI 323
           LFN+LG+ 
Sbjct: 304 LFNKLGIN 311


>gi|115524219|ref|YP_781130.1| biotin synthase [Rhodopseudomonas palustris BisA53]
 gi|122296457|sp|Q07PI4|BIOB_RHOP5 RecName: Full=Biotin synthase
 gi|115518166|gb|ABJ06150.1| biotin synthase [Rhodopseudomonas palustris BisA53]
          Length = 338

 Score =  307 bits (785), Expect = 2e-81,   Method: Composition-based stats.
 Identities = 189/325 (58%), Positives = 245/325 (75%), Gaps = 2/325 (0%)

Query: 1   MSRSTVVPEENPTKK-PKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLN 59
           M+   +      T      WT +E   IY+ PF DL+F + T+HR++F+PN +Q ++LLN
Sbjct: 1   MNSIDLPSLAEATPTIRHDWTREEAAAIYHAPFADLMFRAQTIHRQSFDPNAVQCNQLLN 60

Query: 60  IKTGGCPENCGYCNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKE 119
           +KTGGC E+CGYC+QS H+ + L ASKL++  +V++ AK A++ GATRYCMGAAWREPK+
Sbjct: 61  VKTGGCAEDCGYCSQSAHHDTALPASKLMDPKKVIEAAKAARDAGATRYCMGAAWREPKD 120

Query: 120 RDLSIIVDMIKGVKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTT 179
           RD++ +++M+KGVK+LG+E C+TLGMLS  QA+ L+ AGLDYYNHN+DTSE FY  V TT
Sbjct: 121 RDMAPVIEMVKGVKALGMEACVTLGMLSDAQAKQLADAGLDYYNHNVDTSEEFYSQVVTT 180

Query: 180 HTFEDRLQTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPI 239
            ++ DRL TL  V  +GIKVCCGGILGLGE   DR++ML TLANL+  PES+PIN+LIPI
Sbjct: 181 RSYGDRLDTLAKVHDAGIKVCCGGILGLGEKPTDRVEMLRTLANLAQHPESVPINMLIPI 240

Query: 240 PGSKF-EENKKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFV 298
            G+        VDPIE VR I++ARI+MPKS +RLAAGR  MSDE+QALCF +GANSIF+
Sbjct: 241 EGTPIAATATPVDPIEFVRTIALARIMMPKSDVRLAAGRTAMSDEMQALCFLAGANSIFI 300

Query: 299 GDTLLTAKNPSYNKDTILFNRLGLI 323
           GDTLLT  NP  +KD  LFNRLG+ 
Sbjct: 301 GDTLLTTPNPGDSKDRQLFNRLGIN 325


>gi|295687613|ref|YP_003591306.1| biotin synthase [Caulobacter segnis ATCC 21756]
 gi|295429516|gb|ADG08688.1| biotin synthase [Caulobacter segnis ATCC 21756]
          Length = 335

 Score =  307 bits (785), Expect = 2e-81,   Method: Composition-based stats.
 Identities = 168/326 (51%), Positives = 225/326 (69%), Gaps = 5/326 (1%)

Query: 7   VPEENPTKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCP 66
           + + N  +    WT  EV  ++++PF DL+  +  VHR  F+P+ IQLS+LL++KTGGC 
Sbjct: 1   MSKINAFEPRHDWTLAEVEALFDLPFMDLVHRAANVHRAWFDPSEIQLSQLLSVKTGGCA 60

Query: 67  ENCGYCNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIV 126
           ENCGYC+QS H K+ LKA KL++ D V+ +A+ A++ GA R+CMGAAWRE K+RDL  + 
Sbjct: 61  ENCGYCSQSAHFKTGLKAEKLMDADDVVAKARAARDGGAQRFCMGAAWRELKDRDLPKLA 120

Query: 127 DMIKGVKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRL 186
            MI  VK+LG+ETC TLGML+ +QA+ L  AGLDYYNHN+DT   +Y  V TT T+++RL
Sbjct: 121 TMIAEVKALGMETCATLGMLTADQAKALKAAGLDYYNHNLDTGPDYYKDVVTTRTYQERL 180

Query: 187 QTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEE 246
            TL +VR +G+  CCGGI+G+GE   DR  +L  LA L   P+S+PIN L+P+ G+   +
Sbjct: 181 DTLSHVRDAGMSTCCGGIVGMGETRRDRAGLLHQLATLPAHPDSLPINGLVPVSGTPLGD 240

Query: 247 N-----KKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDT 301
                 K +D IE VR I+VARI+ PKS +RL+AGR  MS ELQALCF +GANSIFVG  
Sbjct: 241 KVLSEGKAIDSIEFVRTIAVARIVCPKSMVRLSAGREGMSRELQALCFMAGANSIFVGGK 300

Query: 302 LLTAKNPSYNKDTILFNRLGLIPDLS 327
           LLT   P  ++D+ LF  L L P  S
Sbjct: 301 LLTTPLPDMDEDSRLFQDLDLKPMGS 326


>gi|331231666|ref|XP_003328496.1| biotin synthase [Puccinia graminis f. sp. tritici CRL 75-36-700-3]
 gi|309307486|gb|EFP84077.1| biotin synthase [Puccinia graminis f. sp. tritici CRL 75-36-700-3]
          Length = 402

 Score =  307 bits (785), Expect = 2e-81,   Method: Composition-based stats.
 Identities = 150/310 (48%), Positives = 217/310 (70%), Gaps = 2/310 (0%)

Query: 17  KVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQSV 76
           + WT ++V  +Y  P  +L+F + T HR   +P+ +QL  LLNIKTGGC E+C YC QS 
Sbjct: 53  RRWTKEQVKDVYESPLMELVFRAATTHRAYHDPSKVQLCTLLNIKTGGCTEDCSYCAQSS 112

Query: 77  HNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKER--DLSIIVDMIKGVKS 134
              + L+ASKLI+++ VL EA+ AK NG+TR+CMGAAWR+   R      I++M+K V++
Sbjct: 113 RYSTGLQASKLIDIEPVLAEARKAKANGSTRFCMGAAWRDMNGRKNGFKKILEMVKEVRA 172

Query: 135 LGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRK 194
           +G+E C TLGMLS EQA  L +AGL  YNHN+DTS  +YP V +T ++++RLQT+ENVR+
Sbjct: 173 MGMEVCTTLGMLSPEQAVQLKEAGLTAYNHNLDTSREYYPKVISTRSYDERLQTIENVRE 232

Query: 195 SGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIE 254
           +G+ VC GGI+GLGE  +DRI ++  ++ L  PPES P+N L+PIPG+   +N++V   E
Sbjct: 233 AGLSVCSGGIIGLGESDEDRIALICQMSQLPAPPESFPVNALVPIPGTPLGDNERVSFHE 292

Query: 255 HVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDT 314
            +R IS ARI++P S +R AAGR   S+  QA+CF +GAN+IF G+ +LT     +++D 
Sbjct: 293 ILRTISTARIVLPTSIVRFAAGRNTFSEAEQAMCFMAGANAIFTGEKMLTTPTSGWDEDI 352

Query: 315 ILFNRLGLIP 324
            +F+R G+ P
Sbjct: 353 SMFSRWGITP 362


>gi|29654322|ref|NP_820014.1| biotin synthase [Coxiella burnetii RSA 493]
 gi|153206820|ref|ZP_01945661.1| biotin synthase [Coxiella burnetii 'MSU Goat Q177']
 gi|154706147|ref|YP_001424413.1| biotin synthase [Coxiella burnetii Dugway 5J108-111]
 gi|161829732|ref|YP_001596710.1| biotin synthase [Coxiella burnetii RSA 331]
 gi|165918604|ref|ZP_02218690.1| biotin synthase [Coxiella burnetii RSA 334]
 gi|212212561|ref|YP_002303497.1| biotin synthase [Coxiella burnetii CbuG_Q212]
 gi|212218432|ref|YP_002305219.1| biotin synthase [Coxiella burnetii CbuK_Q154]
 gi|81629039|sp|Q83CU5|BIOB_COXBU RecName: Full=Biotin synthase
 gi|254810615|sp|B6J725|BIOB_COXB1 RecName: Full=Biotin synthase
 gi|254810616|sp|B6J074|BIOB_COXB2 RecName: Full=Biotin synthase
 gi|254810617|sp|A9KG71|BIOB_COXBN RecName: Full=Biotin synthase
 gi|254810618|sp|A9NCS0|BIOB_COXBR RecName: Full=Biotin synthase
 gi|29541589|gb|AAO90528.1| biotin synthase [Coxiella burnetii RSA 493]
 gi|120577183|gb|EAX33807.1| biotin synthase [Coxiella burnetii 'MSU Goat Q177']
 gi|154355433|gb|ABS76895.1| biotin synthase [Coxiella burnetii Dugway 5J108-111]
 gi|161761599|gb|ABX77241.1| biotin synthase [Coxiella burnetii RSA 331]
 gi|165917732|gb|EDR36336.1| biotin synthase [Coxiella burnetii RSA 334]
 gi|212010971|gb|ACJ18352.1| biotin synthase [Coxiella burnetii CbuG_Q212]
 gi|212012694|gb|ACJ20074.1| biotin synthase [Coxiella burnetii CbuK_Q154]
          Length = 321

 Score =  307 bits (785), Expect = 2e-81,   Method: Composition-based stats.
 Identities = 172/315 (54%), Positives = 227/315 (72%), Gaps = 1/315 (0%)

Query: 14  KKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCN 73
            K + W    V +++ +PF +LL+ ++  HR +F+   ++L  L +IKTG CPE+C YC 
Sbjct: 1   MKGRNWNQASVAKLFELPFFELLYKAYETHRSHFDVRDMELCTLSSIKTGTCPEDCAYCP 60

Query: 74  QSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVK 133
           QS H K+ ++  KLIN++ VL++AK AKENGA R+CMGAAWR P +R+L  +++MIK VK
Sbjct: 61  QSGHYKTDVEREKLINLEAVLEQAKVAKENGARRFCMGAAWRSPPKRELPKVLEMIKSVK 120

Query: 134 SLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVR 193
           +LGLETC+TLGML  EQA  L +AGLD+YNHN+DTS  FY  + TT T++DR++TL+NVR
Sbjct: 121 ALGLETCVTLGMLDQEQALQLKEAGLDFYNHNLDTSPEFYKKIITTRTYQDRMETLKNVR 180

Query: 194 KSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPI 253
            +GI VCCGGILG+GE   DRI +LL L  L  PP SIPIN LIPI G+  E  K +DP 
Sbjct: 181 NAGINVCCGGILGMGESRADRIQLLLELYQLPEPPTSIPINQLIPIKGTPLENTKAIDPF 240

Query: 254 EHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKD 313
           E ++ I++ R+L P S +RL+AGR  MSDELQA CF +GANSIF GD LLTAKNP  N+D
Sbjct: 241 EFIKTIAITRLLFPTSVIRLSAGREAMSDELQAWCFMAGANSIFYGDKLLTAKNPGQNRD 300

Query: 314 TILFNRLGLI-PDLS 327
             L  +LGL  P L+
Sbjct: 301 VNLLKKLGLKVPVLT 315


>gi|56475997|ref|YP_157586.1| biotin synthase protein, gene: BIOB [Aromatoleum aromaticum EbN1]
 gi|56312040|emb|CAI06685.1| Biotin synthase protein (EC 2.8.1.6),gene: BIOB [Aromatoleum
           aromaticum EbN1]
          Length = 328

 Score =  307 bits (785), Expect = 2e-81,   Method: Composition-based stats.
 Identities = 172/308 (55%), Positives = 224/308 (72%)

Query: 18  VWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQSVH 77
            WT  E  +++  PF DLLF +  VHR +F+PN +Q S LL+IKTGGC E+CGYC+QS  
Sbjct: 21  KWTVVEAVELFEQPFMDLLFRAQQVHRAHFDPNAVQRSTLLSIKTGGCSEDCGYCSQSTR 80

Query: 78  NKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLGL 137
           + + L   +L+ V +V++ AK AK  GA+R+CMGAAWR PK++D+  ++ M++ VK+LGL
Sbjct: 81  HNTGLDREQLLKVAEVVEHAKAAKAKGASRFCMGAAWRGPKDKDMETVLAMVREVKALGL 140

Query: 138 ETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSGI 197
           ETC+TLGML  +QA  L +AGLDYYNHN+DT+  FY  V TTHT  DRL TLE VR +GI
Sbjct: 141 ETCVTLGMLKGDQALQLKEAGLDYYNHNLDTAPEFYGQVITTHTLADRLDTLEQVRGAGI 200

Query: 198 KVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEHVR 257
            VC GGI+G+GE    R  +L+ LAN+++PPES+PIN L+P+PG+  E   K+DP E VR
Sbjct: 201 NVCSGGIVGMGEGRRSRAGLLVQLANMASPPESVPINNLVPVPGTPLENVDKIDPFEFVR 260

Query: 258 IISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTILF 317
            I+ ARI+MP S +RL+AGR  MSDELQALCF +GANSIF GD LLT  NP  ++D  LF
Sbjct: 261 TIAAARIMMPTSFVRLSAGRQQMSDELQALCFMAGANSIFYGDRLLTTDNPDTDRDEALF 320

Query: 318 NRLGLIPD 325
            RLGL P 
Sbjct: 321 ARLGLRPV 328


>gi|33595796|ref|NP_883439.1| biotin synthase [Bordetella parapertussis 12822]
 gi|33600323|ref|NP_887883.1| biotin synthase [Bordetella bronchiseptica RB50]
 gi|81579425|sp|Q7WB85|BIOB_BORPA RecName: Full=Biotin synthase
 gi|81580181|sp|Q7WMQ3|BIOB_BORBR RecName: Full=Biotin synthase
 gi|33565875|emb|CAE36422.1| biotin synthase [Bordetella parapertussis]
 gi|33567922|emb|CAE31835.1| biotin synthase [Bordetella bronchiseptica RB50]
          Length = 335

 Score =  307 bits (785), Expect = 2e-81,   Method: Composition-based stats.
 Identities = 160/321 (49%), Positives = 219/321 (68%), Gaps = 2/321 (0%)

Query: 7   VPEENPTKKP--KVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGG 64
           +P   P + P  + W    V +++ +PF DLL  +  VHR++F+ N +QLS LL+IKTGG
Sbjct: 6   IPVPTPVRPPSAERWPLAAVAELFELPFLDLLHRAQQVHRQHFDANTVQLSSLLSIKTGG 65

Query: 65  CPENCGYCNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSI 124
           CPE+C YC QS H  + + A KL+ +D+V++ A+ A+ NGA R+CMGAAWR PK   L  
Sbjct: 66  CPEDCAYCPQSAHYDTGVDADKLMPLDEVVRAARAAQANGAQRFCMGAAWRSPKPHHLEA 125

Query: 125 IVDMIKGVKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFED 184
           + +MI  VK+LG+ETC+TLGML   QA+ L  AGLDYYNHN+DT+  FY  + +T T++D
Sbjct: 126 VAEMIGAVKALGMETCVTLGMLRDGQAEQLKAAGLDYYNHNLDTAPEFYGKIISTRTYQD 185

Query: 185 RLQTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKF 244
           RL TL+ VR++GI VCCGGI+G+GE   DR  ++  LAN+   PES+PIN L+ + G+  
Sbjct: 186 RLDTLQQVREAGINVCCGGIVGMGESRRDRAGLVAQLANMEPYPESVPINNLVQVEGTPL 245

Query: 245 EENKKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLT 304
              + +DP E +R I+VARI MP +++RL+AGR  MSD  QALCF +GANSIF GD LLT
Sbjct: 246 AGAETLDPFEFIRTIAVARITMPLAKVRLSAGRETMSDSEQALCFMAGANSIFYGDVLLT 305

Query: 305 AKNPSYNKDTILFNRLGLIPD 325
             NP    D  L  RLG+  +
Sbjct: 306 TGNPQVEADRRLLQRLGMRAE 326


>gi|323494956|ref|ZP_08100047.1| biotin synthase [Vibrio brasiliensis LMG 20546]
 gi|323310751|gb|EGA63924.1| biotin synthase [Vibrio brasiliensis LMG 20546]
          Length = 350

 Score =  307 bits (785), Expect = 2e-81,   Method: Composition-based stats.
 Identities = 162/308 (52%), Positives = 232/308 (75%)

Query: 16  PKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQS 75
              WT  +V ++   PF DLLF +  VHR++ + NH+Q+S LL+IKTG CPE+C YC QS
Sbjct: 4   RHNWTVAQVRELMEKPFMDLLFEAQLVHRQHQQHNHVQVSTLLSIKTGACPEDCKYCPQS 63

Query: 76  VHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSL 135
               + ++  +L+ V++VL  A+ AK  G+TR+CMGAAW+ PKERD+  + DMIKGVK +
Sbjct: 64  ARYTTDVEKERLMEVERVLDAAQKAKNAGSTRFCMGAAWKNPKERDMPHLTDMIKGVKDM 123

Query: 136 GLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKS 195
           GLETCMTLGML+ +QA+ L+ AGLDYYNHN+DTS  FY ++ TT T++DRL TL +VR +
Sbjct: 124 GLETCMTLGMLTPDQAKALADAGLDYYNHNLDTSPEFYGNIITTRTYQDRLDTLSHVRDA 183

Query: 196 GIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEH 255
           G+K+C GGI+G+GE  +DR  +L+ LANL T PES+PIN+L+ + G+  E+ + V+P + 
Sbjct: 184 GMKICSGGIIGMGENANDRAGLLVELANLPTHPESVPINMLVKVKGTPLEKVEDVEPFDF 243

Query: 256 VRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTI 315
           +R+I++ARI+MPKS +RL+AGR  M++++QALCF +GANS+F G  LLT  NPS +KD +
Sbjct: 244 IRLIAIARIMMPKSAVRLSAGRENMNEQMQALCFMAGANSVFYGCKLLTTPNPSEDKDML 303

Query: 316 LFNRLGLI 323
           LF++LG+ 
Sbjct: 304 LFHKLGIN 311


>gi|217969956|ref|YP_002355190.1| biotin synthase [Thauera sp. MZ1T]
 gi|217507283|gb|ACK54294.1| biotin synthase [Thauera sp. MZ1T]
          Length = 326

 Score =  306 bits (784), Expect = 2e-81,   Method: Composition-based stats.
 Identities = 164/322 (50%), Positives = 221/322 (68%)

Query: 2   SRSTVVPEENPTKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIK 61
           + S  +           W + EV  ++ +P  +L+F +  VHR +F+P  +Q S LL+IK
Sbjct: 3   TTSATIERPAAPPSRHQWATAEVEALFELPLLELVFRAQQVHRSHFDPQEVQRSTLLSIK 62

Query: 62  TGGCPENCGYCNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERD 121
           TGGC E+CGYC+QS  + S L   +L+ VD+VL  A+ AK  GA+R+CMGAAWR PK++D
Sbjct: 63  TGGCSEDCGYCSQSARHDSGLARQRLLPVDEVLANARAAKARGASRFCMGAAWRGPKDQD 122

Query: 122 LSIIVDMIKGVKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHT 181
           L+ +++M++ VK+LGL+TC+TLGML   QA+ L+ AGLDYYNHN+DT+  FY  V TTHT
Sbjct: 123 LAPVLEMVREVKALGLQTCVTLGMLKEGQAEQLADAGLDYYNHNLDTAPDFYGRVITTHT 182

Query: 182 FEDRLQTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPG 241
            +DRL TL+ VR +GI VC GGI+G+GE    R  ++  LANL  PPES+PIN L+ +PG
Sbjct: 183 LQDRLDTLDKVRGAGINVCSGGIVGMGENRRQRAALIAQLANLPAPPESVPINNLVQVPG 242

Query: 242 SKFEENKKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDT 301
           +       +DP E VR I+ ARI MP S +RL+AGR  MSDELQALCF +GANS+F G+ 
Sbjct: 243 TPLAGAGALDPFEFVRTIAAARITMPSSYVRLSAGRGEMSDELQALCFLAGANSMFYGER 302

Query: 302 LLTAKNPSYNKDTILFNRLGLI 323
           LLT  NP  ++D  LF RLGL 
Sbjct: 303 LLTTDNPDADRDDRLFARLGLR 324


>gi|313206807|ref|YP_004045984.1| biotin synthase [Riemerella anatipestifer DSM 15868]
 gi|312446123|gb|ADQ82478.1| biotin synthase [Riemerella anatipestifer DSM 15868]
 gi|315023880|gb|EFT36882.1| biotin synthase [Riemerella anatipestifer RA-YM]
 gi|325335753|gb|ADZ12027.1| Biotin synthase related enzyme [Riemerella anatipestifer RA-GD]
          Length = 365

 Score =  306 bits (784), Expect = 3e-81,   Method: Composition-based stats.
 Identities = 154/311 (49%), Positives = 222/311 (71%), Gaps = 1/311 (0%)

Query: 17  KVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQSV 76
           + WT++E+  IYN+PF DL++ +  VHR++ +PN IQ+S L+++KTGGCPE+CGYC Q+ 
Sbjct: 4   QNWTTQEILDIYNLPFFDLIYRAAEVHRQHHDPNKIQVSSLISVKTGGCPEDCGYCPQAA 63

Query: 77  HNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKER-DLSIIVDMIKGVKSL 135
              +++K  +++ V+QV  +A  AK+NG +R C+GAAWR  K+  D   ++DM++ V  L
Sbjct: 64  RYHTEVKIHEMLPVNQVKAQALRAKQNGISRVCLGAAWRNVKDGPDFDHVLDMVREVTKL 123

Query: 136 GLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKS 195
            +E C TLGML+  QA+ L +AGL  YNHNID+SE +Y  V +T  FEDRL+T+ NVRK+
Sbjct: 124 DMEVCCTLGMLTENQAKRLEEAGLYAYNHNIDSSEEYYKEVISTRAFEDRLETINNVRKT 183

Query: 196 GIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEH 255
            I +C GGI+G+GE ++DR  ML  LAN+   PES+PIN L+ + G+  E+ + V+  E 
Sbjct: 184 SITLCSGGIIGMGESVEDRCGMLKVLANMMPQPESVPINALVAVEGTPMEDQEPVNIFEF 243

Query: 256 VRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTI 315
           VR+++ ARI++PK+++RL+AGR   S E QALCFF+GANSIF GD LLT  NP  N+D  
Sbjct: 244 VRMVATARIVLPKTQVRLSAGRTEFSKEGQALCFFAGANSIFAGDKLLTTPNPDINEDKT 303

Query: 316 LFNRLGLIPDL 326
           LFN LG+ P  
Sbjct: 304 LFNLLGIKPQQ 314


>gi|316934785|ref|YP_004109767.1| biotin synthase [Rhodopseudomonas palustris DX-1]
 gi|315602499|gb|ADU45034.1| biotin synthase [Rhodopseudomonas palustris DX-1]
          Length = 336

 Score =  306 bits (784), Expect = 3e-81,   Method: Composition-based stats.
 Identities = 189/311 (60%), Positives = 241/311 (77%), Gaps = 1/311 (0%)

Query: 16  PKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQS 75
              WT +E   IY+ PF DL+F + T+HR+ F+PN +Q ++LLN+KTGGC E+CGYC+QS
Sbjct: 17  RHDWTREEAAAIYHAPFADLMFRAQTIHRQTFDPNQVQCNQLLNVKTGGCAEDCGYCSQS 76

Query: 76  VHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSL 135
            H+ + L ASKL+   +V++ AK A++ GATRYCMGAAWR PKERD++ +++M+KGVK+L
Sbjct: 77  AHHDTALPASKLMEPAKVIEAAKAARDAGATRYCMGAAWRSPKERDMAPVIEMVKGVKAL 136

Query: 136 GLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKS 195
           G+E CMTLGML+ +QA+ L+ AGLDYYNHNIDTSE FY  V  T +F DRL TLE V+ +
Sbjct: 137 GMEACMTLGMLTDDQAKQLADAGLDYYNHNIDTSEEFYASVVKTRSFGDRLDTLEKVQDA 196

Query: 196 GIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEE-NKKVDPIE 254
           GIKVCCGGILGLGE   DR++ML TLANL   PES+PIN+LIPI G+   +    VDP E
Sbjct: 197 GIKVCCGGILGLGEKPTDRVEMLRTLANLPQHPESVPINMLIPIEGTPIAKTATPVDPFE 256

Query: 255 HVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDT 314
            VR I++ARI+MPKS +RLAAGR  MSDE+QALCF +GANSIF+GDTLLT  NP  +KD 
Sbjct: 257 FVRTIALARIMMPKSDVRLAAGRTAMSDEMQALCFLAGANSIFIGDTLLTTPNPGDSKDR 316

Query: 315 ILFNRLGLIPD 325
           +LFNRLG+ P 
Sbjct: 317 MLFNRLGITPR 327


>gi|254810864|sp|Q82SL7|BIOB_NITEU RecName: Full=Biotin synthase
          Length = 337

 Score =  306 bits (783), Expect = 3e-81,   Method: Composition-based stats.
 Identities = 150/306 (49%), Positives = 209/306 (68%)

Query: 18  VWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQSVH 77
            W+   +  + ++PF+DL+F + TVHR+  + N +QLS L+++KTGGC E+C YC Q+  
Sbjct: 30  RWSIAAIESLLDLPFSDLIFQAQTVHRQYHDANAVQLSTLISVKTGGCSEDCAYCPQAAR 89

Query: 78  NKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLGL 137
             + ++   +++ ++V+  A  AKE+GATR+CMGAAWR PK+RD+  + ++I  VK+LG+
Sbjct: 90  YHTGVENQAILSREEVVAAATQAKESGATRFCMGAAWRGPKQRDIEYMTEVISAVKALGM 149

Query: 138 ETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSGI 197
           ETC TLG+L   QA  L +AGLDYYNHN+DT+  FY  + TT  ++DRL TLE VR + I
Sbjct: 150 ETCATLGILKPGQATQLKQAGLDYYNHNLDTAPEFYGEIITTREYQDRLDTLEEVRGANI 209

Query: 198 KVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEHVR 257
            VCCGGI+GLGE    R  ++  LANL   PES+PIN L+ + G+      ++DP E VR
Sbjct: 210 NVCCGGIVGLGESRMARAGLIAQLANLDPYPESVPINYLVQVEGTPLYGTPELDPFEFVR 269

Query: 258 IISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTILF 317
            I+ ARI MPK+ +RL+AGR  M + +QALCF +GANSIF GD LLT  NP   KD  LF
Sbjct: 270 TIAAARITMPKAMVRLSAGRRQMPEAIQALCFLAGANSIFYGDKLLTTGNPDTEKDLALF 329

Query: 318 NRLGLI 323
            +LGL 
Sbjct: 330 EKLGLH 335


>gi|302759571|ref|XP_002963208.1| hypothetical protein SELMODRAFT_165887 [Selaginella moellendorffii]
 gi|300168476|gb|EFJ35079.1| hypothetical protein SELMODRAFT_165887 [Selaginella moellendorffii]
          Length = 406

 Score =  306 bits (783), Expect = 3e-81,   Method: Composition-based stats.
 Identities = 153/326 (46%), Positives = 212/326 (65%), Gaps = 2/326 (0%)

Query: 1   MSRSTVVPEENPTKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNI 60
           ++ S              W+ +E+ +IY+ P  DLLF    VHR       +Q   LL+I
Sbjct: 51  VAASLAAERAIREGSRTDWSRQEIQEIYDSPLLDLLFHGAQVHRHAHNFREVQQCTLLSI 110

Query: 61  KTGGCPENCGYCNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKER 120
           KTGGC E+C YC QS    + +K  KL++ D VL  A+ AK+ G+TR+CMGAAWR+   R
Sbjct: 111 KTGGCSEDCAYCPQSSRYNTGVKGQKLLSEDVVLDAARKAKDAGSTRFCMGAAWRDTVGR 170

Query: 121 D--LSIIVDMIKGVKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTT 178
           +   + I+D +K ++ +G+E C TLGML  + AQ L +AGL  YNHN+DTS  +YP+V T
Sbjct: 171 NSNFNQILDYVKQIRGMGMEVCCTLGMLEEKHAQALKEAGLTAYNHNLDTSREYYPNVIT 230

Query: 179 THTFEDRLQTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIP 238
           T ++++RL+TLE VR +GI VC GGI+GLGE ++DRI +L TL+ L   PES+PIN L+ 
Sbjct: 231 TRSYDERLKTLEIVRDAGISVCSGGIIGLGEQVEDRIGLLHTLSTLPQHPESVPINALVA 290

Query: 239 IPGSKFEENKKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFV 298
           + G+  E  K V+  E VR+I+ ARI MPK+ +RL+AGR   S   QALCF +GANSIF 
Sbjct: 291 VKGTPLENQKPVEIWEMVRMIATARICMPKAMVRLSAGRVKFSQPEQALCFMAGANSIFT 350

Query: 299 GDTLLTAKNPSYNKDTILFNRLGLIP 324
           G+ LLT  N S+++D  +F  LGLIP
Sbjct: 351 GEKLLTTPNNSFSEDQQMFQLLGLIP 376


>gi|330818480|ref|YP_004362185.1| Biotin synthase [Burkholderia gladioli BSR3]
 gi|327370873|gb|AEA62229.1| Biotin synthase [Burkholderia gladioli BSR3]
          Length = 363

 Score =  306 bits (783), Expect = 3e-81,   Method: Composition-based stats.
 Identities = 175/308 (56%), Positives = 228/308 (74%)

Query: 18  VWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQSVH 77
            W   +V ++Y +PFNDLLF +  VHR++F+ N IQLS LL+IKTGGC E+CGYC+QS H
Sbjct: 31  RWRVADVVKLYELPFNDLLFRAQQVHREHFDANAIQLSTLLSIKTGGCEEDCGYCSQSSH 90

Query: 78  NKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLGL 137
           ++++LKASKL++V  VL  A+ AK NGATR+CMGAAWR PKER +  + +MI+GVK +GL
Sbjct: 91  HETELKASKLMDVSAVLDAARAAKANGATRFCMGAAWRSPKERHIEPLTEMIRGVKEMGL 150

Query: 138 ETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSGI 197
           ETCMTLGML  EQAQ LS+AGLDYYNHN+DTS  FY  V +T T++DRL TL+ VR +GI
Sbjct: 151 ETCMTLGMLEDEQAQALSEAGLDYYNHNLDTSPEFYGQVISTRTYQDRLDTLDRVRDAGI 210

Query: 198 KVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEHVR 257
            VCCGGI+G+GE   +R  ++  LAN++  PES+PIN L+ I G+  E    +DP+E VR
Sbjct: 211 NVCCGGIIGMGESRRERAGLITQLANMNPYPESVPINNLVAIKGTPLEGTAPLDPLEFVR 270

Query: 258 IISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTILF 317
            I+VARI MPK+ +RL+AGR  + D +Q LCF +GANS+F GD LLT  NP   KD  L 
Sbjct: 271 TIAVARITMPKAMVRLSAGREQLDDSMQTLCFLAGANSMFYGDQLLTTSNPQAQKDRELL 330

Query: 318 NRLGLIPD 325
            RLG+  +
Sbjct: 331 ARLGMRAE 338


>gi|306845848|ref|ZP_07478416.1| biotin synthase [Brucella sp. BO1]
 gi|306273740|gb|EFM55578.1| biotin synthase [Brucella sp. BO1]
          Length = 346

 Score =  306 bits (783), Expect = 3e-81,   Method: Composition-based stats.
 Identities = 203/308 (65%), Positives = 254/308 (82%)

Query: 18  VWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQSVH 77
            W+++E   IYN+PFNDLLF +H++HR+NF+PN IQLSKLLNIKTGGCPE+CGYC+QS  
Sbjct: 34  RWSAEEARAIYNLPFNDLLFRAHSLHRENFDPNRIQLSKLLNIKTGGCPEDCGYCSQSAS 93

Query: 78  NKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLGL 137
            ++ LKASKL+ ++ VL+EA+ AK  GATRYCMGAAWR PK+RD+  +  MI+ VK++GL
Sbjct: 94  AENGLKASKLMGIETVLEEARKAKAAGATRYCMGAAWRSPKDRDMPALTHMIESVKAMGL 153

Query: 138 ETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSGI 197
           ETCMTLGML  ++A+ L+ AGLDYYNHNIDTSERFYP V TT +FEDRL TL NVR +GI
Sbjct: 154 ETCMTLGMLDSDKAEKLADAGLDYYNHNIDTSERFYPAVITTRSFEDRLDTLANVRNAGI 213

Query: 198 KVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEHVR 257
           KVC GGILGLGE  +DRIDMLLTLANL  PPES+PIN+LIP+PG++      VDP+E +R
Sbjct: 214 KVCSGGILGLGEGAEDRIDMLLTLANLPEPPESVPINMLIPMPGTRLANAAPVDPLEFIR 273

Query: 258 IISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTILF 317
           ++++ARILMPKS +RL AGR  MSDE+QALCFF+GANS+F+GDTLLTA NPS ++DT L 
Sbjct: 274 VVALARILMPKSHVRLTAGRTAMSDEMQALCFFAGANSLFMGDTLLTAANPSDDRDTSLL 333

Query: 318 NRLGLIPD 325
            RLG+  +
Sbjct: 334 RRLGIQAE 341


>gi|86137733|ref|ZP_01056309.1| biotin synthetase [Roseobacter sp. MED193]
 gi|85825325|gb|EAQ45524.1| biotin synthetase [Roseobacter sp. MED193]
          Length = 346

 Score =  306 bits (783), Expect = 3e-81,   Method: Composition-based stats.
 Identities = 190/313 (60%), Positives = 239/313 (76%)

Query: 11  NPTKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCG 70
           +       WT  E  +IYNMPF DLLF + +VHR++++PN +Q SKLL+IKTGGC E+C 
Sbjct: 3   DAAPLRNDWTRAEAEEIYNMPFMDLLFRAQSVHRQHYDPNQVQRSKLLSIKTGGCAEDCA 62

Query: 71  YCNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIK 130
           YC+QS  N +KL ASKLI V++V+ EA+ AK  GATRYCMGAAWR PK+RD++ +  MI+
Sbjct: 63  YCSQSARNGAKLSASKLIEVERVIAEARKAKAGGATRYCMGAAWRSPKDRDMAALEAMIE 122

Query: 131 GVKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLE 190
           GVK LG+ETCMTLGML   Q   L  AGLDYYNHNIDTSER+Y  + TT TF DR+ TL 
Sbjct: 123 GVKGLGMETCMTLGMLDDNQVFRLRDAGLDYYNHNIDTSERYYSEIITTRTFADRIDTLN 182

Query: 191 NVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKV 250
            VR++G+KVC GGI+G+GE   DRIDM+L LA L   P+S+P+N+LIPI  +   +  K+
Sbjct: 183 RVREAGMKVCAGGIVGMGEQQMDRIDMMLALATLEEHPDSVPVNMLIPIADTPLADVAKL 242

Query: 251 DPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSY 310
           DPIE VR I++ARILMPKS +RL+AGR  MSDELQA+CFF+GANSIFVGDTLLTA NP  
Sbjct: 243 DPIEFVRTIALARILMPKSHVRLSAGRTDMSDELQAMCFFAGANSIFVGDTLLTADNPEE 302

Query: 311 NKDTILFNRLGLI 323
           +KD ILF++LG+ 
Sbjct: 303 DKDQILFDKLGIT 315


>gi|228473542|ref|ZP_04058295.1| biotin synthase [Capnocytophaga gingivalis ATCC 33624]
 gi|228275149|gb|EEK13952.1| biotin synthase [Capnocytophaga gingivalis ATCC 33624]
          Length = 353

 Score =  306 bits (783), Expect = 4e-81,   Method: Composition-based stats.
 Identities = 151/311 (48%), Positives = 218/311 (70%), Gaps = 1/311 (0%)

Query: 14  KKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCN 73
           +    WT++E+  IYN P  DLL+ + TVHR+  +PN +Q+S LL++KTGGC E+C YC+
Sbjct: 3   EIRHNWTAQEIIDIYNRPLMDLLYEAATVHRQYHDPNTVQVSTLLSVKTGGCSEDCCYCS 62

Query: 74  QSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKER-DLSIIVDMIKGV 132
           QS    ++++   ++++ QV  +A  AK +G++R CMGAAWR  K+  +   +++M++ +
Sbjct: 63  QSARYHTEVEIEPMMSLSQVKAQALRAKASGSSRVCMGAAWRNVKDGPEFEQVLEMVRTI 122

Query: 133 KSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENV 192
             L +E C TLGML+  QA+ LS+AGL  YNHN+DTSE +Y  + TT ++EDRL+T+ENV
Sbjct: 123 NKLDMEVCCTLGMLTENQAKRLSEAGLYAYNHNLDTSEDYYSEIVTTRSYEDRLKTIENV 182

Query: 193 RKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDP 252
           RK+ I +C GGI+G+GE ++DR  ML+ L+ L   PES+PIN L+PI G+  EE   VD 
Sbjct: 183 RKTSITICSGGIIGMGESLEDRAKMLVALSTLDPQPESVPINALVPIEGTPLEELPPVDI 242

Query: 253 IEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNK 312
            E VR+I+ ARI+MP+S++RL+AGR  MS E QALCFF+GANSIF GD LLT  NP   +
Sbjct: 243 WEMVRMIATARIVMPQSQVRLSAGRMNMSREGQALCFFAGANSIFAGDKLLTTPNPDIKE 302

Query: 313 DTILFNRLGLI 323
           D  +   LG+ 
Sbjct: 303 DMHMLEALGMR 313


>gi|254720489|ref|ZP_05182300.1| biotin synthase [Brucella sp. 83/13]
 gi|265985518|ref|ZP_06098253.1| biotin synthase [Brucella sp. 83/13]
 gi|306839647|ref|ZP_07472450.1| biotin synthase [Brucella sp. NF 2653]
 gi|264664110|gb|EEZ34371.1| biotin synthase [Brucella sp. 83/13]
 gi|306405227|gb|EFM61503.1| biotin synthase [Brucella sp. NF 2653]
          Length = 346

 Score =  305 bits (782), Expect = 4e-81,   Method: Composition-based stats.
 Identities = 201/308 (65%), Positives = 254/308 (82%)

Query: 18  VWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQSVH 77
            W+++E   IYN+PFNDLLF +H++HR+NF+PN IQLSKLLNIKTGGCPE+CGYC+QS  
Sbjct: 34  RWSAEEARAIYNLPFNDLLFRAHSLHRENFDPNRIQLSKLLNIKTGGCPEDCGYCSQSAS 93

Query: 78  NKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLGL 137
            ++ LKASKL+ ++ VL+EA+ AK  GATRYCMGAAWR PK+RD+  +  MI+ VK++GL
Sbjct: 94  AENGLKASKLMEIETVLEEARKAKAAGATRYCMGAAWRSPKDRDMPALTHMIESVKAMGL 153

Query: 138 ETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSGI 197
           ETCMTLGML  ++A+ L+ AGLDYYNHNIDTSERFYP V TT +FEDRL TL NVR +GI
Sbjct: 154 ETCMTLGMLDSDKAEKLADAGLDYYNHNIDTSERFYPAVITTRSFEDRLDTLANVRNAGI 213

Query: 198 KVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEHVR 257
           KVC GGILGLGE  +DRIDML+TLANL  PPES+PIN+LIP+PG++  +   VDP+E VR
Sbjct: 214 KVCSGGILGLGEEAEDRIDMLVTLANLPEPPESVPINMLIPMPGTRMAKAAPVDPLEFVR 273

Query: 258 IISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTILF 317
           ++++ARILMPKS +RL AGR  MSDE+QALCFF+GANS+F+GDTLLTA NP  ++D+ L 
Sbjct: 274 VVALARILMPKSHVRLTAGRTAMSDEMQALCFFAGANSLFMGDTLLTAANPGDDRDSSLL 333

Query: 318 NRLGLIPD 325
            RLG+  +
Sbjct: 334 RRLGIQAE 341


>gi|168026768|ref|XP_001765903.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|162682809|gb|EDQ69224.1| predicted protein [Physcomitrella patens subsp. patens]
          Length = 429

 Score =  305 bits (782), Expect = 4e-81,   Method: Composition-based stats.
 Identities = 149/313 (47%), Positives = 208/313 (66%), Gaps = 2/313 (0%)

Query: 14  KKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCN 73
           +    WT +E+  IY  P  DLL +   VH+       +Q   LL+IKTGGC E+C YC 
Sbjct: 92  EPRNDWTREEIQAIYESPLMDLLLYGAQVHKHTHTWREVQQCTLLSIKTGGCSEDCSYCP 151

Query: 74  QSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKER--DLSIIVDMIKG 131
           QS    + ++A KL++ D VL+ AK AKE G++R+CMGAAWR+   R  + + I++ +K 
Sbjct: 152 QSSRYNTGVQAQKLLSEDVVLEAAKKAKEAGSSRFCMGAAWRDTVGRKTNFNQILEYVKE 211

Query: 132 VKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLEN 191
           ++++G+E C TLGML  +QA+ L  AGL  YNHN+DTS  +YP++ TT ++++RL+TLE 
Sbjct: 212 IRAMGMEVCCTLGMLEKKQAEQLKTAGLTAYNHNLDTSREYYPNIITTRSYDERLKTLEL 271

Query: 192 VRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVD 251
           VR +GI VC GGI+GLGE  +DR+ +L TLA L   PES+PIN L+ + G+  E  K V+
Sbjct: 272 VRDAGISVCSGGIIGLGEAEEDRVGLLHTLATLPEHPESVPINALLAVKGTPLENQKPVE 331

Query: 252 PIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYN 311
             E VR+I+ ARI+MPK+ +RL+AGR   S   QALCF +GANSIF G+ LLT  N   +
Sbjct: 332 VWEMVRMIATARIVMPKAMVRLSAGRVRFSQPEQALCFMAGANSIFTGEKLLTTPNNDKD 391

Query: 312 KDTILFNRLGLIP 324
            D  +F  LGLIP
Sbjct: 392 ADQQMFQTLGLIP 404


>gi|156974096|ref|YP_001445003.1| biotin synthase [Vibrio harveyi ATCC BAA-1116]
 gi|156525690|gb|ABU70776.1| hypothetical protein VIBHAR_01807 [Vibrio harveyi ATCC BAA-1116]
          Length = 356

 Score =  305 bits (782), Expect = 4e-81,   Method: Composition-based stats.
 Identities = 162/311 (52%), Positives = 229/311 (73%)

Query: 13  TKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYC 72
            +    WT  EV  +   PF DLLF +  VHR+  + N++Q+S LL+IKTG CPE+C YC
Sbjct: 7   VEVRHNWTHAEVRDLMEKPFMDLLFEAQLVHRQYQQTNYVQVSTLLSIKTGACPEDCKYC 66

Query: 73  NQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGV 132
            QS    + ++  +L+ V++VL  A+ AK  G+TR+CMGAAW+ PKERD+  + DMIKGV
Sbjct: 67  PQSARYTTDIEKERLMEVERVLDAAQKAKNAGSTRFCMGAAWKNPKERDMPHLTDMIKGV 126

Query: 133 KSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENV 192
           K +GLETCMTLGML+ +QA+ L+ AGLDYYNHN+DTS  FY ++ TT T++DRL TL +V
Sbjct: 127 KGMGLETCMTLGMLTPDQAKQLATAGLDYYNHNLDTSPEFYGNIITTRTYQDRLDTLSHV 186

Query: 193 RKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDP 252
           R +G+K+C GGI+G+GE  +DR  +L+ LANL   PES+PIN+L+ + G+  EE   V+P
Sbjct: 187 RDAGMKICSGGIIGMGESANDRAGLLVELANLPVHPESVPINMLVKVKGTPLEEVDDVEP 246

Query: 253 IEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNK 312
            + +R+I++ARI+MP+S +RL+AGR  M++++QALCF +GANS+F G  LLT  NPS +K
Sbjct: 247 FDFIRLIAIARIMMPQSAVRLSAGRENMNEQMQALCFMAGANSVFYGCKLLTTPNPSEDK 306

Query: 313 DTILFNRLGLI 323
           D +LFN+LG+ 
Sbjct: 307 DMMLFNKLGIN 317


>gi|254230179|ref|ZP_04923573.1| biotin synthase [Vibrio sp. Ex25]
 gi|151937317|gb|EDN56181.1| biotin synthase [Vibrio sp. Ex25]
          Length = 356

 Score =  305 bits (782), Expect = 4e-81,   Method: Composition-based stats.
 Identities = 162/311 (52%), Positives = 229/311 (73%)

Query: 13  TKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYC 72
            +    WT  EV  +   PF DLLF +  VHR+  + NH+Q+S LL+IKTG CPE+C YC
Sbjct: 7   VEVRHNWTHAEVRDLMEKPFMDLLFEAQLVHRQYQQTNHVQVSTLLSIKTGACPEDCKYC 66

Query: 73  NQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGV 132
            QS    + ++  +L+ V++VL  A+ AK  G+TR+CMGAAW+ PKERD+  + DMIKGV
Sbjct: 67  PQSARYTTDIEKERLMEVERVLDAAQKAKNAGSTRFCMGAAWKNPKERDMPHLTDMIKGV 126

Query: 133 KSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENV 192
           K +GLETCMTLGML+ +QA+ L+ AGLDYYNHN+DTS  FY ++ TT T++DRL TL +V
Sbjct: 127 KGMGLETCMTLGMLTPDQAKQLATAGLDYYNHNLDTSPEFYGNIITTRTYQDRLDTLSHV 186

Query: 193 RKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDP 252
           R +G+K+C GGI+G+GE  +DR  +L+ LANL   PES+PIN+L+ + G+  EE   V+P
Sbjct: 187 RDAGMKICSGGIIGMGESANDRAGLLVELANLPVHPESVPINMLVKVKGTPLEEVDDVEP 246

Query: 253 IEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNK 312
            + +R+I++ARI+MP+S +RL+AGR  M++++QALCF +GANS+F G  LLT  NPS +K
Sbjct: 247 FDFIRLIAIARIMMPQSAVRLSAGRENMNEQMQALCFMAGANSVFYGCKLLTTPNPSEDK 306

Query: 313 DTILFNRLGLI 323
           D +LF++LG+ 
Sbjct: 307 DMMLFDKLGIN 317


>gi|261856679|ref|YP_003263962.1| biotin synthase [Halothiobacillus neapolitanus c2]
 gi|261837148|gb|ACX96915.1| biotin synthase [Halothiobacillus neapolitanus c2]
          Length = 347

 Score =  305 bits (782), Expect = 5e-81,   Method: Composition-based stats.
 Identities = 166/310 (53%), Positives = 222/310 (71%)

Query: 19  WTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQSVHN 78
           W   +V  ++++PFNDL+F +H  HR +F+ N +Q+S LL+IKTG CPE+C YC+QS   
Sbjct: 8   WELTQVLALFDLPFNDLMFRAHETHRAHFDANAVQISTLLSIKTGACPEDCSYCSQSSKY 67

Query: 79  KSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLGLE 138
            + L+  +L+ + +V + A  A+E GATR+CMGAAWR P ++ L  +++M+  VK LG+E
Sbjct: 68  DTGLERERLLPLSEVRESALRAREAGATRFCMGAAWRNPTDKQLENVINMVGVVKELGME 127

Query: 139 TCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSGIK 198
            C+TLGML+  QA  L +AGLDYYNHNIDTS  FY  V TT  F+DRL TLE+VR+SGI 
Sbjct: 128 ACVTLGMLTAPQAGRLKEAGLDYYNHNIDTSPEFYGEVITTRNFQDRLDTLEHVRESGIN 187

Query: 199 VCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEHVRI 258
           VC GGILG+GE  +DR   L TLANL   PES+P+N+L+ IPG+   +   +DPIE +R 
Sbjct: 188 VCSGGILGMGESREDRASFLATLANLPRAPESVPLNMLVRIPGTPMADIPTLDPIEFIRT 247

Query: 259 ISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTILFN 318
           ++VARILMP S +RL+AGR  MSDE QA CFF+GANSIF GD LLT  N   N+D  LF+
Sbjct: 248 VAVARILMPTSHVRLSAGREGMSDEAQAWCFFAGANSIFYGDKLLTTDNADQNRDRDLFD 307

Query: 319 RLGLIPDLSA 328
           +LG+ P + A
Sbjct: 308 KLGIHPLIPA 317


>gi|167585271|ref|ZP_02377659.1| biotin synthase [Burkholderia ubonensis Bu]
          Length = 324

 Score =  305 bits (782), Expect = 5e-81,   Method: Composition-based stats.
 Identities = 168/312 (53%), Positives = 225/312 (72%)

Query: 12  PTKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGY 71
                + W   +V  ++ +PFNDL+F +  VHR++F+ N +QLS LL+IKTGGC E+CGY
Sbjct: 2   AAPAAQRWRVADVVALFELPFNDLMFRAQQVHREHFDANAVQLSTLLSIKTGGCEEDCGY 61

Query: 72  CNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKG 131
           C+QS H+ + LKA KL++VD VL  A+ AK NGA+R+CMGAAWR PKER +  + +M++G
Sbjct: 62  CSQSSHHDTGLKAEKLMDVDAVLDAARAAKANGASRFCMGAAWRNPKERHMPALTEMVRG 121

Query: 132 VKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLEN 191
           VK +GLETCMTLGML  EQA+ L+ AGLDYYNHN+DTS  FY  + +T T++DRL TL+ 
Sbjct: 122 VKEMGLETCMTLGMLEDEQAKALADAGLDYYNHNLDTSPEFYGQIISTRTYQDRLDTLDR 181

Query: 192 VRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVD 251
           VR +GI VCCGGI+G+GE   +R  ++  LANL+  P+S+PIN L+ I G+  E    +D
Sbjct: 182 VRDAGINVCCGGIIGMGESRRERAGLITQLANLNPYPDSVPINNLVAIEGTPLEGTAALD 241

Query: 252 PIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYN 311
           P E VR I+VARI MPK+ +RL+AGR  + D LQA+CF +GANS+F GD LLT  NP   
Sbjct: 242 PFEFVRTIAVARITMPKAVVRLSAGREQLDDGLQAMCFLAGANSMFYGDQLLTTSNPQTQ 301

Query: 312 KDTILFNRLGLI 323
           +D  LF RLG+ 
Sbjct: 302 RDRALFERLGIR 313


>gi|251792311|ref|YP_003007036.1| biotin synthase [Aggregatibacter aphrophilus NJ8700]
 gi|247533703|gb|ACS96949.1| biotin synthase [Aggregatibacter aphrophilus NJ8700]
          Length = 334

 Score =  305 bits (781), Expect = 5e-81,   Method: Composition-based stats.
 Identities = 155/325 (47%), Positives = 221/325 (68%)

Query: 1   MSRSTVVPEENPTKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNI 60
           +S +  +    P    + W+  +V  ++  PF DL++ +  VHRKNF P  IQLS L++I
Sbjct: 2   LSSTLQIYSITPHPSVEYWSVCKVEALFETPFLDLVYRAAQVHRKNFNPRAIQLSTLMSI 61

Query: 61  KTGGCPENCGYCNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKER 120
           KTGGCPE+CGYC QS   ++ ++  +L++V++++ +AK AK  GA R+CMGAAWR PK +
Sbjct: 62  KTGGCPEDCGYCPQSARYQTGVQNQQLLDVEEIVAKAKIAKARGAGRFCMGAAWRGPKPK 121

Query: 121 DLSIIVDMIKGVKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTH 180
           D++ + ++IK VKSLG+ETC T G+L    A+ L  AGLDYYNHN+DT+   Y  V  T 
Sbjct: 122 DIAKVTEIIKAVKSLGMETCGTFGLLQDGMAEELKDAGLDYYNHNLDTAPEHYSEVIGTR 181

Query: 181 TFEDRLQTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIP 240
            F+DR+ TL  VRK+G+KVCCGGI+G+ E   +R  ++ +LANL   PES+PIN L+ I 
Sbjct: 182 RFDDRISTLGKVRKAGLKVCCGGIVGMNETRKERAGLIASLANLDPQPESVPINQLVKIE 241

Query: 241 GSKFEENKKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGD 300
           G+   + +++D  E VR I+VARI MP S +RL+AGR  MS+E+QA+CF +GANSIF GD
Sbjct: 242 GTPLADAEELDWTEFVRTIAVARITMPNSYVRLSAGRQGMSEEMQAMCFMAGANSIFYGD 301

Query: 301 TLLTAKNPSYNKDTILFNRLGLIPD 325
            LL   NP  + D +L  +L L P+
Sbjct: 302 KLLVTGNPEEDGDRLLMEKLDLEPE 326


>gi|329847505|ref|ZP_08262533.1| biotin synthase [Asticcacaulis biprosthecum C19]
 gi|328842568|gb|EGF92137.1| biotin synthase [Asticcacaulis biprosthecum C19]
          Length = 317

 Score =  305 bits (781), Expect = 5e-81,   Method: Composition-based stats.
 Identities = 166/314 (52%), Positives = 222/314 (70%), Gaps = 4/314 (1%)

Query: 16  PKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQS 75
            ++W  +E+ +++++PF DL+  +  VHR +F  N +QLS+LL++KTGGC ENCGYC+QS
Sbjct: 2   RQLWDKEEIAELFDLPFMDLVLRAAEVHRYHFPANEVQLSQLLSVKTGGCAENCGYCSQS 61

Query: 76  VHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSL 135
            H  + LKAS+L+ VD VL EA+ AK++GA R+CMGAAWR+ K+RD+  +  MI GVK++
Sbjct: 62  AHFDTGLKASRLMAVDTVLAEAQKAKDSGAQRFCMGAAWRDLKDRDVPALAAMIGGVKAM 121

Query: 136 GLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKS 195
           GLETC TLGML  +QA  L  AGLDYYNHN+DTS  +Y  V TT T+++RL TL+ V  +
Sbjct: 122 GLETCATLGMLRPDQAVALKDAGLDYYNHNLDTSPEYYDQVVTTRTYQERLDTLQAVSDA 181

Query: 196 GIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEE----NKKVD 251
           G+K CCGGI+G+GE   DR+  L  LA L  PP+SIPIN L+ I G+   +       + 
Sbjct: 182 GMKTCCGGIMGMGESRADRVSFLHQLAELPVPPDSIPINNLVAIAGTPLGDKVGREGGIS 241

Query: 252 PIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYN 311
            IE VR I+ ARI+ P+S +RL+AGR+ MS+ELQALCF +GANSIFVGDTLLT  NP   
Sbjct: 242 GIEFVRTIAAARIVCPRSMVRLSAGRSEMSEELQALCFLAGANSIFVGDTLLTTPNPQPG 301

Query: 312 KDTILFNRLGLIPD 325
            D  +   LGL P 
Sbjct: 302 TDAHMMRELGLRPM 315


>gi|30250227|ref|NP_842297.1| biotin synthase [Nitrosomonas europaea ATCC 19718]
 gi|30181022|emb|CAD86212.1| Biotin synthase [Nitrosomonas europaea ATCC 19718]
          Length = 339

 Score =  305 bits (781), Expect = 5e-81,   Method: Composition-based stats.
 Identities = 150/306 (49%), Positives = 209/306 (68%)

Query: 18  VWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQSVH 77
            W+   +  + ++PF+DL+F + TVHR+  + N +QLS L+++KTGGC E+C YC Q+  
Sbjct: 32  RWSIAAIESLLDLPFSDLIFQAQTVHRQYHDANAVQLSTLISVKTGGCSEDCAYCPQAAR 91

Query: 78  NKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLGL 137
             + ++   +++ ++V+  A  AKE+GATR+CMGAAWR PK+RD+  + ++I  VK+LG+
Sbjct: 92  YHTGVENQAILSREEVVAAATQAKESGATRFCMGAAWRGPKQRDIEYMTEVISAVKALGM 151

Query: 138 ETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSGI 197
           ETC TLG+L   QA  L +AGLDYYNHN+DT+  FY  + TT  ++DRL TLE VR + I
Sbjct: 152 ETCATLGILKPGQATQLKQAGLDYYNHNLDTAPEFYGEIITTREYQDRLDTLEEVRGANI 211

Query: 198 KVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEHVR 257
            VCCGGI+GLGE    R  ++  LANL   PES+PIN L+ + G+      ++DP E VR
Sbjct: 212 NVCCGGIVGLGESRMARAGLIAQLANLDPYPESVPINYLVQVEGTPLYGTPELDPFEFVR 271

Query: 258 IISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTILF 317
            I+ ARI MPK+ +RL+AGR  M + +QALCF +GANSIF GD LLT  NP   KD  LF
Sbjct: 272 TIAAARITMPKAMVRLSAGRRQMPEAIQALCFLAGANSIFYGDKLLTTGNPDTEKDLALF 331

Query: 318 NRLGLI 323
            +LGL 
Sbjct: 332 EKLGLH 337


>gi|113461153|ref|YP_719221.1| biotin synthase [Haemophilus somnus 129PT]
 gi|123327259|sp|Q0I355|BIOB_HAES1 RecName: Full=Biotin synthase
 gi|112823196|gb|ABI25285.1| biotin synthase [Haemophilus somnus 129PT]
          Length = 331

 Score =  305 bits (781), Expect = 6e-81,   Method: Composition-based stats.
 Identities = 154/319 (48%), Positives = 217/319 (68%)

Query: 7   VPEENPTKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCP 66
           +P   P    + W+  +V  ++  PF +L++ +  VHRK+F P  IQLS L++IKTGGCP
Sbjct: 8   IPSLTPHPCVEYWSVCKVEALFETPFLELVYQAAQVHRKHFNPQTIQLSTLMSIKTGGCP 67

Query: 67  ENCGYCNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIV 126
           E+C YC QS    + ++  +L+ V++++++AK AK  GA R+CMGAAWR PK +D+  I 
Sbjct: 68  EDCSYCPQSARYHTGVQNQQLLCVEEIVEKAKIAKSRGAGRFCMGAAWRGPKPKDIEKIT 127

Query: 127 DMIKGVKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRL 186
           ++IK VK LGLETC T G+L    A+ L +AGLDYYNHNIDT+   Y  +  T  F+DRL
Sbjct: 128 EIIKAVKDLGLETCGTFGLLQDGMAEELKEAGLDYYNHNIDTAPEHYKEIIGTRDFDDRL 187

Query: 187 QTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEE 246
            TL  VRK+G+KVCCGGI+G+ E   +R  ++ +LANL   PES+PIN L+ + G+   +
Sbjct: 188 NTLGKVRKAGLKVCCGGIVGMNETRKERAGLIASLANLDPQPESVPINQLVKVEGTPLAD 247

Query: 247 NKKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAK 306
            +++D  E VR I+VARI MPKS +RL+AGR  MS+E+QA+CF +GANSIF GD LL   
Sbjct: 248 AQELDWTEFVRTIAVARITMPKSYVRLSAGRQGMSEEMQAMCFMAGANSIFYGDKLLVTV 307

Query: 307 NPSYNKDTILFNRLGLIPD 325
           NP  + D +L  +L L P+
Sbjct: 308 NPEEDGDQLLMAKLDLKPE 326


>gi|124009722|ref|ZP_01694393.1| biotin synthase [Microscilla marina ATCC 23134]
 gi|123984326|gb|EAY24670.1| biotin synthase [Microscilla marina ATCC 23134]
          Length = 334

 Score =  305 bits (781), Expect = 6e-81,   Method: Composition-based stats.
 Identities = 151/312 (48%), Positives = 211/312 (67%), Gaps = 1/312 (0%)

Query: 17  KVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQSV 76
             WT  E+  IYN P  DL+F + ++HR+N +   +Q+S L++IKTGGCPE+C YC Q+ 
Sbjct: 4   HDWTLAEIEAIYNKPLLDLMFEAASIHRQNKDYAEVQISSLISIKTGGCPEDCAYCPQAA 63

Query: 77  HNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKE-RDLSIIVDMIKGVKSL 135
              + +   KL+ ++ V+  AK AK+ G++R CMGAAWRE ++ RD   +++M+K V  +
Sbjct: 64  RYSTDVDVHKLMPLETVVNMAKEAKDAGSSRVCMGAAWREVRDNRDFDRVLEMVKAVNDM 123

Query: 136 GLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKS 195
            +E C TLGML+  QAQ L+ AGL  YNHN+DTSE +Y  V TT T++DRL T+ N R++
Sbjct: 124 DMEVCCTLGMLNANQAQKLADAGLYAYNHNVDTSEEYYSEVITTRTYKDRLNTINNAREA 183

Query: 196 GIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEH 255
           G+ VC GGI+GLGE   DR+ ML  L+NL   P+S+PIN L+ I G+  E+  KV   + 
Sbjct: 184 GLTVCSGGIVGLGETDKDRVGMLKVLSNLHPHPDSVPINALVRIEGTPLEDQPKVPIQDM 243

Query: 256 VRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTI 315
           VR+I+ ARILMPK+ +RL+AGR  MS   QA+CF +GANSIF GD LLT  NP +  D  
Sbjct: 244 VRMIATARILMPKTVVRLSAGRTEMSLSEQAMCFMAGANSIFAGDKLLTTPNPDFKDDME 303

Query: 316 LFNRLGLIPDLS 327
           +F+ LGL P  +
Sbjct: 304 MFDILGLAPREA 315


>gi|16127751|ref|NP_422315.1| biotin synthase [Caulobacter crescentus CB15]
 gi|221236572|ref|YP_002519009.1| biotin synthase [Caulobacter crescentus NA1000]
 gi|81620912|sp|Q9A2N5|BIOB_CAUCR RecName: Full=Biotin synthase
 gi|254810595|sp|B8H640|BIOB_CAUCN RecName: Full=Biotin synthase
 gi|13425251|gb|AAK25483.1| biotin synthase [Caulobacter crescentus CB15]
 gi|220965745|gb|ACL97101.1| biotin synthase [Caulobacter crescentus NA1000]
          Length = 341

 Score =  305 bits (781), Expect = 6e-81,   Method: Composition-based stats.
 Identities = 169/321 (52%), Positives = 222/321 (69%), Gaps = 5/321 (1%)

Query: 13  TKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYC 72
                 WT  EV  ++ +PF +L+F +  VHR +F+P+ IQLS+LL++KTGGC ENCGYC
Sbjct: 6   ASPRHDWTLAEVEALFALPFMELVFQAANVHRAHFDPSEIQLSQLLSVKTGGCAENCGYC 65

Query: 73  NQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGV 132
           +QS H K+ LKA KL+  D V+ +A+ A++ GA R+CMGAAWRE K+RDL  + +MI  V
Sbjct: 66  SQSAHFKTGLKADKLMAADDVVAKARAARDGGAQRFCMGAAWRELKDRDLPKLTEMIGEV 125

Query: 133 KSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENV 192
           K+LGLETC TLGML+ +QA+ L  AGLDYYNHN+DT   +Y  V TT T+++RL TL +V
Sbjct: 126 KALGLETCATLGMLTADQAKALKAAGLDYYNHNLDTGPDYYKDVVTTRTYQERLDTLAHV 185

Query: 193 RKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEEN----- 247
           R +G+  CCGGI+G+GE   DR  +L  LA L   P+S+PIN L+PI G+   +      
Sbjct: 186 RDAGMSTCCGGIVGMGEQRRDRAGLLHQLATLPAHPDSLPINGLVPISGTPLGDKVLSEG 245

Query: 248 KKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKN 307
           K +D IE VR I+VARI+ PKS +RL+AGR  MS ELQALCF +GANSIFVG  LLT   
Sbjct: 246 KAIDAIEFVRTIAVARIVCPKSMVRLSAGREGMSRELQALCFMAGANSIFVGGKLLTTPL 305

Query: 308 PSYNKDTILFNRLGLIPDLSA 328
           P  ++D+ LF  L L P   A
Sbjct: 306 PGQDEDSQLFQDLDLKPMGGA 326


>gi|269467894|gb|EEZ79633.1| biotin synthase [uncultured SUP05 cluster bacterium]
          Length = 317

 Score =  305 bits (781), Expect = 6e-81,   Method: Composition-based stats.
 Identities = 171/311 (54%), Positives = 235/311 (75%)

Query: 13  TKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYC 72
           T+    W  +E+  +++MPFNDLLF +H++HR+NF+PN +Q+S LLNIKTG CPE+C YC
Sbjct: 2   TQLRHDWKLEEIENLFSMPFNDLLFKAHSIHRENFDPNKVQVSSLLNIKTGACPEDCSYC 61

Query: 73  NQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGV 132
           +QS  + S L+   L+ ++QV+  AK AKE G+ R+CMGAAWR P ++ L ++++MIK V
Sbjct: 62  SQSSKHDSGLERESLMQLNQVISAAKKAKELGSERFCMGAAWRNPTDKSLDLVIEMIKEV 121

Query: 133 KSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENV 192
           K LG+E+C+TLGML+ +QA+ L KAGLDYYNHNIDTS+  Y +V TT  F+DRL T+++V
Sbjct: 122 KGLGMESCVTLGMLTDKQAERLKKAGLDYYNHNIDTSKEHYSNVITTREFQDRLDTIDHV 181

Query: 193 RKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDP 252
           +K+GI VC GGILGLGE ++DR  ML TLAN++  P S+PINLL+PIPG+ FE   +   
Sbjct: 182 QKAGINVCSGGILGLGESVEDRASMLQTLANMAVHPNSVPINLLVPIPGTPFESMDRPSE 241

Query: 253 IEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNK 312
           ++ VR I+VARILMPKS +RL+AGR  MS+ +QA+CFF+GANS+F GD LLT  N + + 
Sbjct: 242 VDFVRSIAVARILMPKSVVRLSAGRNDMSESMQAMCFFAGANSVFYGDELLTTPNVTQST 301

Query: 313 DTILFNRLGLI 323
           D  LF  LG+ 
Sbjct: 302 DEALFKGLGIN 312


>gi|28897887|ref|NP_797492.1| biotin synthase [Vibrio parahaemolyticus RIMD 2210633]
 gi|153838273|ref|ZP_01990940.1| biotin synthase [Vibrio parahaemolyticus AQ3810]
 gi|260364477|ref|ZP_05777102.1| biotin synthase [Vibrio parahaemolyticus K5030]
 gi|260877046|ref|ZP_05889401.1| biotin synthase [Vibrio parahaemolyticus AN-5034]
 gi|260896835|ref|ZP_05905331.1| biotin synthase [Vibrio parahaemolyticus Peru-466]
 gi|260902442|ref|ZP_05910837.1| biotin synthase [Vibrio parahaemolyticus AQ4037]
 gi|81728054|sp|Q87QN6|BIOB_VIBPA RecName: Full=Biotin synthase
 gi|28806100|dbj|BAC59376.1| biotin synthase [Vibrio parahaemolyticus RIMD 2210633]
 gi|149748328|gb|EDM59187.1| biotin synthase [Vibrio parahaemolyticus AQ3810]
 gi|308087021|gb|EFO36716.1| biotin synthase [Vibrio parahaemolyticus Peru-466]
 gi|308093885|gb|EFO43580.1| biotin synthase [Vibrio parahaemolyticus AN-5034]
 gi|308110669|gb|EFO48209.1| biotin synthase [Vibrio parahaemolyticus AQ4037]
 gi|308114607|gb|EFO52147.1| biotin synthase [Vibrio parahaemolyticus K5030]
          Length = 350

 Score =  305 bits (781), Expect = 6e-81,   Method: Composition-based stats.
 Identities = 164/308 (53%), Positives = 227/308 (73%)

Query: 16  PKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQS 75
              WT  EV  +   PF DLLF +  VHR+  + NH+Q+S LL+IKTG CPE+C YC QS
Sbjct: 4   RHNWTHAEVRDLMEKPFMDLLFEAQLVHRQYQQTNHVQVSTLLSIKTGACPEDCKYCPQS 63

Query: 76  VHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSL 135
               + ++  +L+ V++VL  A+ AK  G+TR+CMGAAW+ PKERD+  + DMIKGVK +
Sbjct: 64  ARYTTDIEKERLMEVERVLDAAQKAKNAGSTRFCMGAAWKNPKERDMPHLTDMIKGVKDM 123

Query: 136 GLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKS 195
           GLETCMTLGML+ EQA+ L+ AGLDYYNHN+DTS  FY ++ TT T++DRL TL +VR +
Sbjct: 124 GLETCMTLGMLTPEQAKQLANAGLDYYNHNLDTSPEFYGNIITTRTYQDRLDTLSHVRDA 183

Query: 196 GIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEH 255
           G+K+C GGI+G+GE  +DR  +L+ LANL T PES+PIN+L+ + G+  E    VDP + 
Sbjct: 184 GMKICSGGIIGMGESANDRAGLLVELANLPTHPESVPINMLVKVKGTPLETVDDVDPFDF 243

Query: 256 VRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTI 315
           +R+I++ARI+MP+S +RL+AGR  M++++QALCF +GANS+F G  LLT  NPS +KD +
Sbjct: 244 IRLIAIARIMMPQSAVRLSAGRENMNEQMQALCFMAGANSVFYGCKLLTTPNPSEDKDMM 303

Query: 316 LFNRLGLI 323
           LF +LG+ 
Sbjct: 304 LFKKLGIN 311


>gi|90424727|ref|YP_533097.1| biotin synthase [Rhodopseudomonas palustris BisB18]
 gi|122995413|sp|Q212A8|BIOB_RHOPB RecName: Full=Biotin synthase
 gi|90106741|gb|ABD88778.1| biotin synthase [Rhodopseudomonas palustris BisB18]
          Length = 356

 Score =  305 bits (781), Expect = 6e-81,   Method: Composition-based stats.
 Identities = 188/311 (60%), Positives = 235/311 (75%), Gaps = 1/311 (0%)

Query: 16  PKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQS 75
              WT +E   IY  PF DL+F + T+HR++F+PN +Q ++LLN+KTGGC E+CGYC QS
Sbjct: 17  RHDWTREEAAAIYYAPFMDLMFRAATIHRQSFDPNKVQCNQLLNVKTGGCAEDCGYCGQS 76

Query: 76  VHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSL 135
            H+ + L ASKL+    V++ AK AK  GATRYCMGAAWR PK+RD++ +++M+KGVK+L
Sbjct: 77  AHHHTDLPASKLMAPADVIESAKAAKAGGATRYCMGAAWRSPKDRDMAPVIEMVKGVKAL 136

Query: 136 GLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKS 195
           G+E C+TLGMLS +QA+ L+ AGLDYYNHN+DTSE FYP V  T T+ DRL TL  V+ +
Sbjct: 137 GMEACVTLGMLSDDQAKQLADAGLDYYNHNLDTSEEFYPSVVKTRTYGDRLNTLHKVQDA 196

Query: 196 GIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFE-ENKKVDPIE 254
           GIKVCCGGILGLGE   DR++ML TLANL+  PES+PINLLIPI G+        VDPI 
Sbjct: 197 GIKVCCGGILGLGEKPTDRVEMLRTLANLAKHPESVPINLLIPIEGTPISLTATPVDPIA 256

Query: 255 HVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDT 314
            VR I++ARI+MP S +RLAAGR  MSDE+Q LCF +GANSIF+GDTLLT  NP  NKD 
Sbjct: 257 FVRTIALARIMMPLSDVRLAAGRTAMSDEMQTLCFLAGANSIFIGDTLLTTPNPGDNKDR 316

Query: 315 ILFNRLGLIPD 325
            LF+RLGL P 
Sbjct: 317 SLFDRLGLEPR 327


>gi|260430751|ref|ZP_05784723.1| biotin synthase [Silicibacter lacuscaerulensis ITI-1157]
 gi|260418192|gb|EEX11450.1| biotin synthase [Silicibacter lacuscaerulensis ITI-1157]
          Length = 326

 Score =  305 bits (781), Expect = 6e-81,   Method: Composition-based stats.
 Identities = 193/309 (62%), Positives = 246/309 (79%)

Query: 19  WTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQSVHN 78
           WT K    IY++P  DLL+ + TVHR+NF+PN +Q+S+LL+IKTGGC E+C YC+QS  N
Sbjct: 8   WTRKTAQAIYDLPLMDLLYRAQTVHRENFDPNKVQMSRLLSIKTGGCAEDCAYCSQSARN 67

Query: 79  KSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLGLE 138
            SKL ASKLI V++VL EA+ A+E+G+TR+CMGAAWREPK RD+  +V MI+GVK +G+E
Sbjct: 68  GSKLSASKLIEVERVLAEARKARESGSTRFCMGAAWREPKARDMDALVAMIQGVKEMGME 127

Query: 139 TCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSGIK 198
           TCMTLGML   Q   L  AGLDYYNHNIDTSER+YP V TT TF DR+ TL  VR++G+K
Sbjct: 128 TCMTLGMLDDTQVVQLRDAGLDYYNHNIDTSERYYPEVITTRTFADRIDTLNRVREAGMK 187

Query: 199 VCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEHVRI 258
           VC GGILG+GE  +DRIDML+TLANL  PP+S+PIN+L+P   +   + K VDPI+ VRI
Sbjct: 188 VCSGGILGMGENGEDRIDMLVTLANLPEPPDSVPINMLMPQADTPLADAKPVDPIDFVRI 247

Query: 259 ISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTILFN 318
           I++ARI+MPKS +RL+AGR+ MSDE+QA+CFF+GANSIF GDTLLTA+NP  +KD ILF 
Sbjct: 248 IALARIMMPKSHVRLSAGRSDMSDEMQAMCFFAGANSIFAGDTLLTAENPEESKDAILFA 307

Query: 319 RLGLIPDLS 327
           +LG+ P  +
Sbjct: 308 KLGIQPMEA 316


>gi|261867840|ref|YP_003255762.1| biotin synthase [Aggregatibacter actinomycetemcomitans D11S-1]
 gi|293392020|ref|ZP_06636354.1| biotin synthase [Aggregatibacter actinomycetemcomitans D7S-1]
 gi|261413172|gb|ACX82543.1| biotin synthase [Aggregatibacter actinomycetemcomitans D11S-1]
 gi|290952554|gb|EFE02673.1| biotin synthase [Aggregatibacter actinomycetemcomitans D7S-1]
          Length = 334

 Score =  305 bits (781), Expect = 6e-81,   Method: Composition-based stats.
 Identities = 152/325 (46%), Positives = 221/325 (68%)

Query: 1   MSRSTVVPEENPTKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNI 60
           ++ +  +    P    + W+  +V  ++  PF DL++ +  VHR+NF P  IQLS L++I
Sbjct: 2   LTSTLQIYSITPHPSVEYWSVCKVEALFETPFLDLVYRAAQVHRQNFNPRAIQLSTLMSI 61

Query: 61  KTGGCPENCGYCNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKER 120
           KTGGCPE+CGYC QS   ++ ++  +L++V++++ +AK AK  GA R+CMGAAWR PK +
Sbjct: 62  KTGGCPEDCGYCPQSARYQTGVQNQQLLDVEEIVAKAKIAKARGAGRFCMGAAWRGPKPK 121

Query: 121 DLSIIVDMIKGVKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTH 180
           D++ + ++IK VK+LG+ETC T G+L    A+ L  AGLDYYNHN+DT+   Y  V  T 
Sbjct: 122 DIAKVTEIIKAVKALGMETCGTFGLLQDGMAEELKDAGLDYYNHNLDTAPEHYSEVIGTR 181

Query: 181 TFEDRLQTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIP 240
            F+DR+ TL  VRK+G+KVCCGGI+G+ E   +R  ++ +LANL   PES+PIN L+ I 
Sbjct: 182 RFDDRISTLGKVRKAGLKVCCGGIVGMNETRKERAGLIASLANLDPQPESVPINQLVKIE 241

Query: 241 GSKFEENKKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGD 300
           G+   + +++D  E VR I+VARI MP S +RL+AGR  MS+E+QA+CF +GANSIF GD
Sbjct: 242 GTPLADAEELDWTEFVRTIAVARITMPNSYVRLSAGRQGMSEEMQAMCFMAGANSIFYGD 301

Query: 301 TLLTAKNPSYNKDTILFNRLGLIPD 325
            LL   NP  + D +L  +L L P+
Sbjct: 302 KLLVTGNPEEDGDRLLMEKLDLEPE 326


>gi|163801969|ref|ZP_02195865.1| 8-amino-7-oxononanoate synthase [Vibrio sp. AND4]
 gi|159174110|gb|EDP58918.1| 8-amino-7-oxononanoate synthase [Vibrio sp. AND4]
          Length = 350

 Score =  305 bits (780), Expect = 7e-81,   Method: Composition-based stats.
 Identities = 163/308 (52%), Positives = 226/308 (73%)

Query: 16  PKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQS 75
              WT  EV  +   PF DLLF +  VHR+  +PNH+Q+S LL+IKTG CPE+C YC QS
Sbjct: 4   RHNWTHAEVRGLMEKPFMDLLFEAQLVHRQYQQPNHVQVSTLLSIKTGACPEDCKYCPQS 63

Query: 76  VHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSL 135
               + ++  +L+ V++VL  A+ AK  G+TR+CMGAAW+ PKERD+  + DMIKGVK +
Sbjct: 64  ARYTTDIEKERLMEVERVLDAAQKAKNAGSTRFCMGAAWKNPKERDMPHLTDMIKGVKDM 123

Query: 136 GLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKS 195
           GLETCMTLGML+ EQA  L+ AGLDYYNHN+DTS  FY ++ TT T++DRL TL +VR +
Sbjct: 124 GLETCMTLGMLTPEQATQLATAGLDYYNHNLDTSPEFYGNIITTRTYQDRLDTLSHVRDA 183

Query: 196 GIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEH 255
           G+K+C GGI+G+GE  +DR  + + LANL   PES+PIN+L+ + G+  EE   V+P + 
Sbjct: 184 GMKICSGGIIGMGESANDRAGLFVELANLPVHPESVPINMLVKVKGTPLEEVDDVEPFDF 243

Query: 256 VRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTI 315
           +R+I++ARI+MP+S +RL+AGR  M++++Q LCF +GANS+F G  LLT  NPS +KD +
Sbjct: 244 IRLIAIARIMMPRSAVRLSAGRENMNEQMQTLCFMAGANSVFYGCKLLTTPNPSEDKDMM 303

Query: 316 LFNRLGLI 323
           LFN+LG+ 
Sbjct: 304 LFNKLGIN 311


>gi|306840591|ref|ZP_07473346.1| biotin synthase [Brucella sp. BO2]
 gi|306289412|gb|EFM60642.1| biotin synthase [Brucella sp. BO2]
          Length = 346

 Score =  305 bits (780), Expect = 7e-81,   Method: Composition-based stats.
 Identities = 203/308 (65%), Positives = 253/308 (82%)

Query: 18  VWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQSVH 77
            W+++E   IYN+PFNDLLF +H +HR+NF+PN IQLSKLLNIKTGGCPE+CGYC+QS  
Sbjct: 34  RWSAEEARAIYNLPFNDLLFRAHGLHRENFDPNRIQLSKLLNIKTGGCPEDCGYCSQSAS 93

Query: 78  NKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLGL 137
            ++ LKASKL+ ++ VL+EA+ AK  GATRYCMGAAWR PK+RD+  +  MI+ VK++GL
Sbjct: 94  AENGLKASKLMEIETVLEEARKAKAAGATRYCMGAAWRSPKDRDMPALTHMIESVKAMGL 153

Query: 138 ETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSGI 197
           ETCMTLGML  ++A+ L+ AGLDYYNHNIDTSERFYP V TT +FEDRL TL NVR +GI
Sbjct: 154 ETCMTLGMLDSDKAEKLADAGLDYYNHNIDTSERFYPAVITTRSFEDRLDTLANVRNAGI 213

Query: 198 KVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEHVR 257
           KVC GGILGLGE  +DRIDMLLTLANL  PPES+PIN+LIP+PG++      VDP+E +R
Sbjct: 214 KVCSGGILGLGEGAEDRIDMLLTLANLPEPPESVPINMLIPMPGTRLANAAPVDPLEFIR 273

Query: 258 IISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTILF 317
           ++++ARILMPKS +RL AGR  MSDE+QALCFF+GANS+F+GDTLLTA NPS ++DT L 
Sbjct: 274 VVALARILMPKSHVRLTAGRTAMSDEMQALCFFAGANSLFMGDTLLTAANPSDDRDTSLL 333

Query: 318 NRLGLIPD 325
            RLG+  +
Sbjct: 334 RRLGIQAE 341


>gi|293607168|ref|ZP_06689510.1| biotin synthase [Achromobacter piechaudii ATCC 43553]
 gi|292814502|gb|EFF73641.1| biotin synthase [Achromobacter piechaudii ATCC 43553]
          Length = 346

 Score =  305 bits (780), Expect = 7e-81,   Method: Composition-based stats.
 Identities = 163/322 (50%), Positives = 221/322 (68%)

Query: 7   VPEENPTKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCP 66
           VP+ +       W++ ++  +Y +PF DL+  +  VHR++F+PN +QLS LL+IKTGGCP
Sbjct: 8   VPQTSRNLAAAAWSTDDILALYALPFMDLVHRAQQVHREHFDPNAVQLSSLLSIKTGGCP 67

Query: 67  ENCGYCNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIV 126
           E+C YC QS H  + L+A KL+ +D+V+  AK A+  GA R+CMGAAWR PK   L  + 
Sbjct: 68  EDCAYCPQSSHYDTGLEADKLMPLDEVVAAAKAAQAGGAQRFCMGAAWRSPKPHHLEAVA 127

Query: 127 DMIKGVKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRL 186
           DM+  VK+LGLETC+TLGML   QA+ L  AGLDYYNHN+DTS  FY  + +T T++DRL
Sbjct: 128 DMVSAVKALGLETCVTLGMLRDGQAEQLKNAGLDYYNHNLDTSPEFYGKIISTRTYQDRL 187

Query: 187 QTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEE 246
            TLE VR +GI VCCGGI+G+GE   +R  ++  LAN+   PES+PIN L+ + G+   E
Sbjct: 188 DTLERVRDAGINVCCGGIVGMGESRRERAGLIAQLANMEPYPESVPINNLVQVEGTPLAE 247

Query: 247 NKKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAK 306
            + +DP E VR I+VARI MP++ +RL+AGR  M D +QALCF +GANS+F GD LLT  
Sbjct: 248 VEALDPFEFVRTIAVARITMPRAAVRLSAGREAMDDAMQALCFMAGANSMFYGDALLTTA 307

Query: 307 NPSYNKDTILFNRLGLIPDLSA 328
           NP    D  L  RLG+  D ++
Sbjct: 308 NPQMQADQRLLQRLGMHVDPAS 329


>gi|213963252|ref|ZP_03391509.1| biotin synthase [Capnocytophaga sputigena Capno]
 gi|213954114|gb|EEB65439.1| biotin synthase [Capnocytophaga sputigena Capno]
          Length = 377

 Score =  305 bits (780), Expect = 7e-81,   Method: Composition-based stats.
 Identities = 149/318 (46%), Positives = 219/318 (68%), Gaps = 3/318 (0%)

Query: 11  NPTKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCG 70
           N  +    WT +E+  IYN P  +LL+ + TVHRK  +PN +Q+S LL+IKTGGC E+C 
Sbjct: 11  NNAQTRHNWTKEEIVAIYNKPLMELLYEAATVHRKYHDPNSVQVSTLLSIKTGGCSEDCA 70

Query: 71  YCNQSVHNKSKLKASK--LINVDQVLKEAKNAKENGATRYCMGAAWREPKER-DLSIIVD 127
           YC QS   ++++K     +++V  V  +A  AK  GA+R CMGAAWR  K+  +   +++
Sbjct: 71  YCPQSARYETEVKIENTDMMSVTHVKAQALRAKSAGASRVCMGAAWRNVKDGPEFEQVLE 130

Query: 128 MIKGVKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQ 187
           M++ +  L +E C TLGM++  QA+ L++AGL  YNHN+DTSE +Y  + +T +++DRL+
Sbjct: 131 MVRTINKLDMEVCCTLGMITENQAKRLAEAGLYAYNHNLDTSEEYYKEIISTRSYDDRLK 190

Query: 188 TLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEEN 247
           T++NVRK+ I VC GGI+G+GE ++DR  ML+ L+ L+  PES+PIN L+P+ G+  E+ 
Sbjct: 191 TIDNVRKTNITVCSGGIIGMGESLEDRAGMLVALSTLNPQPESVPINALVPVEGTPLEDC 250

Query: 248 KKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKN 307
           + VD  E VR+++ ARI+MP+S++RL+AGR  MS E QALCFF+GANSIF GD LLT  N
Sbjct: 251 EPVDIFEMVRMVATARIVMPQSQVRLSAGRTQMSQEGQALCFFAGANSIFAGDKLLTTPN 310

Query: 308 PSYNKDTILFNRLGLIPD 325
           P  N+D  +   LG+   
Sbjct: 311 PDINEDMQMLGVLGMRIQ 328


>gi|15602244|ref|NP_245316.1| hypothetical protein PM0379 [Pasteurella multocida subsp. multocida
           str. Pm70]
 gi|81637200|sp|Q9CNP8|BIOB_PASMU RecName: Full=Biotin synthase
 gi|12720626|gb|AAK02463.1| BioB [Pasteurella multocida subsp. multocida str. Pm70]
          Length = 336

 Score =  305 bits (780), Expect = 7e-81,   Method: Composition-based stats.
 Identities = 155/327 (47%), Positives = 220/327 (67%), Gaps = 2/327 (0%)

Query: 1   MSRSTVVPEENPTKKP--KVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLL 58
           M+ +T       T  P  + W+  ++  ++  PF DL++ +  VHR+NF P  IQLS L+
Sbjct: 1   MTTATAFEIRTLTPHPTLEYWSVCKIEALFETPFLDLVYRAAQVHRENFNPKAIQLSTLM 60

Query: 59  NIKTGGCPENCGYCNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPK 118
           +IKTGGCPE+CGYC QS    + ++  +L++V++++++AK AK  GA R+CMGAAWR PK
Sbjct: 61  SIKTGGCPEDCGYCPQSARYHTGVEKQQLLDVEEIVEKAKIAKARGAGRFCMGAAWRGPK 120

Query: 119 ERDLSIIVDMIKGVKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTT 178
            +D+  +  +IK VK LGLETC T G+L    A+ L +AGLDYYNHN+DT+   Y +V  
Sbjct: 121 PKDIEKVTAIIKAVKELGLETCGTFGLLQDGMAEDLKEAGLDYYNHNLDTAPEHYGNVIG 180

Query: 179 THTFEDRLQTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIP 238
           T  F+DR+ TL  VRK+G+KVCCGGI+G+ E   +R  ++ +LANL   PES+PIN L+ 
Sbjct: 181 TRQFDDRINTLGKVRKAGLKVCCGGIIGMNETRKERAGLIASLANLDPQPESVPINQLVK 240

Query: 239 IPGSKFEENKKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFV 298
           + G+   +  ++D  E VR I+VARI MPKS +RL+AGR  MS+E+QA+CF +GANSIF 
Sbjct: 241 VEGTPLADAAELDWTEFVRTIAVARITMPKSYVRLSAGRQGMSEEMQAMCFMAGANSIFY 300

Query: 299 GDTLLTAKNPSYNKDTILFNRLGLIPD 325
           GD LL   NP  + D  L  +L L P+
Sbjct: 301 GDKLLVTGNPEEDGDQRLMAKLDLEPE 327


>gi|256820238|ref|YP_003141517.1| biotin synthase [Capnocytophaga ochracea DSM 7271]
 gi|256581821|gb|ACU92956.1| biotin synthase [Capnocytophaga ochracea DSM 7271]
          Length = 375

 Score =  305 bits (780), Expect = 8e-81,   Method: Composition-based stats.
 Identities = 149/317 (47%), Positives = 219/317 (69%), Gaps = 3/317 (0%)

Query: 12  PTKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGY 71
             +    WT +E+  IYN P  +LL+ + TVHRK  +PN +Q+S LL+IKTGGC E+C Y
Sbjct: 12  NAETRHNWTKEEIMAIYNKPLMELLYEAATVHRKYHDPNSVQVSTLLSIKTGGCSEDCAY 71

Query: 72  CNQSVHNKSK--LKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKER-DLSIIVDM 128
           C QS   +++  ++ + +++V  V  +A  AK  GA+R CMGAAWR  K+  +   +++M
Sbjct: 72  CPQSARYETEVKIENADMMSVTHVKAQALRAKSAGASRVCMGAAWRNVKDGPEFEQVLEM 131

Query: 129 IKGVKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQT 188
           ++ +  L +E C TLGML+  QAQ L++AGL  YNHN+DTSE +Y  + +T +++DRL+T
Sbjct: 132 VRTINKLDMEVCCTLGMLTENQAQRLAEAGLYAYNHNLDTSEEYYKEIISTRSYDDRLKT 191

Query: 189 LENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENK 248
           ++NVRK+ I VC GGI+G+GE ++DR  ML+ L+ L+  PES+PIN L+P+ G+  E+ +
Sbjct: 192 IDNVRKTNITVCSGGIIGMGESLEDRAGMLVALSTLNPQPESVPINALVPVEGTPLEDCE 251

Query: 249 KVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNP 308
            VD  E VR+++ ARI+MP+S++RL+AGR  MS E QALCFF+GANSIF GD LLT  NP
Sbjct: 252 PVDIFEMVRMVATARIVMPQSQVRLSAGRTQMSQEGQALCFFAGANSIFAGDKLLTTPNP 311

Query: 309 SYNKDTILFNRLGLIPD 325
             N+D  +   LG+   
Sbjct: 312 DINEDMQMLGVLGMRIQ 328


>gi|13488069|ref|NP_085663.1| biotin synthase [Mesorhizobium loti MAFF303099]
 gi|14027912|dbj|BAB54504.1| biotin synthase [Mesorhizobium loti MAFF303099]
          Length = 312

 Score =  305 bits (780), Expect = 8e-81,   Method: Composition-based stats.
 Identities = 195/305 (63%), Positives = 250/305 (81%)

Query: 19  WTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQSVHN 78
           WT  +   +++ PFN+LLF +HTVHR+NF+PN +QLS+LL+IKTGGCPE+CGYC+QS H+
Sbjct: 2   WTLDKAQALHDAPFNNLLFLAHTVHRQNFDPNKVQLSRLLSIKTGGCPEDCGYCSQSAHH 61

Query: 79  KSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLGLE 138
           ++ LKASKL+ V +V+ EA  A++ GATRYCMGAAWR PK RD+  +V M++GVK+LG+E
Sbjct: 62  ETGLKASKLMEVRRVIAEATKARDAGATRYCMGAAWRNPKPRDMDAVVAMVEGVKALGME 121

Query: 139 TCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSGIK 198
           TCMTLGML   QAQ L +AGLDYYNHNIDTSER+Y  + +T +F DRL TLE VR+SGIK
Sbjct: 122 TCMTLGMLDLGQAQQLKQAGLDYYNHNIDTSERYYSEIISTRSFADRLDTLEQVRQSGIK 181

Query: 199 VCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEHVRI 258
           VCCGGI+G+GE   DRIDML+TLANL   P+S+PIN+LIPI G+   E + ++PIE VR+
Sbjct: 182 VCCGGIVGMGEEPVDRIDMLVTLANLPEHPQSVPINMLIPIEGTPLAETRPIEPIEFVRV 241

Query: 259 ISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTILFN 318
           I++ARI+MPKS +RL+AGR  M+DE+QALCFF+GANSIFVGDTLLTA NP  ++DT LF 
Sbjct: 242 IALARIMMPKSHVRLSAGRTAMTDEMQALCFFAGANSIFVGDTLLTADNPGEDEDTALFR 301

Query: 319 RLGLI 323
           RLG+ 
Sbjct: 302 RLGIQ 306


>gi|315225664|ref|ZP_07867472.1| biotin synthase [Capnocytophaga ochracea F0287]
 gi|314944391|gb|EFS96432.1| biotin synthase [Capnocytophaga ochracea F0287]
          Length = 375

 Score =  305 bits (780), Expect = 8e-81,   Method: Composition-based stats.
 Identities = 148/317 (46%), Positives = 219/317 (69%), Gaps = 3/317 (0%)

Query: 12  PTKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGY 71
             +    WT +E+  IYN P  +LL+ + TVHRK  +PN +Q+S LL+IKTGGC E+C Y
Sbjct: 12  NAETRHNWTKEEIMAIYNKPLMELLYEAATVHRKYHDPNSVQVSTLLSIKTGGCSEDCAY 71

Query: 72  CNQSVHNKSK--LKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKER-DLSIIVDM 128
           C QS   +++  ++ + +++V  V  +A  AK  GA+R CMGAAWR  K+  +   +++M
Sbjct: 72  CPQSARYETEVKIENADMMSVTHVKAQALRAKSAGASRVCMGAAWRNVKDGPEFEQVLEM 131

Query: 129 IKGVKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQT 188
           ++ +  L +E C TLGML+  QA+ L++AGL  YNHN+DTSE +Y  + +T +++DRL+T
Sbjct: 132 VRTINKLDMEVCCTLGMLTENQAKRLAEAGLYAYNHNLDTSEEYYKEIISTRSYDDRLKT 191

Query: 189 LENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENK 248
           ++NVRK+ I VC GGI+G+GE ++DR  ML+ L+ L+  PES+PIN L+P+ G+  E+ +
Sbjct: 192 IDNVRKTNITVCSGGIIGMGESLEDRAGMLVALSTLNPQPESVPINALVPVEGTPLEDCE 251

Query: 249 KVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNP 308
            VD  E VR+++ ARI+MP+S++RL+AGR  MS E QALCFF+GANSIF GD LLT  NP
Sbjct: 252 PVDIFEMVRMVATARIVMPQSQVRLSAGRTQMSQEGQALCFFAGANSIFAGDKLLTTPNP 311

Query: 309 SYNKDTILFNRLGLIPD 325
             N+D  +   LG+   
Sbjct: 312 DINEDMQMLGVLGMRIQ 328


>gi|328473153|gb|EGF44001.1| biotin synthase [Vibrio parahaemolyticus 10329]
          Length = 350

 Score =  304 bits (779), Expect = 9e-81,   Method: Composition-based stats.
 Identities = 163/308 (52%), Positives = 227/308 (73%)

Query: 16  PKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQS 75
              WT  EV  +   PF DLLF +  VHR+  + NH+Q+S LL+IKTG CPE+C YC QS
Sbjct: 4   RHNWTHAEVRDLMEKPFMDLLFEAQLVHRQYQQTNHVQVSTLLSIKTGACPEDCKYCPQS 63

Query: 76  VHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSL 135
               + ++  +L+ V++VL  A+ AK  G+TR+CMGAAW+ PKERD+  + DMIKGVK +
Sbjct: 64  ARYTTDIEKERLMEVERVLDAAQKAKNAGSTRFCMGAAWKNPKERDMPHLTDMIKGVKDM 123

Query: 136 GLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKS 195
           GLETCMTLGML+ EQA+ L+ AGLDYYNHN+DTS  FY ++ TT T++DRL TL +VR +
Sbjct: 124 GLETCMTLGMLTPEQAKQLANAGLDYYNHNLDTSPEFYGNIITTRTYQDRLDTLSHVRDA 183

Query: 196 GIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEH 255
           G+K+C GGI+G+GE  +DR  +L+ LANL T PES+PIN+L+ + G+  E    V+P + 
Sbjct: 184 GMKICSGGIIGMGESANDRAGLLVELANLPTHPESVPINMLVKVKGTPLETVDDVEPFDF 243

Query: 256 VRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTI 315
           +R+I++ARI+MP+S +RL+AGR  M++++QALCF +GANS+F G  LLT  NPS +KD +
Sbjct: 244 IRLIAIARIMMPQSAVRLSAGRENMNEQMQALCFMAGANSVFYGCKLLTTPNPSEDKDMM 303

Query: 316 LFNRLGLI 323
           LF +LG+ 
Sbjct: 304 LFKKLGIN 311


>gi|91226052|ref|ZP_01260979.1| biotin synthase [Vibrio alginolyticus 12G01]
 gi|153835759|ref|ZP_01988426.1| biotin synthase [Vibrio harveyi HY01]
 gi|269960803|ref|ZP_06175174.1| Biotin synthase [Vibrio harveyi 1DA3]
 gi|91189493|gb|EAS75770.1| biotin synthase [Vibrio alginolyticus 12G01]
 gi|148867565|gb|EDL66886.1| biotin synthase [Vibrio harveyi HY01]
 gi|269834467|gb|EEZ88555.1| Biotin synthase [Vibrio harveyi 1DA3]
          Length = 350

 Score =  304 bits (779), Expect = 1e-80,   Method: Composition-based stats.
 Identities = 163/308 (52%), Positives = 228/308 (74%)

Query: 16  PKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQS 75
              WT  EV  +   PF DLLF +  VHR+  + NH+Q+S LL+IKTG CPE+C YC QS
Sbjct: 4   RHNWTHAEVRDLMEKPFMDLLFEAQLVHRQYQQTNHVQVSTLLSIKTGACPEDCKYCPQS 63

Query: 76  VHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSL 135
               + ++  +L+ V++VL  A+ AK  G+TR+CMGAAW+ PKERD+  + DMIKGVK +
Sbjct: 64  ARYTTDIEKERLMEVERVLDAAQKAKNAGSTRFCMGAAWKNPKERDMPHLTDMIKGVKGM 123

Query: 136 GLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKS 195
           GLETCMTLGML+ +QA+ L+ AGLDYYNHN+DTS  FY ++ TT T++DRL TL +VR +
Sbjct: 124 GLETCMTLGMLTPDQAKQLATAGLDYYNHNLDTSPEFYGNIITTRTYQDRLDTLSHVRDA 183

Query: 196 GIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEH 255
           G+K+C GGI+G+GE  +DR  +L+ LANL   PES+PIN+L+ + G+  EE   V+P + 
Sbjct: 184 GMKICSGGIIGMGESANDRAGLLVELANLPVHPESVPINMLVKVKGTPLEEVDDVEPFDF 243

Query: 256 VRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTI 315
           +R+I++ARI+MP+S +RL+AGR  M++++QALCF +GANS+F G  LLT  NPS +KD +
Sbjct: 244 IRLIAIARIMMPQSAVRLSAGRENMNEQMQALCFMAGANSVFYGCKLLTTPNPSEDKDMM 303

Query: 316 LFNRLGLI 323
           LFN+LG+ 
Sbjct: 304 LFNKLGIN 311


>gi|319775056|ref|YP_004137544.1| biotin synthase [Haemophilus influenzae F3047]
 gi|317449647|emb|CBY85853.1| biotin synthase [Haemophilus influenzae F3047]
          Length = 333

 Score =  304 bits (779), Expect = 1e-80,   Method: Composition-based stats.
 Identities = 154/327 (47%), Positives = 222/327 (67%)

Query: 1   MSRSTVVPEENPTKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNI 60
           ++    +    P    + W+  +V  ++  PF +L++ +  VHRK+F P  IQLS L++I
Sbjct: 2   LAEKLQINSITPHPSVEYWSVCKVEALFETPFLELVYRAAQVHRKHFNPRAIQLSTLMSI 61

Query: 61  KTGGCPENCGYCNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKER 120
           KTGGCPE+CGYC QS    + ++  +L++VD+++ +AK AK  GA R+CMGAAWR PK +
Sbjct: 62  KTGGCPEDCGYCPQSARYHTGVQNQQLLDVDEIVAKAKIAKARGAGRFCMGAAWRGPKPK 121

Query: 121 DLSIIVDMIKGVKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTH 180
           D+  + ++IK VKSLGLETC T G+L    A+ L +AGLDYYNHN+DT+   Y  V  T 
Sbjct: 122 DIEKVTEIIKAVKSLGLETCGTFGLLQDGMAEDLKEAGLDYYNHNLDTAPEHYAEVIGTR 181

Query: 181 TFEDRLQTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIP 240
            F+DRL TL  VRK+G+KVCCGGI+G+ E   +R  ++ +LANL   PES+PIN L+ + 
Sbjct: 182 RFDDRLSTLGKVRKAGLKVCCGGIVGMNETRKERAGLIASLANLDPQPESVPINQLVKVE 241

Query: 241 GSKFEENKKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGD 300
           G+   + +++D  E VR I+VARI MPKS +RL+AGR+ M++E+QA+CF +GANSIF GD
Sbjct: 242 GTPLADAEELDWTEFVRTIAVARITMPKSYVRLSAGRSGMTEEMQAMCFMAGANSIFYGD 301

Query: 301 TLLTAKNPSYNKDTILFNRLGLIPDLS 327
            LL   NP  + D +L  +L L P+ +
Sbjct: 302 KLLVTDNPEEDGDQLLMAKLDLEPETA 328


>gi|319794414|ref|YP_004156054.1| biotin synthase [Variovorax paradoxus EPS]
 gi|315596877|gb|ADU37943.1| biotin synthase [Variovorax paradoxus EPS]
          Length = 343

 Score =  304 bits (779), Expect = 1e-80,   Method: Composition-based stats.
 Identities = 156/314 (49%), Positives = 215/314 (68%)

Query: 10  ENPTKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENC 69
             P      W+ + +  + + P  DLLF + TVHR++F    I+L+ LL++KTGGCPENC
Sbjct: 16  AKPVTPQGPWSVEAIQALLDKPLMDLLFEAQTVHRQHFPEGDIELATLLSVKTGGCPENC 75

Query: 70  GYCNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMI 129
           GYC QS    + +KA KL+ VD+V++ A+ AK+ GATR+CMGAAWR PK+RD+  +  ++
Sbjct: 76  GYCPQSAEFDTAVKAQKLMEVDEVVRAAQAAKDAGATRFCMGAAWRAPKDRDVEKVAVLV 135

Query: 130 KGVKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTL 189
           + VK LG++TC TLGML    A  L  AGLDYYNHN+DT+  +Y  +  T T++DRL TL
Sbjct: 136 EAVKGLGMQTCATLGMLEPHHAHQLKAAGLDYYNHNLDTAPEYYTDIVDTRTYQDRLDTL 195

Query: 190 ENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKK 249
            +VR +GI VCCGGI+G+GE    R  ++  LANL+  PES+PIN L+ +PG+   +++ 
Sbjct: 196 AHVRSAGISVCCGGIVGMGEQPVHRAGLIAQLANLNPYPESVPINSLVRVPGTPLADSEP 255

Query: 250 VDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPS 309
           VDP + VR+I+VARI MP +R+RL+AGR  M D +QALCF +GANSIF GD LL   NP 
Sbjct: 256 VDPFDFVRMIAVARITMPTARVRLSAGRQQMGDAVQALCFMAGANSIFYGDKLLVTGNPD 315

Query: 310 YNKDTILFNRLGLI 323
            + D  L  +LGL 
Sbjct: 316 VDADVQLLRKLGLQ 329


>gi|171060314|ref|YP_001792663.1| biotin synthase [Leptothrix cholodnii SP-6]
 gi|254810726|sp|B1Y502|BIOB_LEPCP RecName: Full=Biotin synthase
 gi|170777759|gb|ACB35898.1| biotin synthase [Leptothrix cholodnii SP-6]
          Length = 345

 Score =  304 bits (779), Expect = 1e-80,   Method: Composition-based stats.
 Identities = 170/303 (56%), Positives = 219/303 (72%)

Query: 23  EVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQSVHNKSKL 82
           +V  +Y +PF DLLF +  VHR +F+ N +QLS LL+IKTGGC E+CGYC QS H  + +
Sbjct: 32  DVEALYALPFMDLLFQAQQVHRAHFDANEVQLSTLLSIKTGGCAEDCGYCPQSAHFDTAV 91

Query: 83  KASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLGLETCMT 142
           +ASKL+ +D+VL  A  AK  GATR+CMGAAWR PKERD+  + +M++ V++LGLETCMT
Sbjct: 92  EASKLMPIDEVLDAANAAKAQGATRFCMGAAWRSPKERDMERVTEMVREVRALGLETCMT 151

Query: 143 LGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSGIKVCCG 202
           LGML  EQA+ L  AGLDYYNHN+D++  FY  V +T T++DRL TL NVR +GI VCCG
Sbjct: 152 LGMLDGEQARELKDAGLDYYNHNLDSAPDFYGQVISTRTYQDRLDTLGNVRDAGINVCCG 211

Query: 203 GILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEHVRIISVA 262
           GI+G+GE    R  ++  LANLS  PES+PIN L+P+PG+   + + +DP E VR I+VA
Sbjct: 212 GIVGMGESRTQRAGLIAQLANLSPYPESVPINNLVPVPGTPLADAEPIDPFEFVRTIAVA 271

Query: 263 RILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTILFNRLGL 322
           RI MP + +RL+AGR  M + LQALCF +GANSIF GD LLT  NP   +D  LF RLGL
Sbjct: 272 RITMPTTMVRLSAGREQMDEALQALCFAAGANSIFYGDKLLTTSNPQAARDRALFERLGL 331

Query: 323 IPD 325
              
Sbjct: 332 RVQ 334


>gi|260779112|ref|ZP_05888004.1| biotin synthase [Vibrio coralliilyticus ATCC BAA-450]
 gi|260605276|gb|EEX31571.1| biotin synthase [Vibrio coralliilyticus ATCC BAA-450]
          Length = 350

 Score =  304 bits (779), Expect = 1e-80,   Method: Composition-based stats.
 Identities = 166/308 (53%), Positives = 226/308 (73%)

Query: 16  PKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQS 75
              WT  EV ++   PF DLLF +  VHR   + NH+Q+S LL+IKTG CPE+C YC QS
Sbjct: 4   RHNWTVAEVRELMAKPFMDLLFEAQLVHRHYQQHNHVQVSTLLSIKTGACPEDCKYCPQS 63

Query: 76  VHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSL 135
              ++ ++  +L+ V++VL  A+ AK  G+TR+CMGAAW+ PK RD+  + +MIKGVK +
Sbjct: 64  ARYQTDVEKERLMEVERVLDAAQKAKSAGSTRFCMGAAWKNPKARDMPHLTEMIKGVKGM 123

Query: 136 GLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKS 195
           GLETCMTLGML+ EQA  L+ AGLDYYNHN+DTS  FY  + TT T++DRL TL +VR +
Sbjct: 124 GLETCMTLGMLTPEQAAELADAGLDYYNHNLDTSPEFYGSIITTRTYQDRLDTLSHVRDA 183

Query: 196 GIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEH 255
           G+K+C GGI+G+GE  +DR  +L+ LANL T PES+PIN+L+ + G+  EE   V+P + 
Sbjct: 184 GMKICSGGIIGMGESANDRAGLLVELANLPTHPESVPINMLVKVKGTPLEEVDDVEPFDF 243

Query: 256 VRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTI 315
           +R+I+VARILMPKS +RL+AGR  M++++QALCF +GANS+F G  LLT  NPS +KD  
Sbjct: 244 IRLIAVARILMPKSAVRLSAGREDMNEQMQALCFMAGANSVFYGCKLLTTPNPSEDKDMQ 303

Query: 316 LFNRLGLI 323
           LFN+LG+ 
Sbjct: 304 LFNKLGIN 311


>gi|262394642|ref|YP_003286496.1| biotin synthase [Vibrio sp. Ex25]
 gi|262338236|gb|ACY52031.1| biotin synthase [Vibrio sp. Ex25]
          Length = 350

 Score =  304 bits (778), Expect = 1e-80,   Method: Composition-based stats.
 Identities = 162/308 (52%), Positives = 228/308 (74%)

Query: 16  PKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQS 75
              WT  EV  +   PF DLLF +  VHR+  + NH+Q+S LL+IKTG CPE+C YC QS
Sbjct: 4   RHNWTHAEVRDLMEKPFMDLLFEAQLVHRQYQQTNHVQVSTLLSIKTGACPEDCKYCPQS 63

Query: 76  VHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSL 135
               + ++  +L+ V++VL  A+ AK  G+TR+CMGAAW+ PKERD+  + DMIKGVK +
Sbjct: 64  ARYTTDIEKERLMEVERVLDAAQKAKNAGSTRFCMGAAWKNPKERDMPHLTDMIKGVKGM 123

Query: 136 GLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKS 195
           GLETCMTLGML+ +QA+ L+ AGLDYYNHN+DTS  FY ++ TT T++DRL TL +VR +
Sbjct: 124 GLETCMTLGMLTPDQAKQLATAGLDYYNHNLDTSPEFYGNIITTRTYQDRLDTLSHVRDA 183

Query: 196 GIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEH 255
           G+K+C GGI+G+GE  +DR  +L+ LANL   PES+PIN+L+ + G+  EE   V+P + 
Sbjct: 184 GMKICSGGIIGMGESANDRAGLLVELANLPVHPESVPINMLVKVKGTPLEEVDDVEPFDF 243

Query: 256 VRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTI 315
           +R+I++ARI+MP+S +RL+AGR  M++++QALCF +GANS+F G  LLT  NPS +KD +
Sbjct: 244 IRLIAIARIMMPQSAVRLSAGRENMNEQMQALCFMAGANSVFYGCKLLTTPNPSEDKDMM 303

Query: 316 LFNRLGLI 323
           LF++LG+ 
Sbjct: 304 LFDKLGIN 311


>gi|254811612|sp|A7MX36|BIOB_VIBHB RecName: Full=Biotin synthase
          Length = 350

 Score =  304 bits (778), Expect = 1e-80,   Method: Composition-based stats.
 Identities = 162/308 (52%), Positives = 228/308 (74%)

Query: 16  PKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQS 75
              WT  EV  +   PF DLLF +  VHR+  + N++Q+S LL+IKTG CPE+C YC QS
Sbjct: 4   RHNWTHAEVRDLMEKPFMDLLFEAQLVHRQYQQTNYVQVSTLLSIKTGACPEDCKYCPQS 63

Query: 76  VHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSL 135
               + ++  +L+ V++VL  A+ AK  G+TR+CMGAAW+ PKERD+  + DMIKGVK +
Sbjct: 64  ARYTTDIEKERLMEVERVLDAAQKAKNAGSTRFCMGAAWKNPKERDMPHLTDMIKGVKGM 123

Query: 136 GLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKS 195
           GLETCMTLGML+ +QA+ L+ AGLDYYNHN+DTS  FY ++ TT T++DRL TL +VR +
Sbjct: 124 GLETCMTLGMLTPDQAKQLATAGLDYYNHNLDTSPEFYGNIITTRTYQDRLDTLSHVRDA 183

Query: 196 GIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEH 255
           G+K+C GGI+G+GE  +DR  +L+ LANL   PES+PIN+L+ + G+  EE   V+P + 
Sbjct: 184 GMKICSGGIIGMGESANDRAGLLVELANLPVHPESVPINMLVKVKGTPLEEVDDVEPFDF 243

Query: 256 VRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTI 315
           +R+I++ARI+MP+S +RL+AGR  M++++QALCF +GANS+F G  LLT  NPS +KD +
Sbjct: 244 IRLIAIARIMMPQSAVRLSAGRENMNEQMQALCFMAGANSVFYGCKLLTTPNPSEDKDMM 303

Query: 316 LFNRLGLI 323
           LFN+LG+ 
Sbjct: 304 LFNKLGIN 311


>gi|188590921|ref|YP_001795521.1| biotin synthetase [Cupriavidus taiwanensis LMG 19424]
 gi|254810619|sp|B2AGA0|BIOB_CUPTR RecName: Full=Biotin synthase
 gi|170937815|emb|CAP62799.1| biotin synthetase [Cupriavidus taiwanensis LMG 19424]
          Length = 340

 Score =  304 bits (778), Expect = 1e-80,   Method: Composition-based stats.
 Identities = 163/319 (51%), Positives = 223/319 (69%)

Query: 7   VPEENPTKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCP 66
               +       W   +V  ++ +PFNDLLF +  VHR++F+ N +QLS LL+IKTGGC 
Sbjct: 18  TARPHALPDDAKWRVDDVAALFALPFNDLLFRAQQVHREHFDANTVQLSTLLSIKTGGCE 77

Query: 67  ENCGYCNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIV 126
           E+CGYC QS H+ + +KA KL+ +++VL  A+ AK NGATR+CMGAAWR PK+R L  ++
Sbjct: 78  EDCGYCPQSAHHDAGVKAEKLMALEEVLDAARAAKANGATRFCMGAAWRSPKDRHLEPVM 137

Query: 127 DMIKGVKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRL 186
           DM++ VK++GLETC+TLGML  EQAQ L +AGLDYYNHN+DTS  FY  + TT T++DRL
Sbjct: 138 DMVREVKAMGLETCVTLGMLKAEQAQQLKEAGLDYYNHNLDTSPEFYGKIITTRTYQDRL 197

Query: 187 QTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEE 246
            T+  VR +GI VCCGGI+G+GE  + R  ++  LAN+   PES+PIN L+ + G+    
Sbjct: 198 DTIGYVRDAGINVCCGGIVGMGESREARAGLIAQLANMDPYPESVPINNLVQVEGTPLAG 257

Query: 247 NKKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAK 306
            + +DP E VR I+VARI MP++ +RL+AGR  M + LQALCF +GANSIF G+ LLT  
Sbjct: 258 TEALDPFEFVRTIAVARITMPRAMVRLSAGREAMDEALQALCFMAGANSIFYGEKLLTTG 317

Query: 307 NPSYNKDTILFNRLGLIPD 325
           NP  ++D  L  RL +  +
Sbjct: 318 NPQADRDRALLARLDIRAE 336


>gi|160872263|ref|ZP_02062395.1| biotin synthase [Rickettsiella grylli]
 gi|159121062|gb|EDP46400.1| biotin synthase [Rickettsiella grylli]
          Length = 326

 Score =  304 bits (778), Expect = 1e-80,   Method: Composition-based stats.
 Identities = 158/311 (50%), Positives = 222/311 (71%)

Query: 16  PKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQS 75
              WTS ++  ++  PFNDL++ + T+HR++F+ N IQ+S LLNIKTG CPE+C YC QS
Sbjct: 7   RHDWTSDQIRILFQSPFNDLIYQAQTIHRQSFQSNAIQVSSLLNIKTGLCPEDCAYCPQS 66

Query: 76  VHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSL 135
            H  + LK   L+++++V K AK AKE G  R+C+ AAWR P ++    I++MI  +K+L
Sbjct: 67  GHYNTGLKKEPLMSLEEVKKAAKKAKEKGVGRFCIAAAWRSPPKKAFMNILEMIVAIKAL 126

Query: 136 GLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKS 195
            LE C TLGML+ EQA+ LS+ GLDYYNHN+DTS  +Y  + +T T+++RL+TL  VR++
Sbjct: 127 DLEACATLGMLNKEQAKQLSEVGLDYYNHNLDTSPEYYETIISTRTYQERLETLSRVREA 186

Query: 196 GIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEH 255
           GIKVCCGGILG+GE  DDR+ +L  LANL   P+S+ +N LIPIPG+       +D IE 
Sbjct: 187 GIKVCCGGILGMGETQDDRVGLLQQLANLPEQPKSVTLNKLIPIPGTPLAHKSPIDTIEF 246

Query: 256 VRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTI 315
           +R+I+VARI++P+S +RL+AGR  +S+E Q LCFF+GANS+  G+ LLT +N S  +D  
Sbjct: 247 IRVIAVARIMLPRSMIRLSAGRDSLSEEAQTLCFFAGANSLHYGEKLLTTENVSPQQDIT 306

Query: 316 LFNRLGLIPDL 326
           L  +LGL P L
Sbjct: 307 LLKKLGLEPVL 317


>gi|78486317|ref|YP_392242.1| biotin synthase [Thiomicrospira crunogena XCL-2]
 gi|123741534|sp|Q31E55|BIOB_THICR RecName: Full=Biotin synthase
 gi|78364603|gb|ABB42568.1| biotin synthase [Thiomicrospira crunogena XCL-2]
          Length = 338

 Score =  304 bits (777), Expect = 1e-80,   Method: Composition-based stats.
 Identities = 156/314 (49%), Positives = 224/314 (71%), Gaps = 1/314 (0%)

Query: 16  PKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQS 75
              WT +E+  I N PFNDL+F + TVHR++F PN IQ S L+NIK+GGC E+C YC+QS
Sbjct: 7   RNDWTLEEIKDIMNQPFNDLMFQAQTVHRQHFNPNEIQTSTLVNIKSGGCAEDCAYCSQS 66

Query: 76  VHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSL 135
             N+++++  +++ V +V+++A  AKE GATR CMGAAWR P ++D   +++M++ VK L
Sbjct: 67  ARNQTEVEKEQMMEVQEVIEQAMAAKEKGATRLCMGAAWRNPTKKDFPRVLEMVRVVKDL 126

Query: 136 GLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKS 195
           GLETC+TLGML+ +Q + L +AGLDYYNHN+DTSE FYP + TT +++DRL T++ V+++
Sbjct: 127 GLETCLTLGMLNDDQVKQLKEAGLDYYNHNLDTSEAFYPKIITTRSYQDRLDTIDKVQEA 186

Query: 196 GIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEEN-KKVDPIE 254
           GI VC GGI+G+GE   DR +++ T   +   P S+PINLL+P+ G+       K D  E
Sbjct: 187 GINVCSGGIIGMGEQHKDRAELIRTFGTMRHHPNSVPINLLVPVEGTPLAHMKDKTDSFE 246

Query: 255 HVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDT 314
            +R+I+ ARI+MP++ +RL+AGR  ++DE QALCF +GANSIF GD LLT  NP    D 
Sbjct: 247 FIRVIATARIVMPQTYVRLSAGRMELTDEAQALCFLAGANSIFYGDKLLTTDNPEAGHDE 306

Query: 315 ILFNRLGLIPDLSA 328
            LF +LG+    +A
Sbjct: 307 QLFAKLGIQMQQNA 320


>gi|90579576|ref|ZP_01235385.1| putative biotin synthase [Vibrio angustum S14]
 gi|90439150|gb|EAS64332.1| putative biotin synthase [Vibrio angustum S14]
          Length = 350

 Score =  304 bits (777), Expect = 2e-80,   Method: Composition-based stats.
 Identities = 163/313 (52%), Positives = 229/313 (73%)

Query: 16  PKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQS 75
              WT +EV  +++ PF DL+F +  VHR+  +PN +Q+S LL+IKTG CPE+C YC QS
Sbjct: 4   RNNWTVEEVQALFDKPFMDLVFEAQQVHRQYHQPNQVQVSTLLSIKTGACPEDCKYCPQS 63

Query: 76  VHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSL 135
            H ++ +   +L+ V++VL  A  AK++GATR+CMGAAW+ PKERD+  ++DM+KGVK +
Sbjct: 64  AHYRTDVDKERLLEVERVLDAANKAKQSGATRFCMGAAWKNPKERDMPYLLDMVKGVKEM 123

Query: 136 GLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKS 195
           GLETCMTLGM++ EQA  L+ AGLDYYNHN+DTS  +Y ++ TT T++DRL TL +VR +
Sbjct: 124 GLETCMTLGMITSEQADTLADAGLDYYNHNLDTSPEYYGNIITTRTYQDRLDTLSHVRDA 183

Query: 196 GIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEH 255
           G+K+C GGI+G+GE   DR  +L+ LANL   PES+PIN+L+ + G+  E    VDP + 
Sbjct: 184 GMKICSGGIIGMGESSRDRAGLLVELANLPVHPESVPINMLVKVKGTPLESVDDVDPFDF 243

Query: 256 VRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTI 315
           +RII+VARI+MP S +RL+AGR  M++++QALCF +GANS+F G  LLT  NP  +KD  
Sbjct: 244 IRIIAVARIIMPMSAVRLSAGREDMNEQMQALCFMAGANSVFYGCKLLTTPNPGEDKDMQ 303

Query: 316 LFNRLGLIPDLSA 328
           LF +LG+  +  A
Sbjct: 304 LFAKLGINSEQQA 316


>gi|319944186|ref|ZP_08018462.1| biotin synthase [Lautropia mirabilis ATCC 51599]
 gi|319742481|gb|EFV94892.1| biotin synthase [Lautropia mirabilis ATCC 51599]
          Length = 355

 Score =  304 bits (777), Expect = 2e-80,   Method: Composition-based stats.
 Identities = 159/325 (48%), Positives = 219/325 (67%), Gaps = 2/325 (0%)

Query: 5   TVVPEENPTKKPKV--WTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKT 62
           +V+    PT  P++  W+   V  ++  PF DL+F + +VHR++F+   IQLS LL++KT
Sbjct: 6   SVLNLRRPTPHPELSYWSVCRVEALFERPFLDLVFEAASVHRQHFDAQRIQLSTLLSVKT 65

Query: 63  GGCPENCGYCNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDL 122
           GGCPE+C YC QS    + +KA KL++V+ VL  A+ AK  GA+R+CMGAAWR PK RD+
Sbjct: 66  GGCPEDCAYCPQSARYDTGVKAQKLLDVETVLASARVAKSRGASRFCMGAAWRGPKPRDI 125

Query: 123 SIIVDMIKGVKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTF 182
             + ++I+ VK LGLETC T G+L    A+ L +AGLDYYNHN+DT+   Y  V  T  F
Sbjct: 126 EKLQELIRAVKDLGLETCGTFGLLEEGMAEDLKEAGLDYYNHNLDTAPEHYGDVIGTRQF 185

Query: 183 EDRLQTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGS 242
           +DRL TL  VR +G+K+CCGGI+G+ E   DR  ++ +LANL   PES+PIN L+ +PG+
Sbjct: 186 DDRLNTLGKVRAAGLKICCGGIVGMNETRKDRAGLIASLANLDPQPESVPINQLVRLPGT 245

Query: 243 KFEENKKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTL 302
              + + +D  E VR I+VARI MP S +RL+AGR  M + +QALCF +GANSIF GD L
Sbjct: 246 PLADAEPLDWTEFVRTIAVARITMPTSLVRLSAGRQEMPESMQALCFMAGANSIFYGDKL 305

Query: 303 LTAKNPSYNKDTILFNRLGLIPDLS 327
           LT +NP  + D  L  +L L+P  S
Sbjct: 306 LTTENPEEDTDRQLMQKLDLLPMQS 330


>gi|315634572|ref|ZP_07889857.1| biotin synthase [Aggregatibacter segnis ATCC 33393]
 gi|315476799|gb|EFU67546.1| biotin synthase [Aggregatibacter segnis ATCC 33393]
          Length = 334

 Score =  304 bits (777), Expect = 2e-80,   Method: Composition-based stats.
 Identities = 158/326 (48%), Positives = 221/326 (67%), Gaps = 1/326 (0%)

Query: 1   MSRSTV-VPEENPTKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLN 59
           MS ST+ +    P    + W+  +V  ++  PF DL++ +  VHRKNF P  IQLS L++
Sbjct: 1   MSTSTLQIYSITPHPTAEYWSVCKVEALFETPFLDLIYRAAQVHRKNFNPRAIQLSTLMS 60

Query: 60  IKTGGCPENCGYCNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKE 119
           IKTGGCPE+CGYC QS    + ++  +L+NV+ ++ +AK AK  GA R+CMGAAWR PK 
Sbjct: 61  IKTGGCPEDCGYCPQSARYHTGVQNQELLNVEDIVAKAKIAKARGAGRFCMGAAWRGPKP 120

Query: 120 RDLSIIVDMIKGVKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTT 179
           +D++ + ++IK VK+LG+ETC T G+L    A+ L  AGLDYYNHN+DT+   Y  V  T
Sbjct: 121 KDIAKVTEIIKAVKALGMETCGTFGLLQDGMAEELKDAGLDYYNHNLDTAPEHYSEVIGT 180

Query: 180 HTFEDRLQTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPI 239
             F+DR+ TL  VRK+G+KVCCGGI+G+ E   +R  ++ +LANL   PES+PIN L+ I
Sbjct: 181 RRFDDRISTLGKVRKAGLKVCCGGIVGMNETRKERAGLIASLANLDPQPESVPINQLVKI 240

Query: 240 PGSKFEENKKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVG 299
            G+   + +++D  E VR I+VARI MP S +RL+AGR  MS+E+QA+CF +GANSIF G
Sbjct: 241 EGTPLADAEELDWTEFVRTIAVARITMPNSYVRLSAGRQGMSEEMQAMCFMAGANSIFYG 300

Query: 300 DTLLTAKNPSYNKDTILFNRLGLIPD 325
           D LL   NP  + D +L  +L L P+
Sbjct: 301 DKLLVTGNPEEDGDRLLMEKLDLEPE 326


>gi|73539856|ref|YP_294376.1| biotin synthase [Ralstonia eutropha JMP134]
 gi|123774172|sp|Q477A1|BIOB_RALEJ RecName: Full=Biotin synthase
 gi|72117269|gb|AAZ59532.1| Biotin synthase [Ralstonia eutropha JMP134]
          Length = 342

 Score =  303 bits (776), Expect = 2e-80,   Method: Composition-based stats.
 Identities = 165/315 (52%), Positives = 224/315 (71%)

Query: 11  NPTKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCG 70
           +   +   W   +V  ++ +PFNDLLF +  VHR+NF+ N +QLS LL+IKTGGC E+CG
Sbjct: 24  HALPEDARWRVDDVAALFALPFNDLLFRAQQVHRENFDANTVQLSTLLSIKTGGCEEDCG 83

Query: 71  YCNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIK 130
           YC QS H+ + +KA KL+ +D+VL+ A+ AK NGATR+CMGAAWR PK+R L  ++DM++
Sbjct: 84  YCPQSAHHDAGVKAEKLMELDEVLEAARAAKANGATRFCMGAAWRSPKDRHLEPVMDMVR 143

Query: 131 GVKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLE 190
            VK++GLETC+TLGML  EQAQ L  AGLDYYNHN+DTS  FY  + TT T++DRL T+ 
Sbjct: 144 EVKAMGLETCVTLGMLKAEQAQQLKDAGLDYYNHNLDTSPEFYGKIITTRTYQDRLDTIG 203

Query: 191 NVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKV 250
           +VR +GI VCCGGI+G+GE  + R  ++  LAN+   PES+PIN L+ + G+     + +
Sbjct: 204 HVRDAGINVCCGGIVGMGESREARAGLIAQLANMDPYPESVPINNLVQVEGTPLAGTEAL 263

Query: 251 DPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSY 310
           DP E VR I+VARI MP + +RL+AGR  M + LQALCF +GANSIF G+ LLT  NP  
Sbjct: 264 DPFEFVRTIAVARITMPGAMVRLSAGREAMDEALQALCFMAGANSIFYGEKLLTTGNPQA 323

Query: 311 NKDTILFNRLGLIPD 325
           ++D  L  RL +  +
Sbjct: 324 DRDRALLARLDIRAE 338


>gi|311108336|ref|YP_003981189.1| biotin synthase [Achromobacter xylosoxidans A8]
 gi|310763025|gb|ADP18474.1| biotin synthase [Achromobacter xylosoxidans A8]
          Length = 339

 Score =  303 bits (776), Expect = 2e-80,   Method: Composition-based stats.
 Identities = 158/303 (52%), Positives = 208/303 (68%)

Query: 23  EVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQSVHNKSKL 82
           ++  +Y +PF DL+F +   HR +F+PN IQLS LL+IKTGGCPE+C YC QS H  + L
Sbjct: 24  DIMALYELPFMDLVFRAQQTHRAHFDPNAIQLSSLLSIKTGGCPEDCAYCPQSSHYDTGL 83

Query: 83  KASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLGLETCMT 142
            A KL+ +  V+  A+ A+E GA R+CMGAAWR PK   L  + +M+  VK+LGLETC+T
Sbjct: 84  DADKLMPLADVVAAARKAQEGGAQRFCMGAAWRSPKPHHLEAVAEMVSAVKALGLETCVT 143

Query: 143 LGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSGIKVCCG 202
           LGML   QA+ L  AGLDYYNHN+DTS  FY  + +T T++DRL TL+ VR +GI VCCG
Sbjct: 144 LGMLREGQAEQLKHAGLDYYNHNLDTSPEFYGKIISTRTYQDRLDTLDRVRDAGISVCCG 203

Query: 203 GILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEHVRIISVA 262
           GI+GLGE   +R  ++  LA++   PES+PIN L+ + G+     + +DP E VR I+VA
Sbjct: 204 GIVGLGESRRERAGLIAQLASMEPYPESVPINNLVQVEGTPLAGVEALDPFEFVRTIAVA 263

Query: 263 RILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTILFNRLGL 322
           RI MP++ +RL+AGR  M D LQALCF +GANS+F GD LLT  NP    D  L  RLG+
Sbjct: 264 RIAMPRAAVRLSAGREAMDDALQALCFMAGANSMFYGDALLTTANPQMEADQRLLQRLGM 323

Query: 323 IPD 325
             D
Sbjct: 324 RID 326


>gi|254810635|sp|A5VUG1|BIOB_BRUO2 RecName: Full=Biotin synthase
          Length = 328

 Score =  303 bits (776), Expect = 2e-80,   Method: Composition-based stats.
 Identities = 201/308 (65%), Positives = 253/308 (82%)

Query: 18  VWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQSVH 77
            W+++E   IYN+PFNDLLF +H +HR+NF+PN IQLSKLLNIKTGGCPE+CGYC+QS  
Sbjct: 16  RWSAEEARAIYNLPFNDLLFRAHGLHRENFDPNRIQLSKLLNIKTGGCPEDCGYCSQSAS 75

Query: 78  NKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLGL 137
            ++ LKASKL+ ++ VL+EA+ AK  GATRYCMGAAWR PK+RD+  +  MI+ VK++GL
Sbjct: 76  AENGLKASKLMEIETVLEEARKAKAAGATRYCMGAAWRSPKDRDMPALTHMIESVKAMGL 135

Query: 138 ETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSGI 197
           ETCMTLGML  ++A+ L+ AGLDYYNHNIDTSERFYP V TT +FEDRL TL NVR +GI
Sbjct: 136 ETCMTLGMLDSDKAEKLADAGLDYYNHNIDTSERFYPAVITTRSFEDRLDTLANVRNAGI 195

Query: 198 KVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEHVR 257
           KVC GGILGLGE  +DRIDML+TLANL  PPES+PIN+LIP+PG++  +   VDP+E VR
Sbjct: 196 KVCSGGILGLGEETEDRIDMLVTLANLPEPPESVPINMLIPMPGTRLAKAAPVDPLEFVR 255

Query: 258 IISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTILF 317
           ++++ARILMPKS +RL AGR  MSDE+QALCFF+GANS+F+GDTLLTA NP  ++D+ L 
Sbjct: 256 VVALARILMPKSHVRLTAGRTAMSDEMQALCFFAGANSLFMGDTLLTAANPGDDRDSSLL 315

Query: 318 NRLGLIPD 325
            RLG+  +
Sbjct: 316 RRLGIQAE 323


>gi|146339438|ref|YP_001204486.1| biotin synthetase [Bradyrhizobium sp. ORS278]
 gi|254810575|sp|A4YQS3|BIOB_BRASO RecName: Full=Biotin synthase
 gi|146192244|emb|CAL76249.1| biotin synthetase (Biotin synthase) [Bradyrhizobium sp. ORS278]
          Length = 334

 Score =  303 bits (776), Expect = 2e-80,   Method: Composition-based stats.
 Identities = 168/314 (53%), Positives = 225/314 (71%), Gaps = 1/314 (0%)

Query: 16  PKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQS 75
              WT +E   +Y +PF DL+F +   HR++F+P  ++ + LL+IKTGGCPE+CGYC+QS
Sbjct: 7   RHDWTREEAEVLYALPFPDLMFLAQATHRRHFDPTRLETASLLSIKTGGCPEDCGYCSQS 66

Query: 76  VHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSL 135
            H  + LKA+KL++ D V+  A+ AKE GA R+CM AAWR PK+RDL  + DM+  VK L
Sbjct: 67  AHYDTGLKATKLMDQDAVVATARRAKEAGADRFCMAAAWRNPKDRDLDQVCDMVSAVKDL 126

Query: 136 GLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKS 195
           G+ETC+TLGML+  QA  L +AGLDYYNHN+DTS  FY  + TT T +DR+ TL NVR++
Sbjct: 127 GMETCVTLGMLTPPQAARLKQAGLDYYNHNVDTSPEFYDRIITTRTMQDRIDTLANVREA 186

Query: 196 GIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEE-NKKVDPIE 254
           GIKVCCGGI+G+GE +DDR+ ML+ LANL   P+S+PIN+   + G    +  ++ D I 
Sbjct: 187 GIKVCCGGIIGMGEEVDDRLGMLVLLANLDAHPDSVPINMWNEVKGVPVNDTAERPDGIA 246

Query: 255 HVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDT 314
             R+I+VARI+MP+S +RL+AGR  MSDELQ+LC  +GANSIF+GD LLT  NP   +D 
Sbjct: 247 LARLIAVARIMMPRSVVRLSAGRQYMSDELQSLCLLAGANSIFIGDVLLTTANPQAERDA 306

Query: 315 ILFNRLGLIPDLSA 328
            L  RLG+   LSA
Sbjct: 307 DLLTRLGMTSSLSA 320


>gi|209883857|ref|YP_002287714.1| biotin synthase [Oligotropha carboxidovorans OM5]
 gi|254810763|sp|B6JDD7|BIOB_OLICO RecName: Full=Biotin synthase
 gi|209872053|gb|ACI91849.1| biotin synthase [Oligotropha carboxidovorans OM5]
          Length = 347

 Score =  303 bits (776), Expect = 2e-80,   Method: Composition-based stats.
 Identities = 169/312 (54%), Positives = 224/312 (71%), Gaps = 1/312 (0%)

Query: 13  TKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYC 72
                 W  +E   +Y++PF DL+F + ++HR +F+PNH++ + LL+IKTGGC E+CGYC
Sbjct: 17  ALPRHNWAREEAQALYDLPFPDLVFQAQSIHRTSFDPNHVETASLLSIKTGGCAEDCGYC 76

Query: 73  NQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGV 132
           +QS H K+ +KA+KL+  D V+  A+ AKE+GA R+CM AAWR PKE+DL  I  M+  V
Sbjct: 77  SQSAHYKTDVKATKLMAHDDVVATARRAKESGAGRFCMAAAWRNPKEKDLERICHMVSAV 136

Query: 133 KSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENV 192
           K LG+ETC TLGML+ EQA  L  AGLD+YNHN+DTS  FY  + TT T +DR++TL + 
Sbjct: 137 KELGMETCATLGMLTREQADKLRAAGLDFYNHNVDTSPEFYGKIITTRTLQDRIETLAHA 196

Query: 193 RKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFE-ENKKVD 251
           R+SG+KVCCGGI+GLGE ++DR+ ML+ LANL+  PES+PIN    + G       +  D
Sbjct: 197 RESGLKVCCGGIVGLGEQVEDRLGMLVLLANLAEHPESVPINQWNEVKGVPVNATAEAPD 256

Query: 252 PIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYN 311
           PI  VR+I+VARI+MPKS +RL+AGR  MSDE+QALC  +GANSIF+GD LLT KNP   
Sbjct: 257 PIAFVRMIAVARIMMPKSVVRLSAGRQYMSDEMQALCMLAGANSIFIGDVLLTTKNPQTT 316

Query: 312 KDTILFNRLGLI 323
           KD  L  RLG+ 
Sbjct: 317 KDAALLERLGMT 328


>gi|332882214|ref|ZP_08449844.1| biotin synthase [Capnocytophaga sp. oral taxon 329 str. F0087]
 gi|332679837|gb|EGJ52804.1| biotin synthase [Capnocytophaga sp. oral taxon 329 str. F0087]
          Length = 372

 Score =  303 bits (776), Expect = 2e-80,   Method: Composition-based stats.
 Identities = 151/313 (48%), Positives = 218/313 (69%), Gaps = 3/313 (0%)

Query: 16  PKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQS 75
              WT +E+  IYN P  DLL+ + TVHRK  +PN +Q+S LL+IKTGGC E+C YC QS
Sbjct: 12  RHNWTKEEIIAIYNKPLMDLLYEAATVHRKYHDPNSVQVSTLLSIKTGGCSEDCAYCPQS 71

Query: 76  VHNKSK--LKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKER-DLSIIVDMIKGV 132
              +++  ++ + +++V  V  +A  AK  GA+R CMGAAWR  K+  +   +++M++ +
Sbjct: 72  ARYETEVKIENADMMSVTHVKAQALRAKSAGASRVCMGAAWRNVKDGPEFEQVLEMVRTI 131

Query: 133 KSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENV 192
             L +E C TLGML+  QA+ L++AGL  YNHN+DTSE +Y  + +T ++EDRL+T++NV
Sbjct: 132 NKLDMEVCCTLGMLTENQAKRLAEAGLYAYNHNLDTSEEYYKEIISTRSYEDRLKTIDNV 191

Query: 193 RKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDP 252
           RK+ I VC GGI+G+GE ++DR  ML+ L+ L+  PES+PIN L+P+ G+  E+ K VD 
Sbjct: 192 RKTNITVCSGGIIGMGESLEDRAGMLVALSTLNPQPESVPINALVPVEGTPLEDCKPVDI 251

Query: 253 IEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNK 312
            E VR+++ ARI+MP+S++RL+AGR  MS E QALCFF+GANSIF GD LLT  NP  N+
Sbjct: 252 FEMVRMVATARIVMPESQVRLSAGRTQMSQEGQALCFFAGANSIFAGDKLLTTPNPDINE 311

Query: 313 DTILFNRLGLIPD 325
           D  +   LG+   
Sbjct: 312 DMQMLGVLGMRIQ 324


>gi|23500239|ref|NP_699679.1| biotin synthase [Brucella suis 1330]
 gi|83269625|ref|YP_418916.1| biotin synthase [Brucella melitensis biovar Abortus 2308]
 gi|256015273|ref|YP_003105282.1| biotin synthase [Brucella microti CCM 4915]
 gi|81751393|sp|Q8FWG3|BIOB_BRUSU RecName: Full=Biotin synthase
 gi|123740853|sp|Q2YKB8|BIOB_BRUA2 RecName: Full=Biotin synthase
 gi|254810631|sp|Q577P8|BIOB_BRUAB RecName: Full=Biotin synthase
 gi|254810632|sp|A9MBD6|BIOB_BRUC2 RecName: Full=Biotin synthase
 gi|254810633|sp|C0RL26|BIOB_BRUMB RecName: Full=Biotin synthase
 gi|254810634|sp|Q8YBW1|BIOB_BRUME RecName: Full=Biotin synthase
 gi|254810636|sp|A9WYH2|BIOB_BRUSI RecName: Full=Biotin synthase
 gi|254810640|sp|B2SBF0|BIOB_BRUA1 RecName: Full=Biotin synthase
 gi|23463844|gb|AAN33684.1| biotin synthase [Brucella suis 1330]
 gi|82939899|emb|CAJ12910.1| Biotin synthase:Elongator protein 3/MiaB/NifB:Radical SAM [Brucella
           melitensis biovar Abortus 2308]
 gi|255997933|gb|ACU49620.1| biotin synthase [Brucella microti CCM 4915]
          Length = 328

 Score =  303 bits (776), Expect = 2e-80,   Method: Composition-based stats.
 Identities = 201/308 (65%), Positives = 253/308 (82%)

Query: 18  VWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQSVH 77
            W+++E   IYN+PFNDLLF +H +HR+NF+PN IQLSKLLNIKTGGCPE+CGYC+QS  
Sbjct: 16  RWSAEEARAIYNLPFNDLLFRAHGLHRENFDPNRIQLSKLLNIKTGGCPEDCGYCSQSAS 75

Query: 78  NKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLGL 137
            ++ LKASKL+ ++ VL+EA+ AK  GATRYCMGAAWR PK+RD+  +  MI+ VK++GL
Sbjct: 76  AENGLKASKLMEIETVLEEARKAKAAGATRYCMGAAWRSPKDRDMPALTHMIESVKAMGL 135

Query: 138 ETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSGI 197
           ETCMTLGML  ++A+ L+ AGLDYYNHNIDTSERFYP V TT +FEDRL TL NVR +GI
Sbjct: 136 ETCMTLGMLDSDKAEKLADAGLDYYNHNIDTSERFYPAVITTRSFEDRLDTLANVRNAGI 195

Query: 198 KVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEHVR 257
           KVC GGILGLGE  +DRIDML+TLANL  PPES+PIN+LIP+PG++  +   VDP+E VR
Sbjct: 196 KVCSGGILGLGEEAEDRIDMLVTLANLPEPPESVPINMLIPMPGTRLAKAAPVDPLEFVR 255

Query: 258 IISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTILF 317
           ++++ARILMPKS +RL AGR  MSDE+QALCFF+GANS+F+GDTLLTA NP  ++D+ L 
Sbjct: 256 VVALARILMPKSHVRLTAGRTAMSDEMQALCFFAGANSLFMGDTLLTAANPGDDRDSSLL 315

Query: 318 NRLGLIPD 325
            RLG+  +
Sbjct: 316 RRLGIQAE 323


>gi|241765127|ref|ZP_04763116.1| biotin synthase [Acidovorax delafieldii 2AN]
 gi|241365244|gb|EER60084.1| biotin synthase [Acidovorax delafieldii 2AN]
          Length = 355

 Score =  303 bits (776), Expect = 2e-80,   Method: Composition-based stats.
 Identities = 161/316 (50%), Positives = 217/316 (68%), Gaps = 1/316 (0%)

Query: 8   PEENPTKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPE 67
           P   P      WT + +  + + P  DLLF +  VHR+++    I+L+ LL++KTGGCPE
Sbjct: 18  PVATPATDG-PWTVEAIQALLDKPLMDLLFEAQNVHRQHWPAGDIELATLLSVKTGGCPE 76

Query: 68  NCGYCNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVD 127
           NCGYC QS    + +KA KL+ VD+V++ A+ AK+ GATR+CMGAAWR PK+RD+  +  
Sbjct: 77  NCGYCPQSAEFDTGVKAEKLMEVDEVVRAAQAAKDAGATRFCMGAAWRAPKDRDIEKVSA 136

Query: 128 MIKGVKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQ 187
           +I  VK LGL+TC TLGML   QAQ L  AGLDYYNHN+DT+  +Y  V +T  ++DRL 
Sbjct: 137 LISAVKGLGLQTCATLGMLESHQAQALKDAGLDYYNHNLDTAPEYYTDVVSTRAYQDRLD 196

Query: 188 TLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEEN 247
           TL++VR +GI VCCGGI+G+GE    R  ++  LANL   PES+PIN L+ +PG+   ++
Sbjct: 197 TLQHVRSAGISVCCGGIVGMGEAPVHRAGLIAQLANLQPYPESVPINSLVRVPGTPLADS 256

Query: 248 KKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKN 307
           + VDP + VR+I+VARI MPK+R+RL+AGR  M D +QALCF +GANSIF GD LL   N
Sbjct: 257 EPVDPFDFVRVIAVARITMPKARVRLSAGRQQMGDAVQALCFMAGANSIFYGDKLLVTGN 316

Query: 308 PSYNKDTILFNRLGLI 323
           P  + D  L  +LGL 
Sbjct: 317 PDVDADVQLLAKLGLK 332


>gi|148558280|ref|YP_001257466.1| biotin synthase [Brucella ovis ATCC 25840]
 gi|148369565|gb|ABQ62437.1| biotin synthase [Brucella ovis ATCC 25840]
          Length = 346

 Score =  303 bits (775), Expect = 3e-80,   Method: Composition-based stats.
 Identities = 201/308 (65%), Positives = 253/308 (82%)

Query: 18  VWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQSVH 77
            W+++E   IYN+PFNDLLF +H +HR+NF+PN IQLSKLLNIKTGGCPE+CGYC+QS  
Sbjct: 34  RWSAEEARAIYNLPFNDLLFRAHGLHRENFDPNRIQLSKLLNIKTGGCPEDCGYCSQSAS 93

Query: 78  NKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLGL 137
            ++ LKASKL+ ++ VL+EA+ AK  GATRYCMGAAWR PK+RD+  +  MI+ VK++GL
Sbjct: 94  AENGLKASKLMEIETVLEEARKAKAAGATRYCMGAAWRSPKDRDMPALTHMIESVKAMGL 153

Query: 138 ETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSGI 197
           ETCMTLGML  ++A+ L+ AGLDYYNHNIDTSERFYP V TT +FEDRL TL NVR +GI
Sbjct: 154 ETCMTLGMLDSDKAEKLADAGLDYYNHNIDTSERFYPAVITTRSFEDRLDTLANVRNAGI 213

Query: 198 KVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEHVR 257
           KVC GGILGLGE  +DRIDML+TLANL  PPES+PIN+LIP+PG++  +   VDP+E VR
Sbjct: 214 KVCSGGILGLGEETEDRIDMLVTLANLPEPPESVPINMLIPMPGTRLAKAAPVDPLEFVR 273

Query: 258 IISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTILF 317
           ++++ARILMPKS +RL AGR  MSDE+QALCFF+GANS+F+GDTLLTA NP  ++D+ L 
Sbjct: 274 VVALARILMPKSHVRLTAGRTAMSDEMQALCFFAGANSLFMGDTLLTAANPGDDRDSSLL 333

Query: 318 NRLGLIPD 325
            RLG+  +
Sbjct: 334 RRLGIQAE 341


>gi|72382494|ref|YP_291849.1| biotin synthase [Prochlorococcus marinus str. NATL2A]
 gi|123732621|sp|Q46K32|BIOB_PROMT RecName: Full=Biotin synthase
 gi|72002344|gb|AAZ58146.1| biotin synthase [Prochlorococcus marinus str. NATL2A]
          Length = 345

 Score =  303 bits (775), Expect = 3e-80,   Method: Composition-based stats.
 Identities = 148/313 (47%), Positives = 211/313 (67%), Gaps = 1/313 (0%)

Query: 16  PKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQS 75
              W+S+E+ +I ++P  DLL+ +  VHR       +QL+ LL++KTGGC E+C YC QS
Sbjct: 33  RHDWSSEEIKEILDLPLMDLLWRAQIVHRSYNPGYKVQLASLLSVKTGGCSEDCAYCPQS 92

Query: 76  VHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERD-LSIIVDMIKGVKS 134
           VHN++ ++ + +I V+ VL  A+ AK+ GA R+CMG AWRE K+ +    +++M+KGV+ 
Sbjct: 93  VHNETTVQPNPVIEVESVLDRARAAKDAGADRFCMGWAWREIKDGNAFDSMLEMVKGVRE 152

Query: 135 LGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRK 194
           LGLE C+T GM++  QA  L++AGL  YNHN+DTS   Y  + +T T++DRL+TL  VR 
Sbjct: 153 LGLEACVTAGMITDSQASRLAEAGLTAYNHNLDTSPEHYSKIISTRTYQDRLETLRRVRM 212

Query: 195 SGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIE 254
           +GI VCCGGI+G+GE + DR  +L  LA L   PES+PIN L+ + G+  E+   +DP+E
Sbjct: 213 AGITVCCGGIIGMGESVSDRASLLKVLATLDPHPESVPINALVAVEGTPMEDLSSIDPLE 272

Query: 255 HVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDT 314
            VR+++ ARI+MPKSR+RL+AGR  +  E Q LC  SGA+SIF GDTLLT  NP    D 
Sbjct: 273 MVRMVATARIIMPKSRIRLSAGRQQLGREAQILCLQSGADSIFYGDTLLTTSNPEVEADR 332

Query: 315 ILFNRLGLIPDLS 327
            L    G+  + S
Sbjct: 333 KLLADAGITANFS 345


>gi|145628035|ref|ZP_01783836.1| Biotin synthase [Haemophilus influenzae 22.1-21]
 gi|260581911|ref|ZP_05849707.1| biotin synthase [Haemophilus influenzae NT127]
 gi|144979810|gb|EDJ89469.1| Biotin synthase [Haemophilus influenzae 22.1-21]
 gi|260095104|gb|EEW78996.1| biotin synthase [Haemophilus influenzae NT127]
          Length = 333

 Score =  303 bits (775), Expect = 3e-80,   Method: Composition-based stats.
 Identities = 153/327 (46%), Positives = 221/327 (67%)

Query: 1   MSRSTVVPEENPTKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNI 60
           ++    +    P    + W+  +V  ++  PF +L++ +  VHRK+F P  IQLS L++I
Sbjct: 2   LAEKLQINSITPHPSVEYWSVCKVEALFETPFLELVYRATQVHRKHFNPRTIQLSTLMSI 61

Query: 61  KTGGCPENCGYCNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKER 120
           KTGGCPE+C YC QS    + ++  +L++VD+++ +AK AK  GA R+CMGAAWR PK +
Sbjct: 62  KTGGCPEDCSYCPQSARYHTGVQNQQLLDVDEIVAKAKIAKARGAGRFCMGAAWRGPKPK 121

Query: 121 DLSIIVDMIKGVKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTH 180
           D+  + ++IK VKSLGLETC T G+L    A+ L +AGLDYYNHN+DT+   Y  V  T 
Sbjct: 122 DIEKVTEIIKAVKSLGLETCGTFGLLQDGMAEDLKEAGLDYYNHNLDTAPEHYAEVIGTR 181

Query: 181 TFEDRLQTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIP 240
            F+DRL TL  VRK+G+KVCCGGI+G+ E   +R  ++ +LANL   PES+PIN L+ + 
Sbjct: 182 RFDDRLSTLGKVRKAGLKVCCGGIVGMNETRKERAGLIASLANLDPQPESVPINQLVKVE 241

Query: 241 GSKFEENKKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGD 300
           G+   + +++D  E VR I+VARI MPKS +RL+AGR+ M++E+QA+CF +GANSIF GD
Sbjct: 242 GTPLADAEELDWTEFVRTIAVARITMPKSYVRLSAGRSGMTEEMQAMCFMAGANSIFYGD 301

Query: 301 TLLTAKNPSYNKDTILFNRLGLIPDLS 327
            LL   NP  + D +L  +L L P+ +
Sbjct: 302 KLLVTDNPEEDGDQLLMAKLDLEPETA 328


>gi|225628930|ref|ZP_03786964.1| biotin synthase [Brucella ceti str. Cudo]
 gi|260167246|ref|ZP_05754057.1| biotin synthase [Brucella sp. F5/99]
 gi|261756650|ref|ZP_06000359.1| biotin synthase [Brucella sp. F5/99]
 gi|225616776|gb|EEH13824.1| biotin synthase [Brucella ceti str. Cudo]
 gi|261736634|gb|EEY24630.1| biotin synthase [Brucella sp. F5/99]
          Length = 346

 Score =  302 bits (774), Expect = 3e-80,   Method: Composition-based stats.
 Identities = 201/308 (65%), Positives = 253/308 (82%)

Query: 18  VWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQSVH 77
            W+++E   IYN+PFNDLLF +H +HR+NF+PN IQLSKLLNIKTGGCPE+CGYC+QS  
Sbjct: 34  RWSAEEARAIYNLPFNDLLFRAHGLHRENFDPNRIQLSKLLNIKTGGCPEDCGYCSQSAS 93

Query: 78  NKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLGL 137
            ++ LKASKL+ ++ VL+EA+ AK  GATRYCMGAAWR PK+RD+  +  MI+ VK++GL
Sbjct: 94  AENGLKASKLMEIETVLEEARKAKAAGATRYCMGAAWRSPKDRDMPALTHMIESVKAMGL 153

Query: 138 ETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSGI 197
           ETCMTLGML  ++A+ L+ AGLDYYNHNIDTSERFYP V TT +FEDRL TL NVR +GI
Sbjct: 154 ETCMTLGMLDSDKAEKLADAGLDYYNHNIDTSERFYPAVITTRSFEDRLDTLANVRNAGI 213

Query: 198 KVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEHVR 257
           KVC GGILGLGE  +DRIDML+TLANL  PPES+PIN+LIP+PG++  +   VDP+E VR
Sbjct: 214 KVCSGGILGLGEEAEDRIDMLVTLANLPEPPESVPINMLIPMPGTRLAKAAPVDPLEFVR 273

Query: 258 IISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTILF 317
           ++++ARILMPKS +RL AGR  MSDE+QALCFF+GANS+F+GDTLLTA NP  ++D+ L 
Sbjct: 274 VVALARILMPKSYVRLTAGRTAMSDEMQALCFFAGANSLFMGDTLLTAANPGDDRDSSLL 333

Query: 318 NRLGLIPD 325
            RLG+  +
Sbjct: 334 RRLGIQAE 341


>gi|17989120|ref|NP_541753.1| biotin synthase [Brucella melitensis bv. 1 str. 16M]
 gi|62317644|ref|YP_223497.1| biotin synthase BioB [Brucella abortus bv. 1 str. 9-941]
 gi|161620558|ref|YP_001594444.1| biotin synthase [Brucella canis ATCC 23365]
 gi|163844655|ref|YP_001622310.1| biotin synthase [Brucella suis ATCC 23445]
 gi|189022892|ref|YP_001932633.1| BioB, biotin synthase [Brucella abortus S19]
 gi|225686291|ref|YP_002734263.1| biotin synthase [Brucella melitensis ATCC 23457]
 gi|237817189|ref|ZP_04596181.1| biotin synthase [Brucella abortus str. 2308 A]
 gi|254691138|ref|ZP_05154392.1| biotin synthase [Brucella abortus bv. 6 str. 870]
 gi|254695557|ref|ZP_05157385.1| biotin synthase [Brucella abortus bv. 3 str. Tulya]
 gi|254698921|ref|ZP_05160749.1| biotin synthase [Brucella abortus bv. 2 str. 86/8/59]
 gi|254699745|ref|ZP_05161573.1| biotin synthase [Brucella suis bv. 5 str. 513]
 gi|254702879|ref|ZP_05164707.1| biotin synthase [Brucella suis bv. 3 str. 686]
 gi|254706000|ref|ZP_05167828.1| biotin synthase [Brucella pinnipedialis M163/99/10]
 gi|254711700|ref|ZP_05173511.1| biotin synthase [Brucella pinnipedialis B2/94]
 gi|254712316|ref|ZP_05174127.1| biotin synthase [Brucella ceti M644/93/1]
 gi|254715387|ref|ZP_05177198.1| biotin synthase [Brucella ceti M13/05/1]
 gi|254732368|ref|ZP_05190946.1| biotin synthase [Brucella abortus bv. 4 str. 292]
 gi|256029666|ref|ZP_05443280.1| biotin synthase [Brucella pinnipedialis M292/94/1]
 gi|256043389|ref|ZP_05446322.1| biotin synthase [Brucella melitensis bv. 1 str. Rev.1]
 gi|256059301|ref|ZP_05449503.1| biotin synthase [Brucella neotomae 5K33]
 gi|256111601|ref|ZP_05452596.1| biotin synthase [Brucella melitensis bv. 3 str. Ether]
 gi|256157816|ref|ZP_05455734.1| biotin synthase [Brucella ceti M490/95/1]
 gi|256253220|ref|ZP_05458756.1| biotin synthase [Brucella ceti B1/94]
 gi|256256324|ref|ZP_05461860.1| biotin synthase [Brucella abortus bv. 9 str. C68]
 gi|256262571|ref|ZP_05465103.1| BioB [Brucella melitensis bv. 2 str. 63/9]
 gi|260564595|ref|ZP_05835080.1| BioB protein [Brucella melitensis bv. 1 str. 16M]
 gi|260756738|ref|ZP_05869086.1| biotin synthase [Brucella abortus bv. 6 str. 870]
 gi|260760168|ref|ZP_05872516.1| biotin synthase [Brucella abortus bv. 4 str. 292]
 gi|260882553|ref|ZP_05894167.1| biotin synthase [Brucella abortus bv. 9 str. C68]
 gi|261215950|ref|ZP_05930231.1| biotin synthase [Brucella abortus bv. 3 str. Tulya]
 gi|261217115|ref|ZP_05931396.1| biotin synthase [Brucella ceti M13/05/1]
 gi|261220329|ref|ZP_05934610.1| biotin synthase [Brucella ceti B1/94]
 gi|261319326|ref|ZP_05958523.1| biotin synthase [Brucella pinnipedialis B2/94]
 gi|261319986|ref|ZP_05959183.1| biotin synthase [Brucella ceti M644/93/1]
 gi|261323257|ref|ZP_05962454.1| biotin synthase [Brucella neotomae 5K33]
 gi|261750209|ref|ZP_05993918.1| biotin synthase [Brucella suis bv. 5 str. 513]
 gi|261753482|ref|ZP_05997191.1| biotin synthase [Brucella suis bv. 3 str. 686]
 gi|265986673|ref|ZP_06099230.1| biotin synthase [Brucella pinnipedialis M292/94/1]
 gi|265989811|ref|ZP_06102368.1| biotin synthase [Brucella melitensis bv. 1 str. Rev.1]
 gi|265993080|ref|ZP_06105637.1| biotin synthase [Brucella melitensis bv. 3 str. Ether]
 gi|297249683|ref|ZP_06933384.1| biotin synthase [Brucella abortus bv. 5 str. B3196]
 gi|17984969|gb|AAL54017.1| biotin synthase [Brucella melitensis bv. 1 str. 16M]
 gi|62197837|gb|AAX76136.1| BioB, biotin synthase [Brucella abortus bv. 1 str. 9-941]
 gi|161337369|gb|ABX63673.1| biotin synthase [Brucella canis ATCC 23365]
 gi|163675378|gb|ABY39488.1| biotin synthase [Brucella suis ATCC 23445]
 gi|189021466|gb|ACD74187.1| BioB, biotin synthase [Brucella abortus S19]
 gi|225642396|gb|ACO02309.1| biotin synthase [Brucella melitensis ATCC 23457]
 gi|237788002|gb|EEP62218.1| biotin synthase [Brucella abortus str. 2308 A]
 gi|260152238|gb|EEW87331.1| BioB protein [Brucella melitensis bv. 1 str. 16M]
 gi|260670486|gb|EEX57426.1| biotin synthase [Brucella abortus bv. 4 str. 292]
 gi|260676846|gb|EEX63667.1| biotin synthase [Brucella abortus bv. 6 str. 870]
 gi|260872081|gb|EEX79150.1| biotin synthase [Brucella abortus bv. 9 str. C68]
 gi|260917557|gb|EEX84418.1| biotin synthase [Brucella abortus bv. 3 str. Tulya]
 gi|260918913|gb|EEX85566.1| biotin synthase [Brucella ceti B1/94]
 gi|260922204|gb|EEX88772.1| biotin synthase [Brucella ceti M13/05/1]
 gi|261292676|gb|EEX96172.1| biotin synthase [Brucella ceti M644/93/1]
 gi|261298549|gb|EEY02046.1| biotin synthase [Brucella pinnipedialis B2/94]
 gi|261299237|gb|EEY02734.1| biotin synthase [Brucella neotomae 5K33]
 gi|261739962|gb|EEY27888.1| biotin synthase [Brucella suis bv. 5 str. 513]
 gi|261743235|gb|EEY31161.1| biotin synthase [Brucella suis bv. 3 str. 686]
 gi|262763950|gb|EEZ09982.1| biotin synthase [Brucella melitensis bv. 3 str. Ether]
 gi|263000480|gb|EEZ13170.1| biotin synthase [Brucella melitensis bv. 1 str. Rev.1]
 gi|263092356|gb|EEZ16609.1| BioB [Brucella melitensis bv. 2 str. 63/9]
 gi|264658870|gb|EEZ29131.1| biotin synthase [Brucella pinnipedialis M292/94/1]
 gi|297173552|gb|EFH32916.1| biotin synthase [Brucella abortus bv. 5 str. B3196]
 gi|326410654|gb|ADZ67718.1| BioB, biotin synthase [Brucella melitensis M28]
 gi|326553946|gb|ADZ88585.1| BioB, biotin synthase [Brucella melitensis M5-90]
          Length = 346

 Score =  302 bits (774), Expect = 3e-80,   Method: Composition-based stats.
 Identities = 201/308 (65%), Positives = 253/308 (82%)

Query: 18  VWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQSVH 77
            W+++E   IYN+PFNDLLF +H +HR+NF+PN IQLSKLLNIKTGGCPE+CGYC+QS  
Sbjct: 34  RWSAEEARAIYNLPFNDLLFRAHGLHRENFDPNRIQLSKLLNIKTGGCPEDCGYCSQSAS 93

Query: 78  NKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLGL 137
            ++ LKASKL+ ++ VL+EA+ AK  GATRYCMGAAWR PK+RD+  +  MI+ VK++GL
Sbjct: 94  AENGLKASKLMEIETVLEEARKAKAAGATRYCMGAAWRSPKDRDMPALTHMIESVKAMGL 153

Query: 138 ETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSGI 197
           ETCMTLGML  ++A+ L+ AGLDYYNHNIDTSERFYP V TT +FEDRL TL NVR +GI
Sbjct: 154 ETCMTLGMLDSDKAEKLADAGLDYYNHNIDTSERFYPAVITTRSFEDRLDTLANVRNAGI 213

Query: 198 KVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEHVR 257
           KVC GGILGLGE  +DRIDML+TLANL  PPES+PIN+LIP+PG++  +   VDP+E VR
Sbjct: 214 KVCSGGILGLGEEAEDRIDMLVTLANLPEPPESVPINMLIPMPGTRLAKAAPVDPLEFVR 273

Query: 258 IISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTILF 317
           ++++ARILMPKS +RL AGR  MSDE+QALCFF+GANS+F+GDTLLTA NP  ++D+ L 
Sbjct: 274 VVALARILMPKSHVRLTAGRTAMSDEMQALCFFAGANSLFMGDTLLTAANPGDDRDSSLL 333

Query: 318 NRLGLIPD 325
            RLG+  +
Sbjct: 334 RRLGIQAE 341


>gi|113866214|ref|YP_724703.1| biotin synthase [Ralstonia eutropha H16]
 gi|123033352|sp|Q0KF86|BIOB_RALEH RecName: Full=Biotin synthase
 gi|113524990|emb|CAJ91335.1| biotin synthase [Ralstonia eutropha H16]
          Length = 343

 Score =  302 bits (774), Expect = 3e-80,   Method: Composition-based stats.
 Identities = 164/318 (51%), Positives = 224/318 (70%)

Query: 8   PEENPTKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPE 67
              +       W   +V  ++ +PFNDLLF +  VHR++F+ N +QLS LL+IKTGGC E
Sbjct: 22  ARSHALPDDAAWRVDDVAALFALPFNDLLFRAQQVHREHFDANTVQLSTLLSIKTGGCEE 81

Query: 68  NCGYCNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVD 127
           +CGYC QS H+ + +KA KL+ +D+VL  A+ AK NGATR+CMGAAWR PK+R L  ++D
Sbjct: 82  DCGYCPQSAHHDAGVKAEKLMALDEVLDAARAAKANGATRFCMGAAWRSPKDRHLEPVMD 141

Query: 128 MIKGVKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQ 187
           M++ VK++GLETC+TLGML  EQAQ L +AGLDYYNHN+DTS  FY  + TT T++DRL 
Sbjct: 142 MVREVKAMGLETCVTLGMLKAEQAQQLKEAGLDYYNHNLDTSPEFYGKIITTRTYQDRLD 201

Query: 188 TLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEEN 247
           T+ +VR +GI VCCGGI+G+GE  + R  ++  LAN+   PES+PIN L+ + G+     
Sbjct: 202 TIGHVRDAGINVCCGGIVGMGEAREARAGLIAQLANMDPYPESVPINNLVQVEGTPLAGT 261

Query: 248 KKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKN 307
           + +DP E VR I+VARI MP++ +RL+AGR  M + LQALCF +GANSIF G+ LLT  N
Sbjct: 262 EALDPFEFVRTIAVARITMPRAMVRLSAGREAMDEALQALCFMAGANSIFYGEKLLTTGN 321

Query: 308 PSYNKDTILFNRLGLIPD 325
           P  ++D  L  RL +  +
Sbjct: 322 PQADRDRALLARLDIRAE 339


>gi|89073943|ref|ZP_01160449.1| putative biotin synthase [Photobacterium sp. SKA34]
 gi|89050271|gb|EAR55775.1| putative biotin synthase [Photobacterium sp. SKA34]
          Length = 350

 Score =  302 bits (774), Expect = 3e-80,   Method: Composition-based stats.
 Identities = 162/313 (51%), Positives = 229/313 (73%)

Query: 16  PKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQS 75
              WT +EV  +++ PF DL+F +  VHR+  +PN +Q+S LL+IKTG CPE+C YC QS
Sbjct: 4   RNNWTVEEVQALFDKPFMDLVFEAQQVHRQYHQPNQVQVSTLLSIKTGACPEDCKYCPQS 63

Query: 76  VHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSL 135
            H ++ +   +L+ V++VL  A  AK++GATR+CMGAAW+ PKERD+  ++DM+KGVK +
Sbjct: 64  AHYRTDVDKERLLEVERVLDAATKAKQSGATRFCMGAAWKNPKERDMPYLLDMVKGVKEM 123

Query: 136 GLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKS 195
           GLETCMTLGM++ +QA  L+ AGLDYYNHN+DTS  +Y ++ TT T++DRL TL +VR +
Sbjct: 124 GLETCMTLGMITSDQADTLAGAGLDYYNHNLDTSPEYYGNIITTRTYQDRLDTLSHVRDA 183

Query: 196 GIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEH 255
           G+K+C GGI+G+GE   DR  +L+ LANL   PES+PIN+L+ + G+  E    VDP + 
Sbjct: 184 GMKICSGGIIGMGESSRDRAGLLVELANLPVHPESVPINMLVKVKGTPLESVDDVDPFDF 243

Query: 256 VRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTI 315
           +RII+VARI+MP S +RL+AGR  M++++QALCF +GANS+F G  LLT  NP  +KD  
Sbjct: 244 IRIIAVARIIMPMSAVRLSAGREDMNEQMQALCFMAGANSVFYGCKLLTTPNPGEDKDMQ 303

Query: 316 LFNRLGLIPDLSA 328
           LF +LG+  +  A
Sbjct: 304 LFAKLGINSEQQA 316


>gi|332667149|ref|YP_004449937.1| Biotin synthase [Haliscomenobacter hydrossis DSM 1100]
 gi|332335963|gb|AEE53064.1| Biotin synthase [Haliscomenobacter hydrossis DSM 1100]
          Length = 365

 Score =  302 bits (774), Expect = 4e-80,   Method: Composition-based stats.
 Identities = 144/313 (46%), Positives = 215/313 (68%), Gaps = 1/313 (0%)

Query: 13  TKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYC 72
            +  K WT +E+ ++Y+ P  +L+F + TVHR++  P  +Q+S L+++KTGGCPE+CGYC
Sbjct: 2   AETQKHWTLEEILEVYHTPLLELVFQAATVHRQHHNPREVQISTLVSVKTGGCPEDCGYC 61

Query: 73  NQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKER-DLSIIVDMIKG 131
            Q+    + ++   +++VD V   A  A+  GA+R CMGAAWR  K+  D   ++D++K 
Sbjct: 62  PQAARYHTGVENEPMMSVDSVRSAALQAQAIGASRLCMGAAWRSVKDDADFDHVIDLVKT 121

Query: 132 VKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLEN 191
           V+ L +E C TLGML+  QAQ L+ AGL  YNHN+DTSE +Y  + +T +++DRL+TL N
Sbjct: 122 VRELDMEVCCTLGMLNEHQAQRLANAGLYAYNHNLDTSEEYYDDIISTRSYDDRLKTLSN 181

Query: 192 VRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVD 251
           VRK+ + VC GGI+G+GE ++DR  MLLTL+ L+  PESIPIN L+ + G+  E  + + 
Sbjct: 182 VRKANLTVCSGGIIGMGESVEDRCKMLLTLSQLNPIPESIPINALVAVEGTPMENIEPIP 241

Query: 252 PIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYN 311
             + +R+++  RI+MP++ +RL+AGR  MS E QALCF +GA SIF G+ LLT  NP   
Sbjct: 242 MWDIIRMVATTRIIMPQTTVRLSAGRTEMSQEGQALCFMAGAGSIFAGEKLLTTPNPDAY 301

Query: 312 KDTILFNRLGLIP 324
           +D  +FN LGL+P
Sbjct: 302 EDMDMFNALGLLP 314


>gi|294853700|ref|ZP_06794372.1| biotin synthase [Brucella sp. NVSL 07-0026]
 gi|294819355|gb|EFG36355.1| biotin synthase [Brucella sp. NVSL 07-0026]
          Length = 342

 Score =  302 bits (774), Expect = 4e-80,   Method: Composition-based stats.
 Identities = 200/308 (64%), Positives = 253/308 (82%)

Query: 18  VWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQSVH 77
            W+++E   IYN+PFNDLLF +H +HR+NF+PN IQLSKLLNIKTGGCPE+CGYC+QS  
Sbjct: 30  RWSAEEARAIYNLPFNDLLFRAHGLHRENFDPNRIQLSKLLNIKTGGCPEDCGYCSQSAS 89

Query: 78  NKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLGL 137
            ++ LKASKL+ ++ VL+EA+ AK  GATRYCMGAAWR PK+RD+  +  MI+ VK++GL
Sbjct: 90  AENGLKASKLMEIETVLEEARKAKAAGATRYCMGAAWRSPKDRDMPALTHMIESVKAMGL 149

Query: 138 ETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSGI 197
           ETCMTLGML  ++A+ L+ AGLDYYNHNIDTSERFYP V TT +FEDRL TL NVR +GI
Sbjct: 150 ETCMTLGMLDSDKAEKLADAGLDYYNHNIDTSERFYPAVITTRSFEDRLDTLANVRNAGI 209

Query: 198 KVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEHVR 257
           KVC GGILGLGE  +DRIDML+TLANL  PPES+PIN+LIP+PG++  +   VDP+E VR
Sbjct: 210 KVCSGGILGLGEEAEDRIDMLVTLANLPEPPESVPINMLIPMPGTRLAKAAPVDPLEFVR 269

Query: 258 IISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTILF 317
           ++++ARILMPKS +RL AGR  MSDE+QALCFF+GANS+F+GD+LLTA NP  ++D+ L 
Sbjct: 270 VVALARILMPKSHVRLTAGRTAMSDEMQALCFFAGANSLFMGDSLLTAANPGDDRDSSLL 329

Query: 318 NRLGLIPD 325
            RLG+  +
Sbjct: 330 RRLGIQAE 337


>gi|323497864|ref|ZP_08102875.1| biotin synthase [Vibrio sinaloensis DSM 21326]
 gi|323317092|gb|EGA70092.1| biotin synthase [Vibrio sinaloensis DSM 21326]
          Length = 350

 Score =  302 bits (774), Expect = 4e-80,   Method: Composition-based stats.
 Identities = 160/308 (51%), Positives = 228/308 (74%)

Query: 16  PKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQS 75
              WT  +V ++ + PF DLLF +  VHR+  + NH+Q+S LL+IKTG CPE+C YC QS
Sbjct: 4   RHNWTVGQVRELMDKPFMDLLFEAQLVHRQYQQHNHVQVSTLLSIKTGACPEDCKYCPQS 63

Query: 76  VHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSL 135
               + ++  +L+ V++VL  A+ AK  G+TR+CMGAAW+ PK RD+  + DMI GVK +
Sbjct: 64  ARYTTDIEKERLMEVERVLDAAQKAKNAGSTRFCMGAAWKNPKARDMPYLRDMISGVKGM 123

Query: 136 GLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKS 195
           GLETCMTLGML+ +QA+ L+ AGLDYYNHN+DTS  FY  + TT T++DRL TL +VR +
Sbjct: 124 GLETCMTLGMLTSDQAKELADAGLDYYNHNLDTSPEFYGSIITTRTYQDRLDTLSHVRDA 183

Query: 196 GIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEH 255
           G+K+C GGI+G+GE  +DR  +L+ LANL T PES+PIN+L+ + G+  E+   V+P + 
Sbjct: 184 GMKICSGGIIGMGESANDRAGLLVELANLPTHPESVPINMLVKVKGTPLEKVDDVEPFDF 243

Query: 256 VRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTI 315
           +R+I++ARI+MPKS +RL+AGR  M++++QALCF +GANS+F G  LLT  NPS +KD +
Sbjct: 244 IRLIAIARIMMPKSAVRLSAGRENMNEQMQALCFMAGANSVFYGCKLLTTPNPSEDKDMM 303

Query: 316 LFNRLGLI 323
           LF++LG+ 
Sbjct: 304 LFDKLGIN 311


>gi|112361517|gb|ABI15616.1| biotin synthase [consortium cosmid clone pGZ1]
          Length = 340

 Score =  302 bits (774), Expect = 4e-80,   Method: Composition-based stats.
 Identities = 165/306 (53%), Positives = 219/306 (71%)

Query: 18  VWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQSVH 77
            W   +V  ++ +PF  LL+ +  VHR+ F+ N IQLS LL+IKTGGC E+CGYC QS H
Sbjct: 23  RWRVADVEALFELPFVHLLYRAQQVHREFFDANEIQLSTLLSIKTGGCTEDCGYCPQSAH 82

Query: 78  NKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLGL 137
             + + A KLI + +V++ A+ A+E GATR+CMGAAWR PKERD+  + +MI+ V+SLGL
Sbjct: 83  FDTGVPAGKLIALAEVVQAAQAARERGATRFCMGAAWRSPKERDMERVTEMIRAVRSLGL 142

Query: 138 ETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSGI 197
           ETCMTLGML   QA+ L  AGLDYYNHN+D++  FY  V +T T++DRL TLE+VR++GI
Sbjct: 143 ETCMTLGMLDATQARALRDAGLDYYNHNLDSAPGFYGRVVSTRTYQDRLDTLEHVREAGI 202

Query: 198 KVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEHVR 257
            VCCGGI+G+GE   +R  ++  LANL   PES+PIN L+ + G+    ++ +DP E VR
Sbjct: 203 SVCCGGIVGMGETRGERAALIAQLANLDPYPESVPINHLVRVEGTPMAGSEPLDPFEFVR 262

Query: 258 IISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTILF 317
            I+ ARI MP++ +RL+AGR  MSD +QALCF +GANSIF GD LLT  NP   +D  LF
Sbjct: 263 TIAAARITMPRALVRLSAGREQMSDAVQALCFAAGANSIFYGDRLLTTSNPQAVRDRALF 322

Query: 318 NRLGLI 323
            RLGL 
Sbjct: 323 QRLGLQ 328


>gi|260544874|ref|ZP_05820695.1| BioB protein [Brucella abortus NCTC 8038]
 gi|260568207|ref|ZP_05838676.1| BioB protein [Brucella suis bv. 4 str. 40]
 gi|260763406|ref|ZP_05875738.1| biotin synthase [Brucella abortus bv. 2 str. 86/8/59]
 gi|261313436|ref|ZP_05952633.1| biotin synthase [Brucella pinnipedialis M163/99/10]
 gi|265996324|ref|ZP_06108881.1| biotin synthase [Brucella ceti M490/95/1]
 gi|260098145|gb|EEW82019.1| BioB protein [Brucella abortus NCTC 8038]
 gi|260154872|gb|EEW89953.1| BioB protein [Brucella suis bv. 4 str. 40]
 gi|260673827|gb|EEX60648.1| biotin synthase [Brucella abortus bv. 2 str. 86/8/59]
 gi|261302462|gb|EEY05959.1| biotin synthase [Brucella pinnipedialis M163/99/10]
 gi|262550621|gb|EEZ06782.1| biotin synthase [Brucella ceti M490/95/1]
          Length = 342

 Score =  302 bits (774), Expect = 4e-80,   Method: Composition-based stats.
 Identities = 201/308 (65%), Positives = 253/308 (82%)

Query: 18  VWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQSVH 77
            W+++E   IYN+PFNDLLF +H +HR+NF+PN IQLSKLLNIKTGGCPE+CGYC+QS  
Sbjct: 30  RWSAEEARAIYNLPFNDLLFRAHGLHRENFDPNRIQLSKLLNIKTGGCPEDCGYCSQSAS 89

Query: 78  NKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLGL 137
            ++ LKASKL+ ++ VL+EA+ AK  GATRYCMGAAWR PK+RD+  +  MI+ VK++GL
Sbjct: 90  AENGLKASKLMEIETVLEEARKAKAAGATRYCMGAAWRSPKDRDMPALTHMIESVKAMGL 149

Query: 138 ETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSGI 197
           ETCMTLGML  ++A+ L+ AGLDYYNHNIDTSERFYP V TT +FEDRL TL NVR +GI
Sbjct: 150 ETCMTLGMLDSDKAEKLADAGLDYYNHNIDTSERFYPAVITTRSFEDRLDTLANVRNAGI 209

Query: 198 KVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEHVR 257
           KVC GGILGLGE  +DRIDML+TLANL  PPES+PIN+LIP+PG++  +   VDP+E VR
Sbjct: 210 KVCSGGILGLGEEAEDRIDMLVTLANLPEPPESVPINMLIPMPGTRLAKAAPVDPLEFVR 269

Query: 258 IISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTILF 317
           ++++ARILMPKS +RL AGR  MSDE+QALCFF+GANS+F+GDTLLTA NP  ++D+ L 
Sbjct: 270 VVALARILMPKSHVRLTAGRTAMSDEMQALCFFAGANSLFMGDTLLTAANPGDDRDSSLL 329

Query: 318 NRLGLIPD 325
            RLG+  +
Sbjct: 330 RRLGIQAE 337


>gi|239815123|ref|YP_002944033.1| biotin synthase [Variovorax paradoxus S110]
 gi|239801700|gb|ACS18767.1| biotin synthase [Variovorax paradoxus S110]
          Length = 342

 Score =  302 bits (774), Expect = 4e-80,   Method: Composition-based stats.
 Identities = 162/325 (49%), Positives = 218/325 (67%), Gaps = 7/325 (2%)

Query: 11  NPTKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCG 70
            P      WT + +  + + P  DLLF + TVHR++F    I+L+ LL++KTGGCPENCG
Sbjct: 17  KPVTPQGPWTIEAIQALLDKPLMDLLFEAQTVHRQHFPEGDIELATLLSVKTGGCPENCG 76

Query: 71  YCNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIK 130
           YC QS    + +KA KL+ VD+V++ A+ AK+ GATR+CMGAAWR PK+RD+  +  +++
Sbjct: 77  YCPQSAEFDTGVKAQKLMEVDEVVRAAQAAKDAGATRFCMGAAWRAPKDRDVEKVAVLVE 136

Query: 131 GVKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLE 190
            VK LGL+TC TLGML    A  L  AGLDYYNHN+DT+  +Y  V  T T++DRL TL 
Sbjct: 137 AVKGLGLQTCATLGMLEPHHAHQLKAAGLDYYNHNLDTAPEYYTDVVDTRTYQDRLDTLA 196

Query: 191 NVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKV 250
           +VR +GI VCCGGI+G+GE    R  ++  LANL   PES+PIN L+ +PG+   +++ V
Sbjct: 197 HVRSAGISVCCGGIVGMGEQPVHRAGLIAQLANLDPYPESVPINSLVRVPGTPLADSEPV 256

Query: 251 DPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSY 310
           DP + VR+I+VARI MP +R+RL+AGR  M D +QALCF +GANSIF GD LL   NP  
Sbjct: 257 DPFDFVRMIAVARITMPTARVRLSAGRQQMGDAVQALCFMAGANSIFYGDKLLVTGNPDV 316

Query: 311 NKDTILFNRLGL-------IPDLSA 328
             DT+L  +LGL        P+  A
Sbjct: 317 EADTVLLRKLGLNARQVQEQPEGCA 341


>gi|163857976|ref|YP_001632274.1| biotin synthase [Bordetella petrii DSM 12804]
 gi|254810569|sp|A9I023|BIOB_BORPD RecName: Full=Biotin synthase
 gi|163261704|emb|CAP44006.1| biotin synthase [Bordetella petrii]
          Length = 340

 Score =  302 bits (773), Expect = 4e-80,   Method: Composition-based stats.
 Identities = 160/307 (52%), Positives = 215/307 (70%)

Query: 19  WTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQSVHN 78
           W + +V  +Y +PF DLL+ +  VHR++F+ + IQLS LL+IKTGGCPE+C YC QS H 
Sbjct: 22  WQADDVLALYELPFMDLLYRAQQVHRQHFDASAIQLSSLLSIKTGGCPEDCAYCPQSAHY 81

Query: 79  KSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLGLE 138
            + L A KL+ ++ VL+ A+ A+  GA R+CMGAAWR PK   L  + +MI+ VK+LGLE
Sbjct: 82  DTGLAADKLMPLEDVLQAARAAQAGGAQRFCMGAAWRSPKPHHLDEVAEMIRAVKALGLE 141

Query: 139 TCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSGIK 198
           TC+TLGML   QA+ L +AGLDYYNHN+DTS  FY  + +T T++DRL TL  VR +G+ 
Sbjct: 142 TCVTLGMLRDGQAEQLKEAGLDYYNHNLDTSPEFYGSIISTRTYQDRLDTLARVRDAGLN 201

Query: 199 VCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEHVRI 258
           VCCGGI+G+GE   +R  ++  LA+L   PES+PIN L+ + G+     + +DP E VR 
Sbjct: 202 VCCGGIVGMGESRRERAGLIAQLASLDPYPESVPINNLVQVEGTPLAGTEALDPFEFVRT 261

Query: 259 ISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTILFN 318
           I+VARI+MP +R+RL+AGR  MSD LQALCF +GANS+F GD LLT  NP    D  L  
Sbjct: 262 IAVARIVMPLARVRLSAGRETMSDTLQALCFLAGANSLFCGDVLLTTGNPQVEADQRLLE 321

Query: 319 RLGLIPD 325
           RLG+  +
Sbjct: 322 RLGMHAE 328


>gi|258542253|ref|YP_003187686.1| biotin synthase [Acetobacter pasteurianus IFO 3283-01]
 gi|256633331|dbj|BAH99306.1| biotin synthase [Acetobacter pasteurianus IFO 3283-01]
 gi|256636390|dbj|BAI02359.1| biotin synthase [Acetobacter pasteurianus IFO 3283-03]
 gi|256639443|dbj|BAI05405.1| biotin synthase [Acetobacter pasteurianus IFO 3283-07]
 gi|256642499|dbj|BAI08454.1| biotin synthase [Acetobacter pasteurianus IFO 3283-22]
 gi|256645554|dbj|BAI11502.1| biotin synthase [Acetobacter pasteurianus IFO 3283-26]
 gi|256648607|dbj|BAI14548.1| biotin synthase [Acetobacter pasteurianus IFO 3283-32]
 gi|256651660|dbj|BAI17594.1| biotin synthase [Acetobacter pasteurianus IFO 3283-01-42C]
 gi|256654651|dbj|BAI20578.1| biotin synthase [Acetobacter pasteurianus IFO 3283-12]
          Length = 336

 Score =  302 bits (773), Expect = 5e-80,   Method: Composition-based stats.
 Identities = 170/311 (54%), Positives = 223/311 (71%)

Query: 13  TKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYC 72
           ++    WT  EV  + ++PF +L+F + T+HR  F+P  IQ+S LL+IKTGGCPE+C YC
Sbjct: 17  SEVRHDWTVAEVQALLDLPFPELMFRAQTLHRATFDPTEIQISTLLSIKTGGCPEDCAYC 76

Query: 73  NQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGV 132
            QS  ++  +KA KL+ V+ VL EAK AK  GA+R+CMGAAWR PKERDL  +  MI+GV
Sbjct: 77  PQSAKHEQGVKADKLMAVEAVLTEAKKAKAAGASRFCMGAAWRSPKERDLDTVCAMIEGV 136

Query: 133 KSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENV 192
           K LG+ETC+TLGML   QA  L  AGLDYYNHN+DTS  +Y  + +T T+++RL TL NV
Sbjct: 137 KQLGMETCVTLGMLDNAQAHKLHDAGLDYYNHNLDTSPEYYGEIISTRTYQERLDTLSNV 196

Query: 193 RKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDP 252
           R +GI VCCGGI+GLGE   DR  ++  LA LS  PES+PINLL+ + G+   +  +V+P
Sbjct: 197 RDAGINVCCGGIVGLGENESDRAGLITALATLSAHPESVPINLLVKVEGTPLAKADEVEP 256

Query: 253 IEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNK 312
           ++ VR+I+ ARI MPKSR+RLAAGR  MSDE QALCF +GANSIF G+ LLT  NP   +
Sbjct: 257 LDFVRMIAAARITMPKSRVRLAAGRENMSDETQALCFLAGANSIFYGERLLTTPNPQATR 316

Query: 313 DTILFNRLGLI 323
           D  L ++LG+ 
Sbjct: 317 DRALLDKLGMH 327


>gi|170717735|ref|YP_001784805.1| biotin synthase [Haemophilus somnus 2336]
 gi|254810713|sp|B0UUK6|BIOB_HAES2 RecName: Full=Biotin synthase
 gi|168825864|gb|ACA31235.1| biotin synthase [Haemophilus somnus 2336]
          Length = 327

 Score =  302 bits (773), Expect = 5e-80,   Method: Composition-based stats.
 Identities = 153/319 (47%), Positives = 217/319 (68%)

Query: 7   VPEENPTKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCP 66
           +P   P    + W+  +V  ++  PF +L++ +  VHRK+F P  IQLS L++IKTGGCP
Sbjct: 8   IPSLTPHPCVEYWSVCKVEALFETPFLELVYQAAQVHRKHFNPQTIQLSTLMSIKTGGCP 67

Query: 67  ENCGYCNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIV 126
           E+C YC QS    + ++  +L+ V++++++AK AK  GA R+CMGAAWR PK +D+  I 
Sbjct: 68  EDCSYCPQSARYHTGVQNQQLLCVEEIVEKAKIAKSRGAGRFCMGAAWRGPKPKDIGKIT 127

Query: 127 DMIKGVKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRL 186
           ++IK VK LGLETC T G+L    A+ L +AGLDYYNHNIDT+   Y  +  T  F+DRL
Sbjct: 128 EIIKAVKDLGLETCGTFGLLQDGMAEELKEAGLDYYNHNIDTAPEHYKEIIGTRDFDDRL 187

Query: 187 QTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEE 246
            TL  +RK+G+KVCCGGI+G+ E   +R  ++ +LANL   PES+PIN L+ + G+   +
Sbjct: 188 NTLGKIRKAGLKVCCGGIVGMNETRKERAGLIASLANLDPQPESVPINQLVKVEGTPLAD 247

Query: 247 NKKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAK 306
            +++D  E VR I+VARI MPKS +RL+AGR  MS+E+QA+CF +GANSIF GD LL   
Sbjct: 248 AQELDWTEFVRTIAVARITMPKSYVRLSAGRQGMSEEMQAMCFMAGANSIFYGDKLLVTV 307

Query: 307 NPSYNKDTILFNRLGLIPD 325
           NP  + D +L  +L L P+
Sbjct: 308 NPEEDGDQLLMAKLDLKPE 326


>gi|301169778|emb|CBW29379.1| biotin synthase [Haemophilus influenzae 10810]
          Length = 333

 Score =  302 bits (773), Expect = 5e-80,   Method: Composition-based stats.
 Identities = 153/327 (46%), Positives = 221/327 (67%)

Query: 1   MSRSTVVPEENPTKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNI 60
           ++    +    P    + W+  +V  ++  PF +L++ +  VHRK+F P  IQLS L++I
Sbjct: 2   LAEKLQINSITPHPSVEYWSVCKVEALFETPFLELVYRATQVHRKHFNPRVIQLSTLMSI 61

Query: 61  KTGGCPENCGYCNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKER 120
           KTGGCPE+C YC QS    + ++  +L++VD+++ +AK AK  GA R+CMGAAWR PK +
Sbjct: 62  KTGGCPEDCSYCPQSARYHTGVQNQQLLDVDEIVAKAKIAKARGAGRFCMGAAWRGPKPK 121

Query: 121 DLSIIVDMIKGVKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTH 180
           D+  + ++IK VKSLGLETC T G+L    A+ L +AGLDYYNHN+DT+   Y  V  T 
Sbjct: 122 DIEKVTEIIKAVKSLGLETCGTFGLLQDGMAEDLKEAGLDYYNHNLDTAPEHYAEVIGTR 181

Query: 181 TFEDRLQTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIP 240
            F+DRL TL  VRK+G+KVCCGGI+G+ E   +R  ++ +LANL   PES+PIN L+ + 
Sbjct: 182 RFDDRLSTLGKVRKAGLKVCCGGIVGMNETRKERAGLIASLANLDPQPESVPINQLVKVE 241

Query: 241 GSKFEENKKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGD 300
           G+   + +++D  E VR I+VARI MPKS +RL+AGR+ M++E+QA+CF +GANSIF GD
Sbjct: 242 GTPLADAEELDWTEFVRTIAVARITMPKSYVRLSAGRSGMTEEMQAMCFMAGANSIFYGD 301

Query: 301 TLLTAKNPSYNKDTILFNRLGLIPDLS 327
            LL   NP  + D +L  +L L P+ +
Sbjct: 302 KLLVTDNPEEDGDQLLMAKLDLEPETA 328


>gi|325577904|ref|ZP_08148137.1| biotin synthase [Haemophilus parainfluenzae ATCC 33392]
 gi|325160334|gb|EGC72461.1| biotin synthase [Haemophilus parainfluenzae ATCC 33392]
          Length = 338

 Score =  302 bits (773), Expect = 5e-80,   Method: Composition-based stats.
 Identities = 152/327 (46%), Positives = 221/327 (67%), Gaps = 2/327 (0%)

Query: 1   MSRSTVVPEENPTKKP--KVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLL 58
           M+ + VV   + T  P  + W+  +V  ++  PF +L++ +  VHR++F P  IQLS L+
Sbjct: 1   MTTTNVVQLSSITPHPSVEYWSVCKVEALFETPFLELVYRAAQVHREHFNPGAIQLSTLM 60

Query: 59  NIKTGGCPENCGYCNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPK 118
           +IKTGGCPE+CGYC QS   ++ ++  +++++D+++++AK AK  GA R+CMGAAWR PK
Sbjct: 61  SIKTGGCPEDCGYCPQSARYQTGVQNQQILDIDEIVEKAKIAKARGAGRFCMGAAWRGPK 120

Query: 119 ERDLSIIVDMIKGVKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTT 178
            +D+  +  +I+ VK +GLETC T G+L    A+ L  AGLDYYNHN+DT+   Y +V  
Sbjct: 121 PKDMEKVTAIIRAVKDIGLETCGTFGLLQDGMAEELKDAGLDYYNHNLDTAPENYHNVIG 180

Query: 179 THTFEDRLQTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIP 238
           T  F+DRL TL  VR +G+KVCCGGI+G+ E   +R  ++ +LANL   PES+PIN L+ 
Sbjct: 181 TRRFDDRLSTLGKVRHAGLKVCCGGIVGMNETRKERAGLIASLANLDPQPESVPINQLVK 240

Query: 239 IPGSKFEENKKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFV 298
           + G+   +   +D  E VR I+VARI MPKS +RL+AGR  MS+E+QA+CF +GANSIF 
Sbjct: 241 VEGTPMADAADLDWTEFVRTIAVARITMPKSYVRLSAGRQGMSEEMQAMCFMAGANSIFY 300

Query: 299 GDTLLTAKNPSYNKDTILFNRLGLIPD 325
           GD LL   NP  + D +L  +L L P+
Sbjct: 301 GDKLLVTGNPEEDGDQLLMAKLDLEPE 327


>gi|300311762|ref|YP_003775854.1| biotin synthase [Herbaspirillum seropedicae SmR1]
 gi|300074547|gb|ADJ63946.1| biotin synthase protein [Herbaspirillum seropedicae SmR1]
          Length = 347

 Score =  302 bits (773), Expect = 5e-80,   Method: Composition-based stats.
 Identities = 157/304 (51%), Positives = 214/304 (70%), Gaps = 1/304 (0%)

Query: 21  SKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQSVHNK- 79
              V  ++ +PF DLL+ + TVHR++   N +QLS LL+IKTGGC E+CGYC QS H+K 
Sbjct: 38  RDAVAALFELPFLDLLYQAQTVHRQHHPANQVQLSSLLSIKTGGCAEDCGYCAQSAHHKE 97

Query: 80  SKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLGLET 139
           + + A KL+ VD+V++ A+ A++ GATR+CMGAAWR PKERD+  + +M+  V++LGLET
Sbjct: 98  AGVPAGKLMAVDEVVQAARAARDQGATRFCMGAAWRNPKERDMPALTEMVSQVRALGLET 157

Query: 140 CMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSGIKV 199
           CMTLGML   QA+ L +AGLDYYNHN+DT+  FY  V +T +++DRL TLE V  +G+ V
Sbjct: 158 CMTLGMLEQAQAEALKEAGLDYYNHNLDTAPDFYGQVISTRSYQDRLDTLERVHLAGLSV 217

Query: 200 CCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEHVRII 259
           CCGGI+G+GE    R  ++  LA L  PP+S+PIN L+PI G+  ++   +D  E VR +
Sbjct: 218 CCGGIIGMGESRAQRAGLIAQLAALPVPPQSVPINHLVPIAGTPLQDVPALDEFEFVRTV 277

Query: 260 SVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTILFNR 319
           +VARI +P + +RL+AGR  MSD  QALCF +GANSIF+G  LLT  N   + D  L  R
Sbjct: 278 AVARIALPHAVIRLSAGRESMSDATQALCFAAGANSIFLGSKLLTTPNAPVSSDLDLLAR 337

Query: 320 LGLI 323
           LGL 
Sbjct: 338 LGLQ 341


>gi|254810642|sp|Q7VVF1|BIOB_BORPE RecName: Full=Biotin synthase
          Length = 335

 Score =  302 bits (773), Expect = 5e-80,   Method: Composition-based stats.
 Identities = 156/309 (50%), Positives = 213/309 (68%)

Query: 17  KVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQSV 76
           + W    V +++ +PF DLL  +  VHR++F+ N +QLS LL+IKTGGCPE+C YC QS 
Sbjct: 18  ERWPLAAVAELFELPFLDLLHRAQQVHRQHFDANTVQLSSLLSIKTGGCPEDCAYCPQSA 77

Query: 77  HNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLG 136
           H  + + A KL+ +D+V++ A+ A+ NGA R+CMGAAWR PK   L  + +MI  VK+LG
Sbjct: 78  HYDTGVDADKLMPLDEVVRAARAAQANGAQRFCMGAAWRSPKPHHLEAVAEMIGAVKALG 137

Query: 137 LETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSG 196
           +ETC+TLGML   QA+ L  AGLDYYNHN+DT+  FY  + +T T++DRL TL+ VR++G
Sbjct: 138 METCVTLGMLRDGQAEQLKAAGLDYYNHNLDTAPEFYGKIISTRTYQDRLDTLQQVREAG 197

Query: 197 IKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEHV 256
           I VCCGGI+G+GE   DR  ++  L N+   PES+PIN L+ + G+     + +DP E +
Sbjct: 198 INVCCGGIVGMGESRRDRAGLVAQLTNMEPYPESVPINNLVQVEGTPLAGAETLDPFEFI 257

Query: 257 RIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTIL 316
           R I+VARI MP +++RL+AGR  MSD  QALCF +GANSIF GD LLT  NP    D  L
Sbjct: 258 RTIAVARITMPLAKVRLSAGRETMSDSEQALCFMAGANSIFYGDVLLTTGNPQVEADRRL 317

Query: 317 FNRLGLIPD 325
             RLG+  +
Sbjct: 318 LQRLGMRAE 326


>gi|90408627|ref|ZP_01216781.1| putative biotin synthase [Psychromonas sp. CNPT3]
 gi|90310271|gb|EAS38402.1| putative biotin synthase [Psychromonas sp. CNPT3]
          Length = 347

 Score =  302 bits (773), Expect = 5e-80,   Method: Composition-based stats.
 Identities = 160/310 (51%), Positives = 220/310 (70%)

Query: 16  PKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQS 75
              W   EV  ++++PF DLLF + T+HR +F  N +Q+S LL+IKTG CPE+C YC QS
Sbjct: 4   RHDWKVSEVDSLFSIPFMDLLFEAQTIHRAHFPKNEVQVSTLLSIKTGACPEDCKYCPQS 63

Query: 76  VHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSL 135
               + L    L+ V++VL+ AK+AK  G+TR+CMGAAW+ PK RD+  +V MI+ VK+L
Sbjct: 64  ARYSTGLAKESLMEVEKVLQAAKDAKATGSTRFCMGAAWKNPKARDMPYLVQMIQEVKAL 123

Query: 136 GLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKS 195
           GLE+CMTLGML+  QA  L++AGLDYYNHN+DTS  +Y  + TT T++DRL TL+NVR +
Sbjct: 124 GLESCMTLGMLNKGQATELAQAGLDYYNHNLDTSPEYYKQIITTRTYQDRLDTLDNVRHA 183

Query: 196 GIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEH 255
           G+KVC GGI+GLGE   DR  +L+ LAN++  PES+PIN L+ + G+  E  + +D    
Sbjct: 184 GMKVCSGGIVGLGEQSTDRSALLVQLANMAIHPESVPINKLVKVAGTPLENVEDLDDFIF 243

Query: 256 VRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTI 315
           ++ I++ARI+MPKS +RL+AGR  MS++ QALCF +GANSIF G  LLT  NP  N D  
Sbjct: 244 IKTIAIARIMMPKSHVRLSAGRDDMSEQTQALCFMAGANSIFYGCKLLTTANPDENSDMR 303

Query: 316 LFNRLGLIPD 325
           LF +LG+  +
Sbjct: 304 LFKKLGINKE 313


>gi|302381152|ref|YP_003816975.1| biotin synthase [Brevundimonas subvibrioides ATCC 15264]
 gi|302191780|gb|ADK99351.1| biotin synthase [Brevundimonas subvibrioides ATCC 15264]
          Length = 341

 Score =  302 bits (773), Expect = 5e-80,   Method: Composition-based stats.
 Identities = 166/322 (51%), Positives = 221/322 (68%), Gaps = 4/322 (1%)

Query: 8   PEENPTKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPE 67
              + +     WT  EV  ++  PF +L+F + TVHR+ F+P+ +Q S+LL+IKTGGC E
Sbjct: 11  ALADLSVPRHDWTLSEVEALFARPFMELVFAAATVHRRWFDPSEVQKSQLLSIKTGGCAE 70

Query: 68  NCGYCNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVD 127
           NCGYC+QS    + LKA KL++   VL EA  AK  GA+R+CMGAAWRE K+RD   +  
Sbjct: 71  NCGYCSQSASFDTGLKAEKLMDTTAVLAEAMAAKAGGASRFCMGAAWRELKDRDTPKLAA 130

Query: 128 MIKGVKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQ 187
           MI GVK+LGLETC TLGML+ +QA+ L  AGLDYYNHN+DT   +Y  V TT T++DRL 
Sbjct: 131 MISGVKALGLETCATLGMLTADQARQLKAAGLDYYNHNLDTGPDYYAEVVTTRTYQDRLD 190

Query: 188 TLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEEN 247
           TLE+VR +G+  CCGGI+G+GE   DR  +L  LA L   P+S+P+N L+P+ G+   E 
Sbjct: 191 TLEHVRDAGMSTCCGGIVGMGERRRDRAGLLHALATLPVHPDSLPVNALVPVTGTPLGER 250

Query: 248 K----KVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLL 303
                ++DPIE VR ++VAR++ PK+ +RL+AGR  MS E+QALCF +GANSIFVG  LL
Sbjct: 251 VLQSGEIDPIEFVRTVAVARLVCPKAMVRLSAGRETMSPEMQALCFLAGANSIFVGGKLL 310

Query: 304 TAKNPSYNKDTILFNRLGLIPD 325
           T  NP  ++D  LF+ L L P 
Sbjct: 311 TTPNPEQDEDARLFSLLDLRPM 332


>gi|16272956|ref|NP_439182.1| biotin synthetase [Haemophilus influenzae Rd KW20]
 gi|68249595|ref|YP_248707.1| biotin synthase [Haemophilus influenzae 86-028NP]
 gi|145632396|ref|ZP_01788131.1| thiamin transporter membrane protein [Haemophilus influenzae 3655]
 gi|145636527|ref|ZP_01792195.1| Biotin synthase [Haemophilus influenzae PittHH]
 gi|145638159|ref|ZP_01793769.1| Biotin synthase [Haemophilus influenzae PittII]
 gi|145640689|ref|ZP_01796272.1| thiamin transporter membrane protein [Haemophilus influenzae R3021]
 gi|148826346|ref|YP_001291099.1| biotin synthase [Haemophilus influenzae PittEE]
 gi|229843930|ref|ZP_04464071.1| Biotin synthase [Haemophilus influenzae 6P18H1]
 gi|229846068|ref|ZP_04466180.1| Biotin synthase [Haemophilus influenzae 7P49H1]
 gi|260580111|ref|ZP_05847941.1| biotin synthase [Haemophilus influenzae RdAW]
 gi|1168665|sp|P44987|BIOB_HAEIN RecName: Full=Biotin synthase
 gi|81335976|sp|Q4QLQ0|BIOB_HAEI8 RecName: Full=Biotin synthase
 gi|254810710|sp|A5UD65|BIOB_HAEIE RecName: Full=Biotin synthase
 gi|1574054|gb|AAC22682.1| biotin synthetase (bioB) [Haemophilus influenzae Rd KW20]
 gi|68057794|gb|AAX88047.1| Biotin synthase [Haemophilus influenzae 86-028NP]
 gi|144987303|gb|EDJ93833.1| thiamin transporter membrane protein [Haemophilus influenzae 3655]
 gi|145270352|gb|EDK10287.1| Biotin synthase [Haemophilus influenzae PittHH]
 gi|145272488|gb|EDK12395.1| Biotin synthase [Haemophilus influenzae PittII]
 gi|145274615|gb|EDK14478.1| thiamin transporter membrane protein [Haemophilus influenzae
           22.4-21]
 gi|148716506|gb|ABQ98716.1| Biotin synthase [Haemophilus influenzae PittEE]
 gi|229811072|gb|EEP46789.1| Biotin synthase [Haemophilus influenzae 7P49H1]
 gi|229812924|gb|EEP48612.1| Biotin synthase [Haemophilus influenzae 6P18H1]
 gi|260093395|gb|EEW77328.1| biotin synthase [Haemophilus influenzae RdAW]
 gi|309751316|gb|ADO81300.1| Biotin synthetase [Haemophilus influenzae R2866]
          Length = 333

 Score =  302 bits (772), Expect = 7e-80,   Method: Composition-based stats.
 Identities = 153/327 (46%), Positives = 221/327 (67%)

Query: 1   MSRSTVVPEENPTKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNI 60
           ++    +    P    + W+  +V  ++  PF +L++ +  VHRK+F P  IQLS L++I
Sbjct: 2   LAEKLQINSITPHPSVEYWSVCKVEALFETPFLELVYRATQVHRKHFNPRAIQLSTLMSI 61

Query: 61  KTGGCPENCGYCNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKER 120
           KTGGCPE+C YC QS    + ++  +L++VD+++ +AK AK  GA R+CMGAAWR PK +
Sbjct: 62  KTGGCPEDCSYCPQSARYHTGVQNQQLLDVDEIVAKAKIAKARGAGRFCMGAAWRGPKPK 121

Query: 121 DLSIIVDMIKGVKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTH 180
           D+  + ++IK VKSLGLETC T G+L    A+ L +AGLDYYNHN+DT+   Y  V  T 
Sbjct: 122 DIEKVTEIIKAVKSLGLETCGTFGLLQDGMAEDLKEAGLDYYNHNLDTAPEHYAEVIGTR 181

Query: 181 TFEDRLQTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIP 240
            F+DRL TL  VRK+G+KVCCGGI+G+ E   +R  ++ +LANL   PES+PIN L+ + 
Sbjct: 182 RFDDRLSTLGKVRKAGLKVCCGGIVGMNETRKERAGLIASLANLDPQPESVPINQLVKVE 241

Query: 241 GSKFEENKKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGD 300
           G+   + +++D  E VR I+VARI MPKS +RL+AGR+ M++E+QA+CF +GANSIF GD
Sbjct: 242 GTPLADAEELDWTEFVRTIAVARITMPKSYVRLSAGRSGMTEEMQAMCFMAGANSIFYGD 301

Query: 301 TLLTAKNPSYNKDTILFNRLGLIPDLS 327
            LL   NP  + D +L  +L L P+ +
Sbjct: 302 KLLVTDNPEEDGDQLLMAKLDLEPETA 328


>gi|75674442|ref|YP_316863.1| biotin synthase [Nitrobacter winogradskyi Nb-255]
 gi|123732161|sp|Q3SW30|BIOB_NITWN RecName: Full=Biotin synthase
 gi|74419312|gb|ABA03511.1| biotin synthase [Nitrobacter winogradskyi Nb-255]
          Length = 341

 Score =  302 bits (772), Expect = 7e-80,   Method: Composition-based stats.
 Identities = 171/311 (54%), Positives = 230/311 (73%), Gaps = 1/311 (0%)

Query: 13  TKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYC 72
            +    WT  E   +Y  PF DLLF + T+HR++F+PNH++ + LL+IKTGGCPE+CGYC
Sbjct: 16  ARPRHDWTRVEAETLYTTPFPDLLFQAQTIHRRHFDPNHVETASLLSIKTGGCPEDCGYC 75

Query: 73  NQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGV 132
            QS H  + +KA+KL++ D VL+ A+ AK+ GA R+CM AAWR PK+RDL  + DMI  V
Sbjct: 76  AQSAHYDAGVKATKLMDKDAVLETARRAKDAGAGRFCMAAAWRHPKDRDLDRVCDMISAV 135

Query: 133 KSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENV 192
           K+LG+ETC TLGML+ EQA+ L +AGLD+YNHN+DTS  FY  + TT T +DR++TL   
Sbjct: 136 KALGMETCATLGMLTPEQARRLQEAGLDFYNHNVDTSPEFYDKIITTRTMQDRIETLACA 195

Query: 193 RKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEE-NKKVD 251
           R++G+K+CCGGI+G+GE + DR+ ML+ LANL   PES+PINL   + G    +   + D
Sbjct: 196 REAGLKLCCGGIIGMGEQVGDRLGMLILLANLDEHPESVPINLWNEVRGVPVNDTADRPD 255

Query: 252 PIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYN 311
           PI  VR+I+VARI+MPKS +RL+AGR  M+DELQALCF +GANSIF+GD LLT KNP+  
Sbjct: 256 PIALVRMIAVARIMMPKSVVRLSAGRQYMTDELQALCFVAGANSIFIGDVLLTTKNPATL 315

Query: 312 KDTILFNRLGL 322
           +D  L +RLG+
Sbjct: 316 RDAALLDRLGM 326


>gi|56417047|ref|YP_154121.1| biotin synthase [Anaplasma marginale str. St. Maries]
 gi|222475415|ref|YP_002563832.1| biotin synthase (bioB) [Anaplasma marginale str. Florida]
 gi|254995228|ref|ZP_05277418.1| biotin synthase (bioB) [Anaplasma marginale str. Mississippi]
 gi|255003403|ref|ZP_05278367.1| biotin synthase (bioB) [Anaplasma marginale str. Puerto Rico]
 gi|255004524|ref|ZP_05279325.1| biotin synthase (bioB) [Anaplasma marginale str. Virginia]
 gi|269958538|ref|YP_003328325.1| biotin synthase [Anaplasma centrale str. Israel]
 gi|81599108|sp|Q5PA14|BIOB_ANAMM RecName: Full=Biotin synthase
 gi|254810549|sp|B9KGM2|BIOB_ANAMF RecName: Full=Biotin synthase
 gi|56388279|gb|AAV86866.1| biotin synthase [Anaplasma marginale str. St. Maries]
 gi|222419553|gb|ACM49576.1| biotin synthase (bioB) [Anaplasma marginale str. Florida]
 gi|269848367|gb|ACZ49011.1| biotin synthase [Anaplasma centrale str. Israel]
          Length = 324

 Score =  302 bits (772), Expect = 7e-80,   Method: Composition-based stats.
 Identities = 165/313 (52%), Positives = 221/313 (70%)

Query: 16  PKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQS 75
              WT +E  +++ MPF+DL+  +H+VH +NF  N +Q++ L+NIKTG CPENC YC QS
Sbjct: 3   RNNWTLEEALELFRMPFSDLILKAHSVHVQNFRNNEVQVAALMNIKTGSCPENCRYCAQS 62

Query: 76  VHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSL 135
            H  + L+   L  V++V   AK AKE GA R+C  AAWR   +RDL  I   ++ +KS 
Sbjct: 63  AHYNTGLEKKSLSTVEEVKTAAKRAKEIGADRFCFAAAWRNLHDRDLEKICQFVEAIKSE 122

Query: 136 GLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKS 195
           GLE+C +LGML  +QAQ L ++GLD+YNHN+DTS  FY +V TT T+E+RL+T+ NV+++
Sbjct: 123 GLESCASLGMLKLDQAQKLKESGLDFYNHNVDTSREFYHNVVTTRTYEERLETVRNVQQA 182

Query: 196 GIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEH 255
           GIKVCCGGILG+GE  +DR  ML+TLANL   P S+PIN L+PI G+  E N K+D I+ 
Sbjct: 183 GIKVCCGGILGMGESTEDRASMLVTLANLEQHPLSVPINRLVPIEGTPMEGNPKIDNIDF 242

Query: 256 VRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTI 315
           VR I+VARI+MP S +RLAAGR  MS+E+QALC  +GANSIF G+ LLT  N     D  
Sbjct: 243 VRTIAVARIMMPASYVRLAAGRGEMSEEMQALCMLAGANSIFCGEKLLTTPNARPEDDQR 302

Query: 316 LFNRLGLIPDLSA 328
           LF++LG+ P  +A
Sbjct: 303 LFSQLGITPSRAA 315


>gi|329123034|ref|ZP_08251605.1| biotin synthase [Haemophilus aegyptius ATCC 11116]
 gi|327471965|gb|EGF17405.1| biotin synthase [Haemophilus aegyptius ATCC 11116]
          Length = 333

 Score =  302 bits (772), Expect = 7e-80,   Method: Composition-based stats.
 Identities = 152/311 (48%), Positives = 217/311 (69%)

Query: 17  KVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQSV 76
           + W+  +V  ++  PF +L++ +  VHRK+F P  IQLS L++IKTGGCPE+C YC QS 
Sbjct: 18  EYWSVCKVEALFETPFLELVYRATQVHRKHFNPRAIQLSTLMSIKTGGCPEDCSYCPQSA 77

Query: 77  HNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLG 136
              + ++  +L++VD+++ +AK AK  GA R+CMGAAWR PK +D+  + ++IK VKSLG
Sbjct: 78  RYHTGVQNQQLLDVDEIVAKAKIAKARGAGRFCMGAAWRGPKPKDIEKVTEIIKAVKSLG 137

Query: 137 LETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSG 196
           LETC T G+L    A+ L +AGLDYYNHN+DT+   Y  V  T  F+DRL TL  VRK+G
Sbjct: 138 LETCGTFGLLQDGMAEDLKEAGLDYYNHNLDTAPEHYAEVIGTRRFDDRLSTLGKVRKAG 197

Query: 197 IKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEHV 256
           +KVCCGGI+G+ E   +R  ++ +LANL   PES+PIN L+ + G+   + +++D  E V
Sbjct: 198 LKVCCGGIVGMNETRKERAGLIASLANLDPQPESVPINQLVKVEGTPLADAEELDWTEFV 257

Query: 257 RIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTIL 316
           R I+VARI MPKS +RL+AGR+ M++E+QA+CF +GANSIF GD LL   NP  + D +L
Sbjct: 258 RTIAVARITMPKSYVRLSAGRSGMTEEMQAMCFMAGANSIFYGDKLLVTDNPEEDGDQLL 317

Query: 317 FNRLGLIPDLS 327
             +L L P+ +
Sbjct: 318 MAKLDLEPETA 328


>gi|319897478|ref|YP_004135675.1| biotin synthase [Haemophilus influenzae F3031]
 gi|317432984|emb|CBY81355.1| biotin synthase [Haemophilus influenzae F3031]
          Length = 333

 Score =  301 bits (771), Expect = 7e-80,   Method: Composition-based stats.
 Identities = 153/327 (46%), Positives = 220/327 (67%)

Query: 1   MSRSTVVPEENPTKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNI 60
           ++    +    P    + W+  +V  ++  PF +L++ +  VHRK+F P  IQLS L++I
Sbjct: 2   LAEKLQINSITPHPSVEYWSVCKVEALFETPFLELVYRATQVHRKHFNPRAIQLSTLMSI 61

Query: 61  KTGGCPENCGYCNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKER 120
           KTGGCPE+C YC QS    + ++  +L++VD+++ +AK AK  GA R+CMGAAWR PK +
Sbjct: 62  KTGGCPEDCSYCPQSARYHTGVQNQQLLDVDEIVAKAKIAKARGAGRFCMGAAWRGPKPK 121

Query: 121 DLSIIVDMIKGVKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTH 180
           D+  + ++IK VKSLGLETC T G+L    A+ L  AGLDYYNHN+DT+   Y  V  T 
Sbjct: 122 DIEKVTEIIKAVKSLGLETCGTFGLLQDGMAEDLKDAGLDYYNHNLDTAPEHYAEVIGTR 181

Query: 181 TFEDRLQTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIP 240
            F+DRL TL  VRK+G+KVCCGGI+G+ E   +R  ++ +LANL   PES+PIN L+ + 
Sbjct: 182 RFDDRLSTLGKVRKAGLKVCCGGIVGMNETRKERAGLIASLANLDPQPESVPINQLVKVE 241

Query: 241 GSKFEENKKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGD 300
           G+   + +++D  E VR I+VARI MPKS +RL+AGR+ M++E+QA+CF +GANSIF GD
Sbjct: 242 GTPLADAEELDWTEFVRTIAVARITMPKSYVRLSAGRSGMTEEMQAMCFMAGANSIFYGD 301

Query: 301 TLLTAKNPSYNKDTILFNRLGLIPDLS 327
            LL   NP  + D +L  +L L P+ +
Sbjct: 302 KLLVTDNPEEDGDQLLMAKLDLEPETA 328


>gi|328850566|gb|EGF99729.1| hypothetical protein MELLADRAFT_73336 [Melampsora larici-populina
           98AG31]
          Length = 408

 Score =  301 bits (771), Expect = 7e-80,   Method: Composition-based stats.
 Identities = 146/309 (47%), Positives = 218/309 (70%), Gaps = 2/309 (0%)

Query: 17  KVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQSV 76
           + W+ +E+ ++Y+ P  +L+F + TVHR + +P+ +QL  LLNIKTGGC E+C YC QS 
Sbjct: 70  RKWSRQEIQEVYDTPLMELVFRAATVHRAHHDPSKVQLCTLLNIKTGGCTEDCSYCAQSS 129

Query: 77  HNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKER--DLSIIVDMIKGVKS 134
              + L+ASKLI+++ VL EA+ AK NG+TR+CMGAAWR+   R      I++M+K V++
Sbjct: 130 RYSTGLEASKLIDIEPVLAEARKAKANGSTRFCMGAAWRDLHGRKNGFKRILEMVKEVRA 189

Query: 135 LGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRK 194
           + +E C TLGMLS EQA+ L +AGL  YNHN+DTS  FYP V TT ++++RL TLENVR 
Sbjct: 190 MDMEVCTTLGMLSPEQAEQLKQAGLTAYNHNLDTSREFYPEVITTRSYDERLATLENVRA 249

Query: 195 SGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIE 254
           +G+ VC GGI+GLGE  +DR+ ++  ++ L +PPES P+N L+PIPG+   E ++V   +
Sbjct: 250 AGLSVCSGGIIGLGETPEDRVGLVYEMSQLPSPPESFPVNALVPIPGTPLGERERVSFHD 309

Query: 255 HVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDT 314
            +RII+ ARI++P S +R AAGR   ++  QA+C+ +GAN+IF G+ +LT     +++D 
Sbjct: 310 ILRIIATARIVLPTSIVRFAAGRNTFTEAEQAMCYMAGANAIFTGERMLTTPTSGWDEDL 369

Query: 315 ILFNRLGLI 323
            +F R G+ 
Sbjct: 370 SMFERWGIR 378


>gi|124026193|ref|YP_001015309.1| biotin synthase [Prochlorococcus marinus str. NATL1A]
 gi|254810774|sp|A2C3I4|BIOB_PROM1 RecName: Full=Biotin synthase
 gi|123961261|gb|ABM76044.1| Biotin synthase [Prochlorococcus marinus str. NATL1A]
          Length = 345

 Score =  301 bits (771), Expect = 8e-80,   Method: Composition-based stats.
 Identities = 147/319 (46%), Positives = 212/319 (66%), Gaps = 1/319 (0%)

Query: 10  ENPTKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENC 69
            N       W+S+E+ +I ++P  DLL+ +  VHR       +QL+ LL++KTGGC E+C
Sbjct: 27  INGGDIRHDWSSEEIKEILDLPLMDLLWRAQIVHRSYNPGYKVQLASLLSVKTGGCSEDC 86

Query: 70  GYCNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERD-LSIIVDM 128
            YC QSVHN++ ++ + +I V+ VL  A+ AK+ GA R+CMG AWRE K+ +    +++M
Sbjct: 87  AYCPQSVHNETTVQPNPVIEVESVLDRARAAKDAGADRFCMGWAWREIKDGNAFDSMLEM 146

Query: 129 IKGVKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQT 188
           ++GV+ LGLE C+T GM++  QA  L++AGL  YNHN+DTS   Y  + +T T++DRL+T
Sbjct: 147 VRGVRELGLEACVTAGMITDSQASRLAEAGLTAYNHNLDTSPEHYSKIISTRTYQDRLET 206

Query: 189 LENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENK 248
           L  VR +GI VCCGGI+G+GE + DR  +L  LA L   PES+PIN L+ + G+  E+  
Sbjct: 207 LRRVRMAGITVCCGGIIGMGESVSDRASLLKVLATLDPHPESVPINALVAVEGTPMEDLS 266

Query: 249 KVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNP 308
            +DP+E VR+++ AR++MPKSR+RL+AGR  +  E Q LC  SGA+SIF GDTLLT  NP
Sbjct: 267 SIDPLEMVRMVATARVIMPKSRIRLSAGRQQLGREAQILCLQSGADSIFYGDTLLTTSNP 326

Query: 309 SYNKDTILFNRLGLIPDLS 327
               D  L    G+  + S
Sbjct: 327 EVEADRKLLADAGITANFS 345


>gi|270160157|ref|ZP_06188813.1| biotin synthase [Legionella longbeachae D-4968]
 gi|289165068|ref|YP_003455206.1| Biotin synthase [Legionella longbeachae NSW150]
 gi|269988496|gb|EEZ94751.1| biotin synthase [Legionella longbeachae D-4968]
 gi|288858241|emb|CBJ12109.1| Biotin synthase [Legionella longbeachae NSW150]
          Length = 315

 Score =  301 bits (771), Expect = 8e-80,   Method: Composition-based stats.
 Identities = 184/311 (59%), Positives = 241/311 (77%)

Query: 13  TKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYC 72
           T+  K W+  E+  IY  PFNDLL+ +  +HR++ +PN +Q + LL+IKTG CPE+CGYC
Sbjct: 2   TQAKKHWSISEITAIYEQPFNDLLYHAQMLHREHHKPNSLQFATLLSIKTGACPEDCGYC 61

Query: 73  NQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGV 132
           +QS H+K+ ++  KL++V +VLK A+ AK+ GA R+CMGAAWR P ++ ++ + +MIKGV
Sbjct: 62  SQSGHHKTHVEKEKLMSVAEVLKRAQEAKDGGAKRFCMGAAWRCPPDKAMNELQEMIKGV 121

Query: 133 KSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENV 192
           KSLGLETCMTLGML+ EQA  L +AGLD+YNHNIDTS  +Y  V TT  F DRL+TL++V
Sbjct: 122 KSLGLETCMTLGMLTPEQASSLKEAGLDFYNHNIDTSPSYYEKVVTTRKFSDRLETLDHV 181

Query: 193 RKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDP 252
           R +GI VCCGGILGLGE  +DRI+ LLTLAN+ TPPES+PIN LIP+ G+    +K+V+ 
Sbjct: 182 RTAGIGVCCGGILGLGETREDRIEFLLTLANMETPPESVPINRLIPVEGTPLAHSKQVEG 241

Query: 253 IEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNK 312
           IE VR I+ ARILMPKS +RL AGR  MSDELQALC+F+GANS+F+GD LLT  NP  +K
Sbjct: 242 IELVRTIATARILMPKSVIRLTAGRTEMSDELQALCYFAGANSVFIGDKLLTEDNPQRSK 301

Query: 313 DTILFNRLGLI 323
           D +LF++LGL 
Sbjct: 302 DKVLFSKLGLT 312


>gi|238022352|ref|ZP_04602778.1| hypothetical protein GCWU000324_02259 [Kingella oralis ATCC 51147]
 gi|237866966|gb|EEP68008.1| hypothetical protein GCWU000324_02259 [Kingella oralis ATCC 51147]
          Length = 359

 Score =  301 bits (771), Expect = 8e-80,   Method: Composition-based stats.
 Identities = 156/322 (48%), Positives = 216/322 (67%), Gaps = 2/322 (0%)

Query: 3   RSTVVPEENPTKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKT 62
           R  V P+ +PT   + W+  +V  ++N PF +L+F +  VHR++F+P  +QLS LL++KT
Sbjct: 10  RRAVAPKPHPTA--QYWSKCQVEGLFNQPFLELVFQAAQVHREHFDPRAVQLSTLLSVKT 67

Query: 63  GGCPENCGYCNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDL 122
           GGC E+C YC QS H  + ++ + L+ VD V+  AK AK+ GA+R+CMGAAWR PK  D+
Sbjct: 68  GGCTEDCEYCPQSAHYHTGVEKTGLMEVDDVVALAKIAKKRGASRFCMGAAWRSPKPEDI 127

Query: 123 SIIVDMIKGVKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTF 182
             + DM++ VK +GLETC T G+L    AQ L  AGLDYYNHN+DT    Y  +  T   
Sbjct: 128 PQLADMVRAVKEIGLETCGTFGLLDEGMAQSLHDAGLDYYNHNLDTDPSRYNDIIHTRRH 187

Query: 183 EDRLQTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGS 242
           EDR+ TL  VR++G+K+CCGGI+G+ E   +R  ++ +LANL   PES+PIN LI I G+
Sbjct: 188 EDRMDTLGKVREAGLKICCGGIVGMNETRAERAGLIASLANLDPQPESVPINQLIKIDGT 247

Query: 243 KFEENKKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTL 302
              +   +D  E VR I+VARI MP+S +RL+AGRA M + +QA+CF +GANSIF GDTL
Sbjct: 248 PLADVPDLDWTEFVRTIAVARITMPQSYVRLSAGRANMPEAMQAMCFMAGANSIFYGDTL 307

Query: 303 LTAKNPSYNKDTILFNRLGLIP 324
           LT+ NP  + D  L  +L L P
Sbjct: 308 LTSPNPEESGDRALLAKLDLYP 329


>gi|154245065|ref|YP_001416023.1| biotin synthase [Xanthobacter autotrophicus Py2]
 gi|254813110|sp|A7IEC3|BIOB_XANP2 RecName: Full=Biotin synthase
 gi|154159150|gb|ABS66366.1| biotin synthase [Xanthobacter autotrophicus Py2]
          Length = 345

 Score =  301 bits (771), Expect = 8e-80,   Method: Composition-based stats.
 Identities = 172/316 (54%), Positives = 230/316 (72%), Gaps = 1/316 (0%)

Query: 9   EENPTKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPEN 68
               +     WT  E   +Y++PF +L+F + +VHR++F+P  ++ + LL+IKTGGC E+
Sbjct: 16  AAEGSLLRSDWTEAEARALYDLPFPELMFRAQSVHRRHFDPTTVETATLLSIKTGGCAED 75

Query: 69  CGYCNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDM 128
           CGYC+QS H+++ LKA+KL+ V++VL +A+ AK+ GATR+CMGAAWR PK+RDL  +  M
Sbjct: 76  CGYCSQSAHHETGLKATKLMGVEEVLSQAQKAKDGGATRFCMGAAWRSPKDRDLDAVCAM 135

Query: 129 IKGVKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQT 188
           I GVK++GLE C+TLGML+ +Q   L  AGLDYYNHNIDTS  FYP + TT T +DRL T
Sbjct: 136 ISGVKAMGLEACVTLGMLTPDQVTRLGAAGLDYYNHNIDTSPAFYPEIVTTRTMDDRLDT 195

Query: 189 LENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSK-FEEN 247
           L +VR  GI++C GGI+G+GE +DDRI MLL LA L   PES+PIN+   I G+    + 
Sbjct: 196 LASVRAGGIRLCTGGIVGMGESVDDRIAMLLVLATLDPHPESVPINMWNEIEGTPVMGKA 255

Query: 248 KKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKN 307
            K DPI  VR+I++AR+LMP+S +RL+AGR  MSDE+QALCF +GANSIF GD LLT  N
Sbjct: 256 DKPDPIAFVRLIALARLLMPQSIVRLSAGRDAMSDEMQALCFLAGANSIFTGDVLLTTAN 315

Query: 308 PSYNKDTILFNRLGLI 323
           P  +KD  LF RLG+ 
Sbjct: 316 PERDKDAALFARLGIR 331


>gi|67458919|ref|YP_246543.1| biotin synthase [Rickettsia felis URRWXCal2]
 gi|75536643|sp|Q4UM45|BIOB_RICFE RecName: Full=Biotin synthase
 gi|67004452|gb|AAY61378.1| Biotin synthase [Rickettsia felis URRWXCal2]
          Length = 309

 Score =  301 bits (771), Expect = 9e-80,   Method: Composition-based stats.
 Identities = 172/307 (56%), Positives = 226/307 (73%)

Query: 17  KVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQSV 76
           K WT  E  +I++  F +L++ + T+HR NF+PN IQ+S LL+IKTG CPENC +C QS 
Sbjct: 2   KKWTFDEAKEIFSFSFMELVYQAQTIHRANFDPNKIQISSLLSIKTGSCPENCKFCPQSS 61

Query: 77  HNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLG 136
           H K+ +K   L+ ++ V+  AK AK  G+TR+CMGAAWR P++ DL ++ +MIK VK LG
Sbjct: 62  HYKTYVKKEPLMQIEDVITAAKRAKAAGSTRFCMGAAWRGPRDEDLKLVCEMIKEVKKLG 121

Query: 137 LETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSG 196
           LETC+TLG+L   QA  L +AGLD+YNHNIDTSE FY  + TT TF+DRL TL  VR SG
Sbjct: 122 LETCVTLGLLKEHQAVTLKEAGLDFYNHNIDTSEEFYNKIITTRTFQDRLDTLRYVRASG 181

Query: 197 IKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEHV 256
           +KVCCGGILG+GE  DDRI+M+LTLANL  P ES+ IN LI IPG+  E  + +DP + V
Sbjct: 182 MKVCCGGILGMGETNDDRINMILTLANLEEPAESVTINKLIKIPGTPLENVQDIDPFDFV 241

Query: 257 RIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTIL 316
           R+I++ARI++PKS +RL+AGR  MSDELQALC  +G  SIF G+ +LT+ NP   +D  L
Sbjct: 242 RVIALARIMIPKSYIRLSAGREQMSDELQALCIMAGVYSIFYGEKILTSANPMPERDNDL 301

Query: 317 FNRLGLI 323
           F +LG+I
Sbjct: 302 FQKLGII 308


>gi|301156588|emb|CBW16059.1| biotin synthase [Haemophilus parainfluenzae T3T1]
          Length = 338

 Score =  301 bits (771), Expect = 9e-80,   Method: Composition-based stats.
 Identities = 152/327 (46%), Positives = 220/327 (67%), Gaps = 2/327 (0%)

Query: 1   MSRSTVVPEENPTKKP--KVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLL 58
           M+ + VV   + T  P  + W+  +V  ++  PF +L++ +  VHR+ F P  IQLS L+
Sbjct: 1   MTTTNVVQLSSITPHPSVEYWSVCKVEALFETPFLELVYRAAQVHREYFNPGAIQLSTLM 60

Query: 59  NIKTGGCPENCGYCNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPK 118
           +IKTGGCPE+CGYC QS   ++ ++  +++++D+++++AK AK  GA R+CMGAAWR PK
Sbjct: 61  SIKTGGCPEDCGYCPQSARYQTGVQNQQILDIDEIVEKAKIAKARGAGRFCMGAAWRGPK 120

Query: 119 ERDLSIIVDMIKGVKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTT 178
            +D+  +  +I+ VK +GLETC T G+L    A+ L  AGLDYYNHN+DT+   Y +V  
Sbjct: 121 PKDMEKVTAIIRAVKDIGLETCGTFGLLQDGMAEELKDAGLDYYNHNLDTAPENYHNVIG 180

Query: 179 THTFEDRLQTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIP 238
           T  F+DRL TL  VR +G+KVCCGGI+G+ E   +R  ++ +LANL   PES+PIN L+ 
Sbjct: 181 TRRFDDRLSTLGKVRHAGLKVCCGGIVGMNETRKERAGLIASLANLDPQPESVPINQLVK 240

Query: 239 IPGSKFEENKKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFV 298
           + G+   +   +D  E VR I+VARI MPKS +RL+AGR  MS+E+QA+CF +GANSIF 
Sbjct: 241 VEGTPMADAADLDWTEFVRTIAVARITMPKSYVRLSAGRQGMSEEMQAMCFMAGANSIFY 300

Query: 299 GDTLLTAKNPSYNKDTILFNRLGLIPD 325
           GD LL   NP  + D +L  +L L P+
Sbjct: 301 GDKLLVTGNPEEDGDQLLMAKLDLEPE 327


>gi|33593682|ref|NP_881326.1| biotin synthase [Bordetella pertussis Tohama I]
 gi|33563755|emb|CAE42995.1| biotin synthase [Bordetella pertussis Tohama I]
 gi|332383086|gb|AEE67933.1| biotin synthase [Bordetella pertussis CS]
          Length = 340

 Score =  301 bits (771), Expect = 9e-80,   Method: Composition-based stats.
 Identities = 156/309 (50%), Positives = 213/309 (68%)

Query: 17  KVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQSV 76
           + W    V +++ +PF DLL  +  VHR++F+ N +QLS LL+IKTGGCPE+C YC QS 
Sbjct: 23  ERWPLAAVAELFELPFLDLLHRAQQVHRQHFDANTVQLSSLLSIKTGGCPEDCAYCPQSA 82

Query: 77  HNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLG 136
           H  + + A KL+ +D+V++ A+ A+ NGA R+CMGAAWR PK   L  + +MI  VK+LG
Sbjct: 83  HYDTGVDADKLMPLDEVVRAARAAQANGAQRFCMGAAWRSPKPHHLEAVAEMIGAVKALG 142

Query: 137 LETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSG 196
           +ETC+TLGML   QA+ L  AGLDYYNHN+DT+  FY  + +T T++DRL TL+ VR++G
Sbjct: 143 METCVTLGMLRDGQAEQLKAAGLDYYNHNLDTAPEFYGKIISTRTYQDRLDTLQQVREAG 202

Query: 197 IKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEHV 256
           I VCCGGI+G+GE   DR  ++  L N+   PES+PIN L+ + G+     + +DP E +
Sbjct: 203 INVCCGGIVGMGESRRDRAGLVAQLTNMEPYPESVPINNLVQVEGTPLAGAETLDPFEFI 262

Query: 257 RIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTIL 316
           R I+VARI MP +++RL+AGR  MSD  QALCF +GANSIF GD LLT  NP    D  L
Sbjct: 263 RTIAVARITMPLAKVRLSAGRETMSDSEQALCFMAGANSIFYGDVLLTTGNPQVEADRRL 322

Query: 317 FNRLGLIPD 325
             RLG+  +
Sbjct: 323 LQRLGMRAE 331


>gi|116790024|gb|ABK25474.1| unknown [Picea sitchensis]
          Length = 401

 Score =  301 bits (771), Expect = 9e-80,   Method: Composition-based stats.
 Identities = 154/332 (46%), Positives = 217/332 (65%), Gaps = 4/332 (1%)

Query: 1   MSRSTVVPEENPTKKPKV--WTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLL 58
           +S       EN  +      WT  E+  +Y+ P  DLLF    VHR   +   +Q   LL
Sbjct: 40  LSSPASAEAENAVRNGPRNDWTKPEIQAVYDSPIMDLLFHGAQVHRHAHKFREVQQCTLL 99

Query: 59  NIKTGGCPENCGYCNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPK 118
           +IKTGGC E+C YC QS    + +K  KL+N D V++ AK AKE G+TR+CMGAAWR+  
Sbjct: 100 SIKTGGCSEDCAYCPQSSRYDTGVKGQKLMNQDAVIESAKKAKEAGSTRFCMGAAWRDTV 159

Query: 119 ER--DLSIIVDMIKGVKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHV 176
            R  + + I+D +K ++ +G+E C TLGML  +QA+ L KAGL  YNHN+DTS  FYP +
Sbjct: 160 GRKTNFNQILDYVKEIRGMGMEVCCTLGMLEKQQAEDLKKAGLTAYNHNLDTSREFYPSI 219

Query: 177 TTTHTFEDRLQTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLL 236
            TT ++++RL+TLE VR++GI VC GGI+GLGE ++DR+ +L TLA L   PES+PIN L
Sbjct: 220 ITTRSYDERLKTLELVREAGISVCSGGIIGLGEQVEDRVGLLHTLATLPEHPESVPINAL 279

Query: 237 IPIPGSKFEENKKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSI 296
           + + G+  ++ K V+  E +R+I+ ARI+MP++ +RL+AGR   S   QALCF +GANSI
Sbjct: 280 LAVKGTPLQDQKPVEIWEMIRMIATARIVMPRAMVRLSAGRVRFSLPEQALCFLAGANSI 339

Query: 297 FVGDTLLTAKNPSYNKDTILFNRLGLIPDLSA 328
           F G+ LLT  N  ++ D  +F  LGLIP  ++
Sbjct: 340 FTGEKLLTTPNNDFDADQQMFKVLGLIPKAAS 371


>gi|85708383|ref|ZP_01039449.1| biotin synthetase [Erythrobacter sp. NAP1]
 gi|85689917|gb|EAQ29920.1| biotin synthetase [Erythrobacter sp. NAP1]
          Length = 335

 Score =  301 bits (770), Expect = 1e-79,   Method: Composition-based stats.
 Identities = 164/314 (52%), Positives = 222/314 (70%), Gaps = 6/314 (1%)

Query: 16  PKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQS 75
              WT +E+  ++++PF +LLF + +VHR+N  P  IQL  LL+IKTGGCPE+CGYC+QS
Sbjct: 5   RTDWTREEIADLFDLPFTELLFRAASVHRENHPPEQIQLCTLLSIKTGGCPEDCGYCSQS 64

Query: 76  VHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSL 135
           V   S ++A+KL++V  VL+ A  AK+ G+ R+CMGAAWR PK+RD+  IV+++KGV+ +
Sbjct: 65  VKADSGVEATKLMDVQAVLQRAAQAKDAGSQRFCMGAAWRNPKDRDMPKIVEIVKGVRDM 124

Query: 136 GLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKS 195
           GLETCMTLGML   QA +L++AGLDYYNHNID+S  +Y  V +T  F+ RL TL++VR +
Sbjct: 125 GLETCMTLGMLEPHQADMLAEAGLDYYNHNIDSSPEYYERVISTRDFQCRLDTLDHVRTA 184

Query: 196 GIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDP--- 252
           GI VC GGI+G+GE  +DR+  + TLA L   PES+P+N L+P+ G+   +     P   
Sbjct: 185 GINVCSGGIVGMGETREDRVGFVHTLATLPEHPESVPVNALVPVKGTVLGDMLADTPMAK 244

Query: 253 ---IEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPS 309
              IE VR ++VARI MP S +RL+AGR  MS+  QALCFF+GANSIF GD LLTA N  
Sbjct: 245 IDDIEFVRTVAVARITMPMSMVRLSAGRESMSEATQALCFFAGANSIFTGDKLLTAPNAG 304

Query: 310 YNKDTILFNRLGLI 323
            +    LF +LGL 
Sbjct: 305 DDSGGALFAKLGLT 318


>gi|87198743|ref|YP_496000.1| biotin synthase [Novosphingobium aromaticivorans DSM 12444]
 gi|123763627|sp|Q2GAF7|BIOB_NOVAD RecName: Full=Biotin synthase
 gi|87134424|gb|ABD25166.1| biotin synthase [Novosphingobium aromaticivorans DSM 12444]
          Length = 356

 Score =  301 bits (770), Expect = 1e-79,   Method: Composition-based stats.
 Identities = 171/335 (51%), Positives = 224/335 (66%), Gaps = 10/335 (2%)

Query: 1   MSRSTVVPEEN----PTKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSK 56
           M  + ++  E+           WT +E+  ++++PF +LLF +  VHR +     +QL  
Sbjct: 1   MQETALLERESAGTGNAPVRTDWTREEIAALFDLPFTELLFRAAEVHRAHHRAGEVQLCT 60

Query: 57  LLNIKTGGCPENCGYCNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWRE 116
           LL+IKTGGCPE+CGYC+QSV   S ++A+KL+ V +VL+ A  AK+NG+ R+CMGAAWR 
Sbjct: 61  LLSIKTGGCPEDCGYCSQSVKADSGVEATKLMEVQKVLQSAAQAKDNGSKRFCMGAAWRN 120

Query: 117 PKERDLSIIVDMIKGVKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHV 176
           PK+RD+  I+ MIKGV+ +G+ETCMTLGML+  QA  L+ AGLDYYNHNIDTS   Y  V
Sbjct: 121 PKDRDMPAIISMIKGVREMGMETCMTLGMLTPSQAAQLADAGLDYYNHNIDTSPERYEEV 180

Query: 177 TTTHTFEDRLQTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLL 236
            TT TF DRLQTL+NVR +GI VC GGI+G+GE   DR+  +  LA L   PES+P+N L
Sbjct: 181 ITTRTFADRLQTLDNVRNAGINVCSGGIVGMGETRADRVGFVHALATLEQHPESVPVNAL 240

Query: 237 IPIPGSKFEENKKVDP------IEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFF 290
           +PI G+   +     P      IE VR ++VARI MP S +RL+AGR  MS+  QALCF 
Sbjct: 241 VPIKGTVLGDMLADTPLAKIDDIEFVRTVAVARITMPLSMVRLSAGRESMSEATQALCFM 300

Query: 291 SGANSIFVGDTLLTAKNPSYNKDTILFNRLGLIPD 325
           +GANSIF GD LLTA N   + D  +F RLGL P 
Sbjct: 301 AGANSIFTGDKLLTAANAGDDADAAMFKRLGLKPM 335


>gi|314947132|gb|ADT64682.1| biotin synthase [Alcaligenes faecalis]
          Length = 338

 Score =  301 bits (770), Expect = 1e-79,   Method: Composition-based stats.
 Identities = 160/311 (51%), Positives = 216/311 (69%)

Query: 13  TKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYC 72
              P  WT + + ++Y +PF DL+F + TVHR++   N IQLS LL+IKTG CPE+C YC
Sbjct: 3   VNNPAPWTIRRIMELYELPFMDLVFQAQTVHRQHHPANQIQLSSLLSIKTGACPEDCSYC 62

Query: 73  NQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGV 132
            QS   +++L+   L+ +DQVL+ A+ A+  GA R+CMGAAWR P E+ L  ++DM+  V
Sbjct: 63  PQSSKYQTELEPEPLMPLDQVLEAARAAQAQGAQRFCMGAAWRSPTEKQLDQVIDMVSAV 122

Query: 133 KSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENV 192
           K++GLETC+TLGML   QA+ L +AGLDYYNHN+DTS  FY  + +T T++DRL TLE V
Sbjct: 123 KAMGLETCVTLGMLKDGQAERLKEAGLDYYNHNLDTSPEFYGQIISTRTYQDRLDTLERV 182

Query: 193 RKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDP 252
           R +G+  CCGGI+G+GE   +R  +L  LAN+   PES+PIN L+ +PG+  ++   +DP
Sbjct: 183 RAAGLNSCCGGIIGMGESRRERAGLLAQLANMRPYPESVPINQLVKVPGTPLDQVDDLDP 242

Query: 253 IEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNK 312
            E VR I++ARILMP S +RL+AGR  M D  QALCF +GANSIF G+ LLT  NP +  
Sbjct: 243 FEFVRTIAIARILMPTSAVRLSAGRETMDDSTQALCFMAGANSIFYGEQLLTTGNPQFVA 302

Query: 313 DTILFNRLGLI 323
           D  LF RL L 
Sbjct: 303 DQDLFARLQLE 313


>gi|152978804|ref|YP_001344433.1| biotin synthase [Actinobacillus succinogenes 130Z]
 gi|254810541|sp|A6VNF1|BIOB_ACTSZ RecName: Full=Biotin synthase
 gi|150840527|gb|ABR74498.1| biotin synthase [Actinobacillus succinogenes 130Z]
          Length = 338

 Score =  300 bits (769), Expect = 1e-79,   Method: Composition-based stats.
 Identities = 154/327 (47%), Positives = 219/327 (66%)

Query: 1   MSRSTVVPEENPTKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNI 60
           M  +  +    P  + + W+  +V  ++  PF +L+  +  VHR++F P  +QLS L++I
Sbjct: 1   METTLQLYSNTPHPQAQYWSVCKVEALFETPFLELVHRAAIVHREHFNPQAVQLSTLMSI 60

Query: 61  KTGGCPENCGYCNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKER 120
           KTGGCPE+CGYC QS   ++ ++   L+ V+ ++++AK AK  GA+R+CMGAAWR PK +
Sbjct: 61  KTGGCPEDCGYCPQSARYRTGVQKQALLEVEDIVEKAKIAKSRGASRFCMGAAWRGPKPK 120

Query: 121 DLSIIVDMIKGVKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTH 180
           D+  I +++K VK LGLETC T G+L    A+ L +AGLDYYNHNIDTS   Y  V  T 
Sbjct: 121 DIGKITEIVKAVKDLGLETCGTFGLLEDGMAENLKEAGLDYYNHNIDTSPEHYKKVIGTR 180

Query: 181 TFEDRLQTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIP 240
            FEDRL TL  VRK+G+KVCCGGI+G+ E   +R   + +LANL   PES+PIN L+ + 
Sbjct: 181 GFEDRLSTLGKVRKAGLKVCCGGIIGMNENRKERAGFIASLANLDPQPESVPINQLVKVD 240

Query: 241 GSKFEENKKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGD 300
           G+   + +++D  E VR I+VARI MPKS +RL+AGR  MS+E+QA+CF +GANSIF GD
Sbjct: 241 GTPLADAEELDWTEFVRTIAVARITMPKSYVRLSAGRQGMSEEMQAMCFMAGANSIFYGD 300

Query: 301 TLLTAKNPSYNKDTILFNRLGLIPDLS 327
            LL   N   ++D +L  +L L P+ +
Sbjct: 301 KLLVTGNAEEDRDQLLMAKLDLEPETA 327


>gi|254796961|ref|YP_003081798.1| biotin synthase [Neorickettsia risticii str. Illinois]
 gi|254590207|gb|ACT69569.1| biotin synthase [Neorickettsia risticii str. Illinois]
          Length = 325

 Score =  300 bits (769), Expect = 2e-79,   Method: Composition-based stats.
 Identities = 169/297 (56%), Positives = 223/297 (75%)

Query: 17  KVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQSV 76
           KVW   E  +++++PF DLL+ +  VHR+NF  N +QL+ LL++KTGGCPENC YC QS 
Sbjct: 3   KVWQFSEAEELFHLPFLDLLYSAQRVHRENFLHNQVQLTMLLSVKTGGCPENCSYCPQSA 62

Query: 77  HNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLG 136
           H  + LK   ++ V++VL+ AK A E GATR+C+GAAWR P+ +DL  + +MI G+K LG
Sbjct: 63  HYNTGLKKEPVMQVEKVLEAAKRAVELGATRFCIGAAWRGPRGKDLDAVCEMISGIKKLG 122

Query: 137 LETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSG 196
           LETC +LG+LS EQA  L  AGLD+YNHNIDTS+ +Y  + TT +F DR++TLENV K+G
Sbjct: 123 LETCASLGLLSHEQAVSLKAAGLDFYNHNIDTSQEYYSKIITTRSFSDRIETLENVAKAG 182

Query: 197 IKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEHV 256
           +KVC GGILG+GE  +DRI ML+ L++LS PPESIPIN LIPIPG+   +N  VDP++ V
Sbjct: 183 LKVCSGGILGMGESNEDRIKMLVELSHLSFPPESIPINKLIPIPGTPLAKNNAVDPLDFV 242

Query: 257 RIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKD 313
           RI+++ARI+ PKS +RL+AGR  MSDELQ LCF +GANSIF G+ LLT+ N     D
Sbjct: 243 RIVALARIMFPKSYVRLSAGRESMSDELQTLCFIAGANSIFYGEKLLTSANSDPESD 299


>gi|168022433|ref|XP_001763744.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|162684988|gb|EDQ71386.1| predicted protein [Physcomitrella patens subsp. patens]
          Length = 422

 Score =  300 bits (768), Expect = 2e-79,   Method: Composition-based stats.
 Identities = 149/312 (47%), Positives = 205/312 (65%), Gaps = 2/312 (0%)

Query: 14  KKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCN 73
           +    WT  E+  IY  P  DLL +   VH+   +   +Q   LL+IKTGGC E+C YC 
Sbjct: 89  EPRHDWTRDEIQAIYESPLMDLLLYGAQVHKHTHKWREVQQCTLLSIKTGGCSEDCSYCP 148

Query: 74  QSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKER--DLSIIVDMIKG 131
           QS    + +KA KL++ D VL  AK AKE G++R+CMGAAWR+   R  + + I++ +K 
Sbjct: 149 QSSRYDTGVKAQKLLSEDIVLDAAKKAKEAGSSRFCMGAAWRDTVGRKTNFNQILEYVKE 208

Query: 132 VKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLEN 191
           ++ +G+E C TLGML  +QA+ L  AGL  YNHN+DTS  +YP++ TT ++++RL+TLE 
Sbjct: 209 IRGMGMEVCCTLGMLEQKQAEQLKAAGLTAYNHNLDTSREYYPNIITTRSYDERLKTLEL 268

Query: 192 VRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVD 251
           VR +GI VC GGI+GLGE  +DR+ +L TLA L   PES+PIN L+ + G+  E  K V+
Sbjct: 269 VRDAGISVCSGGIIGLGEAEEDRVGLLHTLATLPEHPESVPINALLAVKGTPLENQKPVE 328

Query: 252 PIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYN 311
             E VR+I+ ARI+MPK+ +RL+AGR   S   QALCF +GANSIF G+ LLT  N   +
Sbjct: 329 VWEMVRMIATARIVMPKAMVRLSAGRVRFSQPEQALCFMAGANSIFTGEKLLTTPNNDKD 388

Query: 312 KDTILFNRLGLI 323
            D  +F  LGLI
Sbjct: 389 ADQQMFQTLGLI 400


>gi|92115907|ref|YP_575636.1| biotin synthase [Nitrobacter hamburgensis X14]
 gi|123083865|sp|Q1QRH1|BIOB_NITHX RecName: Full=Biotin synthase
 gi|91798801|gb|ABE61176.1| biotin synthase [Nitrobacter hamburgensis X14]
          Length = 340

 Score =  300 bits (768), Expect = 2e-79,   Method: Composition-based stats.
 Identities = 167/312 (53%), Positives = 233/312 (74%), Gaps = 1/312 (0%)

Query: 13  TKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYC 72
           ++    WT  E   +YN+PF DL+F + T+HR++F+PNH++ + LL+IKTGGCPE+CGYC
Sbjct: 16  SQPRHDWTRSEAETLYNLPFADLIFQAQTLHRRHFDPNHVETANLLSIKTGGCPEDCGYC 75

Query: 73  NQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGV 132
           +QS H  S +KA+KL++ + V++ A+ A++ GA+R+CM AAWR PK+RDL  + DM+  V
Sbjct: 76  SQSAHYDSGVKATKLMDREAVIETARRARDAGASRFCMAAAWRNPKDRDLDRVCDMVSAV 135

Query: 133 KSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENV 192
           K LGLETC TLGML+ +QA+ L  AGLD+YNHN+DTS  FY ++ TT T +DR+ TL + 
Sbjct: 136 KELGLETCATLGMLTPDQARRLHDAGLDFYNHNVDTSPEFYGNIITTRTMQDRIDTLAHA 195

Query: 193 RKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEE-NKKVD 251
           R++G+KVCCGGI+GLGE + DR+ ML+ LANL   PES+PIN+   +      +  ++ D
Sbjct: 196 REAGLKVCCGGIIGLGEQVGDRLGMLMLLANLPAHPESVPINMWNEVKSVPVNDTAERPD 255

Query: 252 PIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYN 311
           PI  VR+I+VARI+MP+S +RL+AGR  M+DELQALCF +GANSIF+GD LLT KNP   
Sbjct: 256 PIALVRMIAVARIMMPRSVVRLSAGRQYMTDELQALCFLAGANSIFIGDVLLTTKNPQTA 315

Query: 312 KDTILFNRLGLI 323
           +D  L +RLG+ 
Sbjct: 316 RDAALLDRLGIR 327


>gi|145634186|ref|ZP_01789897.1| thiamin transporter membrane protein [Haemophilus influenzae
           PittAA]
 gi|145268630|gb|EDK08623.1| thiamin transporter membrane protein [Haemophilus influenzae
           PittAA]
          Length = 333

 Score =  300 bits (768), Expect = 2e-79,   Method: Composition-based stats.
 Identities = 153/327 (46%), Positives = 221/327 (67%)

Query: 1   MSRSTVVPEENPTKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNI 60
           ++    +    P    + W+  +V  ++  PF +L++ +  VHRK+F P  IQLS L++I
Sbjct: 2   LAEKLQINSITPHPSVEYWSVCKVEALFETPFLELVYRAMQVHRKHFNPRAIQLSTLMSI 61

Query: 61  KTGGCPENCGYCNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKER 120
           KTGGCPE+C YC QS    + ++  +L++VD+++ +AK AK  GA R+CMGAAWR PK +
Sbjct: 62  KTGGCPEDCSYCPQSARYHTGVQNQQLLDVDEIVAKAKIAKARGAGRFCMGAAWRGPKPK 121

Query: 121 DLSIIVDMIKGVKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTH 180
           D+  + ++IK VKSLGLETC T G+L    A+ L +AGLDYYNHN+DT+   Y  V  T 
Sbjct: 122 DIEKVTEIIKAVKSLGLETCGTFGLLQDGMAEDLKEAGLDYYNHNLDTAPEHYAEVIGTR 181

Query: 181 TFEDRLQTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIP 240
            F+DRL TL  VRK+G+KVCCGGI+G+ E   +R  ++ +LANL   PES+PIN L+ + 
Sbjct: 182 RFDDRLSTLGKVRKAGLKVCCGGIVGMNETRKERAGLIASLANLDPQPESVPINQLVKVE 241

Query: 241 GSKFEENKKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGD 300
           G+   + +++D  E VR I+VARI MPKS +RL+AGR+ M++E+QA+CF +GANSIF GD
Sbjct: 242 GTPLADAEELDWTEFVRTIAVARITMPKSYVRLSAGRSGMTEEMQAMCFMAGANSIFYGD 301

Query: 301 TLLTAKNPSYNKDTILFNRLGLIPDLS 327
            LL   NP  + D +L  +L L P+ +
Sbjct: 302 KLLVTDNPEEDGDQLLMAKLDLEPETA 328


>gi|27904766|ref|NP_777892.1| biotin synthase [Buchnera aphidicola str. Bp (Baizongia pistaciae)]
 gi|38372209|sp|Q89AK5|BIOB_BUCBP RecName: Full=Biotin synthase
 gi|27904164|gb|AAO26997.1| biotin synthase [Buchnera aphidicola str. Bp (Baizongia pistaciae)]
          Length = 344

 Score =  300 bits (768), Expect = 2e-79,   Method: Composition-based stats.
 Identities = 160/306 (52%), Positives = 223/306 (72%)

Query: 18  VWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQSVH 77
            W  ++V ++++ PF D+LF +  +HRKNF  N IQ+S LL+IKTG CPE+C YC QS  
Sbjct: 4   QWNFEKVKELFDQPFFDILFLAQNIHRKNFNANQIQISTLLSIKTGACPEDCKYCPQSAR 63

Query: 78  NKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLGL 137
            K+ +K  KL+ + Q+LK A+ AK+ G+TR+CMGAAW+ PKERD+  +  +I+ VK LGL
Sbjct: 64  YKTNIKIEKLLTLKQILKSAQQAKKLGSTRFCMGAAWKNPKERDMHFLKTVIQEVKKLGL 123

Query: 138 ETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSGI 197
           ETCMTLG L  +QA  L+KAGLD+YNHN+DTS+ +Y  + TT T++DRL TL+ VRKSG+
Sbjct: 124 ETCMTLGTLHNDQADRLAKAGLDFYNHNLDTSKSYYQKIVTTRTYQDRLNTLKKVRKSGM 183

Query: 198 KVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEHVR 257
           K+C GGILGLGE + DRI++L+ L+NL   PESIPIN+L+ + G+  E    +D  + ++
Sbjct: 184 KICSGGILGLGEKLKDRIELLIELSNLEIAPESIPINMLVKVKGTPLENQTSIDTFDFIK 243

Query: 258 IISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTILF 317
            I++ RI+MP S +RL+AGR  M+++ QA+CF SGANSIF G  LLT  NP   +D  LF
Sbjct: 244 TIAITRIMMPTSYIRLSAGRENMNEQTQAMCFLSGANSIFYGCKLLTTPNPKKERDKQLF 303

Query: 318 NRLGLI 323
           ++LGL 
Sbjct: 304 SKLGLN 309


>gi|260913622|ref|ZP_05920098.1| biotin synthase [Pasteurella dagmatis ATCC 43325]
 gi|260632161|gb|EEX50336.1| biotin synthase [Pasteurella dagmatis ATCC 43325]
          Length = 337

 Score =  300 bits (768), Expect = 2e-79,   Method: Composition-based stats.
 Identities = 152/309 (49%), Positives = 217/309 (70%)

Query: 17  KVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQSV 76
           + W+  +V  ++  PF DL++ +  +HR+NF P  IQLS L++IKTGGCPE+CGYC QS 
Sbjct: 19  EYWSVCKVEALFETPFLDLVYRAAQIHRENFNPKAIQLSTLMSIKTGGCPEDCGYCPQSA 78

Query: 77  HNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLG 136
             ++ ++  +L+ +D+++++AK AK  GA R+CMGAAWR PK +D++ I ++IK VK+LG
Sbjct: 79  RYQTGVQNQQLLEIDEIVEKAKIAKARGAGRFCMGAAWRGPKPKDVAKITEIIKAVKALG 138

Query: 137 LETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSG 196
           LETC T G+L    A+ L  AGLDYYNHN+DT+   Y +V  T  F+DR+ TL  VRK+G
Sbjct: 139 LETCGTFGLLQDGMAEDLKAAGLDYYNHNLDTAPEHYHNVIGTRQFDDRINTLGKVRKAG 198

Query: 197 IKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEHV 256
           +KVCCGGI+G+ E   +R  ++ +LANL   PES+PIN L+ + G+   +  ++D  E V
Sbjct: 199 LKVCCGGIVGMNETRKERAGLIASLANLDPQPESVPINQLVKVEGTPLADAAELDWTEFV 258

Query: 257 RIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTIL 316
           R I+VARI MPKS +RL+AGR  MS+E+QA+CF +GANSIF GD LL   NP  + D +L
Sbjct: 259 RTIAVARITMPKSYVRLSAGRQGMSEEMQAMCFMAGANSIFYGDKLLVTGNPEEDGDQLL 318

Query: 317 FNRLGLIPD 325
             +L L P+
Sbjct: 319 MAKLDLEPE 327


>gi|52841702|ref|YP_095501.1| biotin synthase BioB [Legionella pneumophila subsp. pneumophila
           str. Philadelphia 1]
 gi|54297383|ref|YP_123752.1| biotin synthase [Legionella pneumophila str. Paris]
 gi|81601849|sp|Q5X592|BIOB_LEGPA RecName: Full=Biotin synthase
 gi|81603358|sp|Q5ZVG8|BIOB_LEGPH RecName: Full=Biotin synthase
 gi|52628813|gb|AAU27554.1| biotin synthase BioB [Legionella pneumophila subsp. pneumophila
           str. Philadelphia 1]
 gi|53751168|emb|CAH12579.1| Biotin synthase [Legionella pneumophila str. Paris]
 gi|307610173|emb|CBW99724.1| biotin synthase [Legionella pneumophila 130b]
          Length = 315

 Score =  300 bits (767), Expect = 2e-79,   Method: Composition-based stats.
 Identities = 186/311 (59%), Positives = 237/311 (76%)

Query: 13  TKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYC 72
           +++ K W+  ++  IY  PFNDLL+ +HT+HR   +PN +Q + LL+IKTG CPE+CGYC
Sbjct: 2   SEEKKQWSISDIEAIYQQPFNDLLYQAHTIHRTYHDPNSLQFATLLSIKTGACPEDCGYC 61

Query: 73  NQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGV 132
           +QS H K+ ++  KL++V++VL+ AK AKE GA R+CMGAAWR P ++ +  + +MI+GV
Sbjct: 62  SQSGHYKTHVEKEKLMSVEEVLQCAKEAKEGGAKRFCMGAAWRCPPDKAIPQLKEMIEGV 121

Query: 133 KSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENV 192
           KSLGLETCMTLGML+ EQA  L +AGLDYYNHNIDTS  +Y  V TT  F DRL TL NV
Sbjct: 122 KSLGLETCMTLGMLTKEQASHLKEAGLDYYNHNIDTSPSYYDKVVTTRKFSDRLDTLNNV 181

Query: 193 RKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDP 252
           R +GI VCCGGILGLGE  +DRI+ LLTLAN+ TPPES+PIN LIP+ G+   + ++V+ 
Sbjct: 182 RSAGINVCCGGILGLGETREDRIEFLLTLANMETPPESVPINRLIPVEGTPLAQAERVEG 241

Query: 253 IEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNK 312
           IE VR I+ ARILMPKS +RL AGR  MSDELQALC+F+GANS+F+GD LLT  NP   K
Sbjct: 242 IELVRTIATARILMPKSAIRLTAGRTEMSDELQALCYFAGANSVFIGDKLLTEDNPQRFK 301

Query: 313 DTILFNRLGLI 323
           D  LFN+LGL 
Sbjct: 302 DKTLFNKLGLT 312


>gi|52425578|ref|YP_088715.1| BioB protein [Mannheimia succiniciproducens MBEL55E]
 gi|81609473|sp|Q65SD0|BIOB_MANSM RecName: Full=Biotin synthase
 gi|52307630|gb|AAU38130.1| BioB protein [Mannheimia succiniciproducens MBEL55E]
          Length = 336

 Score =  300 bits (767), Expect = 2e-79,   Method: Composition-based stats.
 Identities = 153/316 (48%), Positives = 219/316 (69%)

Query: 12  PTKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGY 71
           P  + + W+  +V  ++  PF +L+  +  VHR+NF P  IQLS L++IKTGGCPE+CGY
Sbjct: 12  PHPQVEYWSVCKVEALFETPFLELVHRAALVHRENFNPQAIQLSTLMSIKTGGCPEDCGY 71

Query: 72  CNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKG 131
           C QS   ++ ++  +L+NV+ ++++AK AK  GA+R+CMGAAWR PK +D++ + ++IK 
Sbjct: 72  CPQSARYQTGVQKQELLNVEDIVEKAKIAKSRGASRFCMGAAWRGPKPKDIAKMTEIIKA 131

Query: 132 VKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLEN 191
           VK+LGLETC T G+L    A+ L +AGLDYYNHN+DTS   Y  V  T  F+DRL TL  
Sbjct: 132 VKALGLETCGTFGLLDDGMAEDLKEAGLDYYNHNLDTSPEHYNKVIGTRGFDDRLNTLGK 191

Query: 192 VRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVD 251
           VRK+G+KVCCGGI+G+ E   +R   + +LANL   PES+PIN L+ + G+   + +++D
Sbjct: 192 VRKAGLKVCCGGIIGMNESRKERAGFIASLANLDPQPESVPINQLVKVEGTPLSDAQELD 251

Query: 252 PIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYN 311
             E VR ++VARI MPKS +RL+AGR  MS+E+QA+CF +GANSIF GD LL   N   +
Sbjct: 252 WTEFVRTVAVARITMPKSYVRLSAGRQGMSEEMQAMCFMAGANSIFYGDKLLVTGNAEED 311

Query: 312 KDTILFNRLGLIPDLS 327
            D +L  +L L P+ +
Sbjct: 312 CDRLLMEKLDLEPETT 327


>gi|170084817|ref|XP_001873632.1| biotin synthase, BioB [Laccaria bicolor S238N-H82]
 gi|164651184|gb|EDR15424.1| biotin synthase, BioB [Laccaria bicolor S238N-H82]
          Length = 411

 Score =  300 bits (767), Expect = 2e-79,   Method: Composition-based stats.
 Identities = 147/324 (45%), Positives = 217/324 (66%), Gaps = 3/324 (0%)

Query: 1   MSRSTVVPEENPTKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNI 60
           ++     P      +   WT +E+ QIY+ P  +L++ + +VHR++ +P  IQL  L+NI
Sbjct: 56  LATHASAPATRSLTRN-DWTKQEIQQIYDTPLLELVYRAASVHRQHQDPTKIQLCTLMNI 114

Query: 61  KTGGCPENCGYCNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREP--K 118
           KTGGC E+C YC+QS    +  KAS+LI ++ VL+ A+ AKENG+TR+CMGAAWR+   +
Sbjct: 115 KTGGCSEDCSYCSQSSRYSTPTKASRLIELEPVLEAARKAKENGSTRFCMGAAWRDLAGR 174

Query: 119 ERDLSIIVDMIKGVKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTT 178
           +R    I++M++ V+ +G+E C TLGMLS EQA+ L +AGL  YNHN+DTS  FYP V T
Sbjct: 175 KRGFEKILEMVREVRGMGMEVCTTLGMLSPEQARQLKEAGLTAYNHNLDTSREFYPQVIT 234

Query: 179 THTFEDRLQTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIP 238
           T ++++RL T+  VR +GI VC GGILGLGE   DR+ ++  ++N+   PES P+N L+P
Sbjct: 235 TRSYDERLDTISAVRDAGISVCSGGILGLGESDADRVGLIYEVSNMPEHPESFPVNALVP 294

Query: 239 IPGSKFEENKKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFV 298
           IPG+  E N  V     +R I+ ARI MP + +RLAAGR  +++  QALCF +GAN++F 
Sbjct: 295 IPGTPLEGNDIVPYHTLIRTIATARIAMPATIIRLAAGRNTLAESEQALCFMAGANAVFT 354

Query: 299 GDTLLTAKNPSYNKDTILFNRLGL 322
           G+ +LT     +++D  + +R GL
Sbjct: 355 GEQMLTTPCSPWDEDKAMMDRWGL 378


>gi|269308637|gb|ACZ34281.1| biotin synthase [Heterodera glycines]
          Length = 338

 Score =  300 bits (767), Expect = 2e-79,   Method: Composition-based stats.
 Identities = 166/308 (53%), Positives = 222/308 (72%), Gaps = 2/308 (0%)

Query: 18  VWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQSVH 77
            WT  E   ++++ F +L+F +  VH+++  P+ +Q+S LL+IKTG CPENC YC QS +
Sbjct: 11  KWTFSEALSVFSLAFPELIFRAQNVHQQHHNPSQVQISTLLSIKTGACPENCSYCPQSGY 70

Query: 78  NKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMI-KGVKSLG 136
           +K+ LK   L+ V+QVL+ AK AK +GATR+CMGAAWR PK+RDL  + +M+ K  +  G
Sbjct: 71  HKTGLKKEPLMEVEQVLEAAKRAKASGATRFCMGAAWRGPKDRDLDKVCEMVAKVKQLGG 130

Query: 137 LETCMTLGML-SFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKS 195
           LETC TLG+L +  QAQ L KAGLD+YNHNID S+ FY  + TT  F+DR+ T+E VR +
Sbjct: 131 LETCATLGLLKNEGQAQRLKKAGLDFYNHNIDCSKDFYHKIITTRRFDDRISTIEKVRSA 190

Query: 196 GIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEH 255
           GIKVCCGGI+G+GE  ++R+ ML+TLAN + PPES+PIN L+P PG+        DP + 
Sbjct: 191 GIKVCCGGIIGMGENNEERVKMLVTLANFAPPPESVPINKLMPFPGTPLANAPAPDPFDF 250

Query: 256 VRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTI 315
           VR I+ AR+LMP + +RL+AGR  M+DELQALCF +GANS+F G+ LLTA NP   KD  
Sbjct: 251 VRTIATARVLMPMAYIRLSAGREQMADELQALCFLAGANSLFFGEKLLTASNPMPEKDKE 310

Query: 316 LFNRLGLI 323
           LF RLGL 
Sbjct: 311 LFQRLGLK 318


>gi|148359001|ref|YP_001250208.1| biotin synthase BioB [Legionella pneumophila str. Corby]
 gi|296107050|ref|YP_003618750.1| biotin synthetase [Legionella pneumophila 2300/99 Alcoy]
 gi|254810723|sp|A5IBW2|BIOB_LEGPC RecName: Full=Biotin synthase
 gi|148280774|gb|ABQ54862.1| biotin synthase BioB [Legionella pneumophila str. Corby]
 gi|295648951|gb|ADG24798.1| biotin synthetase [Legionella pneumophila 2300/99 Alcoy]
          Length = 315

 Score =  300 bits (767), Expect = 2e-79,   Method: Composition-based stats.
 Identities = 186/311 (59%), Positives = 237/311 (76%)

Query: 13  TKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYC 72
           +++ K W+  ++  IY  PFNDLL+ +HT+HR   +PN +Q + LL+IKTG CPE+CGYC
Sbjct: 2   SEENKQWSISDIEAIYQQPFNDLLYQAHTIHRTYHDPNSLQFATLLSIKTGACPEDCGYC 61

Query: 73  NQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGV 132
           +QS H K+ ++  KL++V++VL+ AK AKE GA R+CMGAAWR P ++ +  + +MI+GV
Sbjct: 62  SQSGHYKTHVEKEKLMSVEEVLQCAKEAKEGGAKRFCMGAAWRCPPDKAIPQLKEMIEGV 121

Query: 133 KSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENV 192
           KSLGLETCMTLGML+ EQA  L +AGLDYYNHNIDTS  +Y  V TT  F DRL TL NV
Sbjct: 122 KSLGLETCMTLGMLTKEQASHLKEAGLDYYNHNIDTSPSYYDKVVTTRKFSDRLDTLNNV 181

Query: 193 RKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDP 252
           R +GI VCCGGILGLGE  +DRI+ LLTLAN+ TPPES+PIN LIP+ G+   + ++V+ 
Sbjct: 182 RSAGINVCCGGILGLGETREDRIEFLLTLANMETPPESVPINRLIPVEGTPLAQAERVEG 241

Query: 253 IEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNK 312
           IE VR I+ ARILMPKS +RL AGR  MSDELQALC+F+GANS+F+GD LLT  NP   K
Sbjct: 242 IELVRTIATARILMPKSAIRLTAGRTEMSDELQALCYFAGANSVFIGDKLLTEDNPQRFK 301

Query: 313 DTILFNRLGLI 323
           D  LFN+LGL 
Sbjct: 302 DKTLFNKLGLT 312


>gi|88811928|ref|ZP_01127181.1| biotin synthetase [Nitrococcus mobilis Nb-231]
 gi|88790812|gb|EAR21926.1| biotin synthetase [Nitrococcus mobilis Nb-231]
          Length = 340

 Score =  300 bits (767), Expect = 3e-79,   Method: Composition-based stats.
 Identities = 168/317 (52%), Positives = 223/317 (70%)

Query: 7   VPEENPTKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCP 66
           +           W   EV ++    FNDLLF +  +HR+ F+PN +Q+  L +IKTG CP
Sbjct: 1   MAVSEGADIRHDWRHSEVEELLGQAFNDLLFQAQEIHRRYFDPNEVQVCTLQSIKTGSCP 60

Query: 67  ENCGYCNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIV 126
           E+C YC QS+   + ++   L+NV+ VL  A+ A+  GATR+CMGAAWR PK+RDL+ ++
Sbjct: 61  EDCKYCPQSIRYHAGVEPEALMNVETVLAAAQKARAAGATRFCMGAAWRRPKDRDLTRVI 120

Query: 127 DMIKGVKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRL 186
           +M++ +K+LG+ETC TLGML+  QAQ L  AGLDYYNHNIDTS  +YP+V TT T+ DRL
Sbjct: 121 EMVRAIKALGMETCATLGMLTAAQAQRLQTAGLDYYNHNIDTSPEYYPNVITTRTYRDRL 180

Query: 187 QTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEE 246
           +TL +VR +GIK+CCGGI+GLGE   DR  ML TLANL   P+S+PIN LI +PG+   +
Sbjct: 181 ETLAHVRAAGIKLCCGGIIGLGETRADRAGMLCTLANLPEHPQSVPINQLIQVPGTPLYD 240

Query: 247 NKKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAK 306
              V+P E VR+I+V+RILMPK+ +RL+AGR  MSDE QALCF +GANSIF G+ LLT  
Sbjct: 241 TPAVEPFEMVRVIAVSRILMPKAWIRLSAGRCEMSDETQALCFLAGANSIFYGERLLTTD 300

Query: 307 NPSYNKDTILFNRLGLI 323
           NP    D +LF +LGL 
Sbjct: 301 NPEEQHDRVLFAKLGLR 317


>gi|238503604|ref|XP_002383035.1| biotin synthase, putative [Aspergillus flavus NRRL3357]
 gi|317138595|ref|XP_003189061.1| biotin synthase [Aspergillus oryzae RIB40]
 gi|220690506|gb|EED46855.1| biotin synthase, putative [Aspergillus flavus NRRL3357]
 gi|311893277|dbj|BAJ25843.1| putative biotin synthase AoBioB [Aspergillus oryzae]
          Length = 388

 Score =  299 bits (766), Expect = 3e-79,   Method: Composition-based stats.
 Identities = 148/325 (45%), Positives = 213/325 (65%), Gaps = 2/325 (0%)

Query: 5   TVVPEENPTKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGG 64
            +      T     WT +EV QIY  P N L + +  VHR+  +P+ IQ+  L+NIKTGG
Sbjct: 36  ALQEATAATVPRTTWTREEVQQIYETPLNQLTYAAAAVHRRFHDPSAIQMCTLMNIKTGG 95

Query: 65  CPENCGYCNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKER--DL 122
           C E+C YC QS  + + LKA+K+  VD VLK A+ AK NG+TR+CMGAAWR+ + R   L
Sbjct: 96  CSEDCSYCAQSSRHNTGLKATKMSPVDDVLKAARIAKANGSTRFCMGAAWRDMRGRKTSL 155

Query: 123 SIIVDMIKGVKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTF 182
             +  M+ GV+ +G+E C+TLGM+   QA+ L  AGL  YNHN+DTS  FYP + TT ++
Sbjct: 156 KNVKQMVSGVREMGMEVCVTLGMIDENQAKELKDAGLTAYNHNLDTSREFYPTIITTRSY 215

Query: 183 EDRLQTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGS 242
           ++RL+TL +VR +GI VC GGILGLGE   DRI ++ T+++L + PES P+N L+PIPG+
Sbjct: 216 DERLKTLSHVRDAGINVCSGGILGLGEADSDRIGLIHTVSSLPSHPESFPVNALVPIPGT 275

Query: 243 KFEENKKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTL 302
              E K +   + +R I+ ARI++P + +RLAAGR  +S+E Q  CF +GAN++F G+ +
Sbjct: 276 PLGERKMISFDKLLRTIATARIVLPATIVRLAAGRISLSEEQQVQCFMAGANAVFTGEKM 335

Query: 303 LTAKNPSYNKDTILFNRLGLIPDLS 327
           LT     +++D  +F + G  P  S
Sbjct: 336 LTTDCNGWDEDREMFEKWGFYPMKS 360


>gi|145250451|ref|XP_001396739.1| biotin synthase [Aspergillus niger CBS 513.88]
 gi|61696866|gb|AAX53106.1| biotin synthase [Aspergillus niger]
 gi|134082259|emb|CAK42303.1| unnamed protein product [Aspergillus niger]
          Length = 384

 Score =  299 bits (766), Expect = 3e-79,   Method: Composition-based stats.
 Identities = 147/325 (45%), Positives = 215/325 (66%), Gaps = 2/325 (0%)

Query: 5   TVVPEENPTKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGG 64
            +      T     WT +E+ QIY  P N L + +  VHR+  +P+ IQ+  L+NIKTGG
Sbjct: 35  ALREATAATAPRTNWTREEIQQIYETPLNQLTYAAAAVHRRFHDPSAIQMCTLMNIKTGG 94

Query: 65  CPENCGYCNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKER--DL 122
           C E+C YC QS   ++ LKA+K+  VD+VL+ A+ AK NG+TR+CMGAAWR+ + R   L
Sbjct: 95  CSEDCSYCAQSSRYQTGLKATKMSPVDEVLEAARIAKSNGSTRFCMGAAWRDMRGRKTSL 154

Query: 123 SIIVDMIKGVKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTF 182
             I  M+ GV+ +G+E C+TLGM+   QA+ L  AGL  YNHN+DTS  FYP + TT ++
Sbjct: 155 KNIKSMVSGVRGMGMEVCVTLGMIDEAQAKELKDAGLTAYNHNLDTSREFYPEIITTRSY 214

Query: 183 EDRLQTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGS 242
           ++RL+TLENVR +GI VC GGILGLGE  +DR+ ++ T++ L   PES P+N L+PIPG+
Sbjct: 215 DERLKTLENVRDAGINVCSGGILGLGEKDEDRVGLIYTMSGLEKHPESFPVNALVPIPGT 274

Query: 243 KFEENKKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTL 302
              E K +   + +R ++ AR++MP + +RLAAGR  +S+E Q  CF +GAN++F G+ +
Sbjct: 275 PLGERKMISFDKILRTVATARVVMPATIVRLAAGRISLSEEQQVACFMAGANAVFTGEKM 334

Query: 303 LTAKNPSYNKDTILFNRLGLIPDLS 327
           LT +   +++D  +F + G  P  S
Sbjct: 335 LTTECNGWDEDRAMFEKWGFYPMKS 359


>gi|167854857|ref|ZP_02477634.1| biotin synthase [Haemophilus parasuis 29755]
 gi|219871454|ref|YP_002475829.1| biotin synthase [Haemophilus parasuis SH0165]
 gi|223041519|ref|ZP_03611720.1| biotin synthase [Actinobacillus minor 202]
 gi|254810712|sp|B8F6C9|BIOB_HAEPS RecName: Full=Biotin synthase
 gi|167854036|gb|EDS25273.1| biotin synthase [Haemophilus parasuis 29755]
 gi|219691658|gb|ACL32881.1| biotin synthase [Haemophilus parasuis SH0165]
 gi|223017614|gb|EEF16024.1| biotin synthase [Actinobacillus minor 202]
          Length = 335

 Score =  299 bits (766), Expect = 3e-79,   Method: Composition-based stats.
 Identities = 152/326 (46%), Positives = 218/326 (66%)

Query: 3   RSTVVPEENPTKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKT 62
           R     E  P    + W   +V +++++PF DL+F +  +HR++F+PN IQLS LL+IKT
Sbjct: 7   RLKAKNELTPHPTAQYWRKCQVEELFDLPFMDLVFRAAEIHRQHFDPNAIQLSTLLSIKT 66

Query: 63  GGCPENCGYCNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDL 122
           GGC E+C YC QS    + ++   +++V+ ++++A+ AK  GA+R+CMGAAWR PK +D+
Sbjct: 67  GGCAEDCEYCPQSARYDTGVEKQSMLDVNYIVEKAQIAKARGASRFCMGAAWRGPKPKDI 126

Query: 123 SIIVDMIKGVKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTF 182
             +  +IK VKSLGLETC T GML    A+ L +AGLDYYNHN+DT    Y  V  T + 
Sbjct: 127 ETVSAIIKAVKSLGLETCGTFGMLEEGMAEDLKEAGLDYYNHNLDTDPERYHQVIHTRSH 186

Query: 183 EDRLQTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGS 242
           +DR+ TL  VR +G+K+CCGGI+G+ E   +R  ++ +LANL   PES+PIN L+ + G+
Sbjct: 187 DDRMDTLGKVRSAGLKICCGGIVGMNETRAERAGLIASLANLDPQPESVPINQLVKVAGT 246

Query: 243 KFEENKKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTL 302
             E  + +D  E VR I+VARI MPKS +RL+AGR+ M + +QALCF +GANSIF GD L
Sbjct: 247 PLENAEDLDWTEFVRTIAVARITMPKSYVRLSAGRSNMPEAMQALCFMAGANSIFYGDKL 306

Query: 303 LTAKNPSYNKDTILFNRLGLIPDLSA 328
           LT +NP  + D +L  +L L P   +
Sbjct: 307 LTTENPEEDGDRVLMEKLNLYPLSCS 332


>gi|54294487|ref|YP_126902.1| biotin synthase [Legionella pneumophila str. Lens]
 gi|81601343|sp|Q5WW97|BIOB_LEGPL RecName: Full=Biotin synthase
 gi|53754319|emb|CAH15796.1| Biotin synthase [Legionella pneumophila str. Lens]
          Length = 315

 Score =  299 bits (766), Expect = 3e-79,   Method: Composition-based stats.
 Identities = 185/311 (59%), Positives = 236/311 (75%)

Query: 13  TKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYC 72
           +++ K W+  ++  IY  PFNDLL+ +H +HR   +PN +Q + LL+IKTG CPE+CGYC
Sbjct: 2   SEEKKQWSISDIEAIYQQPFNDLLYQAHAIHRTYHDPNSLQFATLLSIKTGACPEDCGYC 61

Query: 73  NQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGV 132
           +QS H K+ ++  KL++V++VL+ AK AKE GA R+CMGAAWR P ++ +  + +MI+GV
Sbjct: 62  SQSGHYKTHVEKEKLMSVEEVLQCAKEAKEGGAKRFCMGAAWRCPPDKAIPQLKEMIEGV 121

Query: 133 KSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENV 192
           KSLGLETCMTLGML+ EQA  L +AGLDYYNHNIDTS  +Y  V TT  F DRL TL NV
Sbjct: 122 KSLGLETCMTLGMLTKEQASHLKEAGLDYYNHNIDTSPSYYDKVVTTRKFSDRLDTLNNV 181

Query: 193 RKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDP 252
           R +GI VCCGGILGLGE  +DRI+ LLTLAN+ TPPES+PIN LIP+ G+   + ++V+ 
Sbjct: 182 RSAGINVCCGGILGLGETREDRIEFLLTLANMETPPESVPINRLIPVEGTPLAQAERVEG 241

Query: 253 IEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNK 312
           IE VR I+ ARILMPKS +RL AGR  MSDELQALC+F+GANS+F+GD LLT  NP   K
Sbjct: 242 IELVRTIATARILMPKSAIRLTAGRTEMSDELQALCYFAGANSVFIGDKLLTEDNPQRFK 301

Query: 313 DTILFNRLGLI 323
           D  LFN+LGL 
Sbjct: 302 DKTLFNKLGLT 312


>gi|325106038|ref|YP_004275692.1| biotin synthase [Pedobacter saltans DSM 12145]
 gi|324974886|gb|ADY53870.1| biotin synthase [Pedobacter saltans DSM 12145]
          Length = 331

 Score =  299 bits (766), Expect = 3e-79,   Method: Composition-based stats.
 Identities = 154/312 (49%), Positives = 212/312 (67%), Gaps = 3/312 (0%)

Query: 16  PKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQS 75
              WT +E+ +IYN P  +L++ + TVHR+  + + +Q+S LL++KTGGCPE+C YC Q+
Sbjct: 8   RHNWTKEELLEIYNKPLIELVYEAATVHREWHKADEVQISTLLSVKTGGCPEDCSYCGQA 67

Query: 76  VHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKE-RDLSIIVDMIKGVKS 134
               + +K   L+  + V+  A+ AK+NG++R+CM AAWRE ++  D   I+DM+KGV  
Sbjct: 68  ARYHTDIKVQALLPTETVIAHAQKAKDNGSSRFCMAAAWREVRDNSDFDRIIDMVKGVND 127

Query: 135 LGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRK 194
           LGLE C TLGML+  QAQ L  AGL  YNHN+DTSE +Y  + +T  F++R+ T+ NVRK
Sbjct: 128 LGLEVCCTLGMLTENQAQRLQDAGLYAYNHNLDTSEEYYDEIISTRQFDNRINTINNVRK 187

Query: 195 SGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIE 254
           +GI VC GGI+GLGE  +DRI ML TLAN+   PES+PIN L  + G+  E N KVD  +
Sbjct: 188 AGITVCSGGIIGLGETNEDRISMLRTLANMEKHPESVPINALARVKGTPLENNPKVDIWD 247

Query: 255 HVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGD--TLLTAKNPSYNK 312
            VR+I+ ARI+MP S +RL+AGR  MS+  QA CF +GANSIF G+  TLL   NP  ++
Sbjct: 248 MVRMIATARIVMPASMVRLSAGRIEMSETEQAWCFMAGANSIFTGERQTLLVTPNPGVSE 307

Query: 313 DTILFNRLGLIP 324
           D  +   LGL P
Sbjct: 308 DMQMLKNLGLKP 319


>gi|332290174|ref|YP_004421026.1| biotin synthase [Gallibacterium anatis UMN179]
 gi|330433070|gb|AEC18129.1| biotin synthase [Gallibacterium anatis UMN179]
          Length = 336

 Score =  299 bits (766), Expect = 3e-79,   Method: Composition-based stats.
 Identities = 152/326 (46%), Positives = 220/326 (67%), Gaps = 1/326 (0%)

Query: 1   MSRSTV-VPEENPTKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLN 59
           M+ +T+ +    P    + W+  +V  ++  PF DL++ +  VHR++F P  IQLS L++
Sbjct: 1   MTTTTIELTSLTPHPSVEYWSVCKVEALFETPFLDLIYRAAQVHREHFNPQAIQLSTLMS 60

Query: 60  IKTGGCPENCGYCNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKE 119
           IKTGGCPE+CGYC QS   ++ ++  +L++++ ++ +AK AKE GA R+CMGAAWR PK 
Sbjct: 61  IKTGGCPEDCGYCPQSARYQTGVQKEELLDIEDIVAKAKIAKERGAGRFCMGAAWRGPKP 120

Query: 120 RDLSIIVDMIKGVKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTT 179
           +D+  +  +IK VK LGLETC T G+L    A+ L +AGLDYYNHNIDT+   Y  V +T
Sbjct: 121 KDIEKVSAIIKAVKELGLETCGTFGLLQDGMAEQLKEAGLDYYNHNIDTAPEHYEEVIST 180

Query: 180 HTFEDRLQTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPI 239
             F+DR+ TL  VRK+G+KVCCGGI+G+ E   +R  ++ +LANL   PES+PIN L+ +
Sbjct: 181 RRFDDRINTLGKVRKAGLKVCCGGIVGMNETRKERAGLIASLANLDPQPESVPINQLVKV 240

Query: 240 PGSKFEENKKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVG 299
            G+   E +++D  E VR ++VARI MP S +RL+AGR  M + +QALCF +GANSIF G
Sbjct: 241 EGTPMMEAEELDWTEFVRTVAVARITMPNSYVRLSAGRHKMPEAMQALCFMAGANSIFYG 300

Query: 300 DTLLTAKNPSYNKDTILFNRLGLIPD 325
           D LL   N   + D +L  +L L+P+
Sbjct: 301 DKLLVTGNNEEDHDQMLMAKLDLVPE 326


>gi|301101411|ref|XP_002899794.1| biotin synthase [Phytophthora infestans T30-4]
 gi|262102796|gb|EEY60848.1| biotin synthase [Phytophthora infestans T30-4]
          Length = 377

 Score =  299 bits (766), Expect = 3e-79,   Method: Composition-based stats.
 Identities = 150/314 (47%), Positives = 210/314 (66%), Gaps = 3/314 (0%)

Query: 13  TKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYC 72
           ++    WT +EV  I++ P  +L++ + TVHR +F+P  +Q   LL+IKTGGC E+C YC
Sbjct: 35  SEVRHDWTKEEVQAIFDQPLLELVYKAATVHRMHFDPTEVQQCTLLSIKTGGCTEDCKYC 94

Query: 73  NQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERD-LSIIVDMIKG 131
           +QS  +K+ +K      V +V++ A+ AK  G+TR+CMG+AWRE  +++    I+DM++ 
Sbjct: 95  SQSSRHKTFVKPEPTKKVQEVVEMARRAKAAGSTRFCMGSAWREVGKKNAFRHILDMVRQ 154

Query: 132 VKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLEN 191
           VK + LE C TLGML+ EQA  L +AGL  YNHN+DTS   Y  V TT T++DRL+T+EN
Sbjct: 155 VKEMDLEVCCTLGMLTKEQAVQLKEAGLSAYNHNLDTSREHYAKVITTRTYDDRLKTIEN 214

Query: 192 VRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENK--K 249
           VRK+GI VCCGGILGLGE   DR+ +L TLA +   PES+P+N L+ + G+   +     
Sbjct: 215 VRKAGISVCCGGILGLGEEKIDRVGLLHTLATMDEHPESVPVNALVSVEGTPLFDEDIAP 274

Query: 250 VDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPS 309
           V   +  R+I+ ARILMPK+ +RL+AGR   +D  Q + F +GANSIF GDTLLT  NP+
Sbjct: 275 VTASDMARMIATARILMPKTMVRLSAGRMSFTDAEQGMMFMAGANSIFNGDTLLTTANPA 334

Query: 310 YNKDTILFNRLGLI 323
           + KD  LF   GL 
Sbjct: 335 FEKDKRLFESFGLK 348


>gi|329113420|ref|ZP_08242201.1| Biotin synthase [Acetobacter pomorum DM001]
 gi|326697245|gb|EGE48905.1| Biotin synthase [Acetobacter pomorum DM001]
          Length = 339

 Score =  299 bits (766), Expect = 3e-79,   Method: Composition-based stats.
 Identities = 169/308 (54%), Positives = 220/308 (71%)

Query: 16  PKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQS 75
              WT  EV  + ++PF +L+F + T+HR  F+P  IQ+S LL+IKTGGCPE+C YC QS
Sbjct: 23  RHDWTVAEVQALLDLPFPELMFRAQTLHRATFDPTEIQISTLLSIKTGGCPEDCAYCPQS 82

Query: 76  VHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSL 135
             ++  +KA KL+ V+ VL EAK AK  GA+R+CMGAAWR PKERDL  +  MI+GVK L
Sbjct: 83  AKHEQGVKADKLMAVEAVLTEAKKAKAAGASRFCMGAAWRSPKERDLDTVCAMIEGVKQL 142

Query: 136 GLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKS 195
           G+ETC+TLGML   QA  L  AGLDYYNHN+DTS  +Y  + +T T+++RL TL NVR +
Sbjct: 143 GMETCVTLGMLDNTQAHKLHDAGLDYYNHNLDTSPEYYGEIISTRTYQERLDTLSNVRDA 202

Query: 196 GIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEH 255
           GI VCCGGI+GLGE   DR  ++  LA L   PES+PINLL+ + G+   +  +V+P++ 
Sbjct: 203 GINVCCGGIVGLGENETDRAGLITALATLPAHPESVPINLLVKVEGTPLAKADEVEPLDF 262

Query: 256 VRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTI 315
           VR+I+ ARI MPKSR+RLAAGR  MSDE QALCF +GANSIF G+ LLT  NP   +D  
Sbjct: 263 VRMIAAARITMPKSRVRLAAGRENMSDETQALCFLAGANSIFYGERLLTTPNPQATRDRA 322

Query: 316 LFNRLGLI 323
           L ++LG+ 
Sbjct: 323 LLDKLGMH 330


>gi|294340599|emb|CAZ88988.1| Biotin synthase (Biotin synthetase) [Thiomonas sp. 3As]
          Length = 345

 Score =  299 bits (766), Expect = 4e-79,   Method: Composition-based stats.
 Identities = 169/319 (52%), Positives = 225/319 (70%)

Query: 7   VPEENPTKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCP 66
            P          W+  +V  ++ MPF DLL+ +  VHR+NF+PN IQLS LL+IKTGGC 
Sbjct: 14  APAAVEPSPSTRWSVAQVDALFAMPFMDLLYRAQQVHRENFDPNMIQLSTLLSIKTGGCS 73

Query: 67  ENCGYCNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIV 126
           E+CGYC QS H+++ ++ASKL+ +D+VL+ A+ AK  GATR+CMGAAWR PKERD+  + 
Sbjct: 74  EDCGYCPQSAHHEAGVQASKLMPLDEVLEAARAAKAEGATRFCMGAAWRSPKERDMESLT 133

Query: 127 DMIKGVKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRL 186
           +M++ V++LGLETCMTLGML  EQA  L  AGLDYYNHN+D++  FY  + +T T++DRL
Sbjct: 134 EMVREVRALGLETCMTLGMLDAEQASELKDAGLDYYNHNLDSAPEFYGSIISTRTYQDRL 193

Query: 187 QTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEE 246
            TL NVR++G+ VCCGGI+G+GE    R  ++  LANL   PES+PIN L+ + G+  E 
Sbjct: 194 DTLVNVREAGVNVCCGGIVGMGESRIQRAGLIAQLANLEPYPESVPINNLVAVKGTPLEG 253

Query: 247 NKKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAK 306
              +DP E VR I+VAR+ MP++++RL+AGR  M D LQALCF +GANSIF GD LLT  
Sbjct: 254 AAPLDPFEFVRTIAVARVTMPRTQVRLSAGREQMDDALQALCFAAGANSIFYGDRLLTTC 313

Query: 307 NPSYNKDTILFNRLGLIPD 325
           NP   +D  L  RLGL   
Sbjct: 314 NPQTQRDRSLLARLGLRVQ 332


>gi|255532062|ref|YP_003092434.1| biotin synthase [Pedobacter heparinus DSM 2366]
 gi|255345046|gb|ACU04372.1| biotin synthase [Pedobacter heparinus DSM 2366]
          Length = 335

 Score =  299 bits (766), Expect = 4e-79,   Method: Composition-based stats.
 Identities = 150/311 (48%), Positives = 208/311 (66%), Gaps = 1/311 (0%)

Query: 14  KKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCN 73
                WT +E+  IY+ PF DL++ + T+HR+N   N +Q+S L++IKTGGC E+C YC 
Sbjct: 3   PTKHNWTKEEISAIYHKPFLDLVYEAATIHRENAAYNEVQVSSLISIKTGGCAEDCSYCP 62

Query: 74  QSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKE-RDLSIIVDMIKGV 132
           Q+    + L+   L+ + QV+  A  AKE GA+R CMGAAWRE ++ RD   +++M+K V
Sbjct: 63  QAARYHTDLEVQPLMQLGQVVSAAVKAKEGGASRLCMGAAWREVRDNRDFDRVIEMVKAV 122

Query: 133 KSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENV 192
             + +E C TLGML+  QAQ L+ AGL  YNHNIDTSE  Y  + TT T+ DRL T++NV
Sbjct: 123 NEMDMEVCCTLGMLTENQAQRLADAGLYAYNHNIDTSEEDYKRIITTRTYNDRLNTIKNV 182

Query: 193 RKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDP 252
           RK+ + VC GGI+GLGE  +DR+ ML TLAN+   PES+P+N L+P+ G+   +  +V  
Sbjct: 183 RKAKLTVCSGGIIGLGETTEDRVAMLQTLANMEVHPESVPVNALVPVKGTPLADQPRVPI 242

Query: 253 IEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNK 312
            + VR+I+ ARI+MP S +RL+AGR  MS   QA CF +GA+SIF GD LLT  NP++  
Sbjct: 243 WDMVRMIATARIVMPNSVVRLSAGRNEMSTLEQAFCFMAGASSIFAGDKLLTTPNPAFID 302

Query: 313 DTILFNRLGLI 323
           D  +F  LGL 
Sbjct: 303 DMAMFELLGLK 313


>gi|162148725|ref|YP_001603186.1| biotin synthase [Gluconacetobacter diazotrophicus PAl 5]
 gi|161787302|emb|CAP56896.1| putative biotin synthase [Gluconacetobacter diazotrophicus PAl 5]
          Length = 366

 Score =  299 bits (765), Expect = 4e-79,   Method: Composition-based stats.
 Identities = 165/309 (53%), Positives = 219/309 (70%), Gaps = 1/309 (0%)

Query: 16  PKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQS 75
              WT  E+  +  +PF +L+F + +VHR  F+P  IQ+S LL+IKTGGCPE+C YC QS
Sbjct: 52  RTDWTRDEIAALIALPFPELMFRAQSVHRARFDPTEIQISTLLSIKTGGCPEDCAYCPQS 111

Query: 76  VHN-KSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKS 134
             +    +KAS+L+ V+ VLKEA+ A++ GA R+CMGAAWR PK+ DL  +  M++GVKS
Sbjct: 112 AKHEDGGVKASRLMAVEAVLKEARAARDAGAARFCMGAAWRSPKDHDLETVCAMVEGVKS 171

Query: 135 LGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRK 194
           LG+ETC+TLGML   QA  L +AGLDYYNHN+DTS   Y  + +T T+++RL TL +VR 
Sbjct: 172 LGMETCVTLGMLDDRQAHRLREAGLDYYNHNLDTSPEHYGSIISTRTYQERLDTLAHVRD 231

Query: 195 SGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIE 254
           +GI VCCGGI+G+GE  DDR  ++ +LA+L   PES+PINLL+ + G+       VDPI+
Sbjct: 232 AGINVCCGGIVGMGENDDDRAGLIASLASLPRHPESVPINLLVRVAGTPLAGADPVDPID 291

Query: 255 HVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDT 314
            VRII+ ARI MP SR+RLAAGR  M+DE Q LCF +GANSIF G+ LLT  NP  ++D 
Sbjct: 292 FVRIIAAARIAMPASRVRLAAGREDMTDEAQTLCFLAGANSIFYGEKLLTTPNPEASRDA 351

Query: 315 ILFNRLGLI 323
            L  RLG+ 
Sbjct: 352 RLLARLGMH 360


>gi|114778943|ref|ZP_01453734.1| biotin synthase [Mariprofundus ferrooxydans PV-1]
 gi|114550815|gb|EAU53383.1| biotin synthase [Mariprofundus ferrooxydans PV-1]
          Length = 324

 Score =  299 bits (765), Expect = 4e-79,   Method: Composition-based stats.
 Identities = 154/308 (50%), Positives = 220/308 (71%)

Query: 18  VWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQSVH 77
            W+ +E+  ++ +PFNDL+F +   HR  F+ N +QLS LL+IKTGGCPE+C YC QS  
Sbjct: 4   DWSIEEIEALFALPFNDLMFRAQQAHRACFDANEVQLSTLLSIKTGGCPEDCKYCPQSSR 63

Query: 78  NKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLGL 137
             + +++  L+  D+V+K A+ AKE GA+R+CMGAAWREPK R   +++DMI+ VK++ +
Sbjct: 64  YTTDVESELLMKKDEVMKAARIAKEKGASRFCMGAAWREPKGRAFDLVLDMIREVKAMDM 123

Query: 138 ETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSGI 197
           E C TLGML+ EQA  L  AGLDYYNHN+DT   +Y  + +T T+E+RL TL+NVR  G+
Sbjct: 124 EACATLGMLTAEQAAKLKAAGLDYYNHNLDTDPEYYKEIISTRTYEERLDTLKNVRAEGM 183

Query: 198 KVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEHVR 257
            VCCGGI+G+GE + +R  M+  LA +S  PES+PIN+L+ + G+  ++   +DP + +R
Sbjct: 184 SVCCGGIVGMGESLRNRAGMIAQLARMSPHPESVPINMLVKVAGTPMQDLDDLDPFDFIR 243

Query: 258 IISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTILF 317
            I+VARI MP S +RL+AGR +M++++QALCF +GANSIF G+ LLT  N    KD  LF
Sbjct: 244 TIAVARITMPSSHVRLSAGREVMNEQMQALCFLAGANSIFYGEKLLTTGNQDAEKDQQLF 303

Query: 318 NRLGLIPD 325
            RLG+ P+
Sbjct: 304 ARLGIRPE 311


>gi|240948869|ref|ZP_04753225.1| biotin synthase [Actinobacillus minor NM305]
 gi|240296684|gb|EER47295.1| biotin synthase [Actinobacillus minor NM305]
          Length = 335

 Score =  299 bits (765), Expect = 4e-79,   Method: Composition-based stats.
 Identities = 152/326 (46%), Positives = 218/326 (66%)

Query: 3   RSTVVPEENPTKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKT 62
           R     E  P    + W   +V +++++PF DL+F +  +HR++F+PN IQLS LL+IKT
Sbjct: 7   RLKAKNELTPHPTAQYWRKCQVEELFDLPFMDLVFRAAEIHRQHFDPNAIQLSTLLSIKT 66

Query: 63  GGCPENCGYCNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDL 122
           GGC E+C YC QS    + ++   +++V+ ++++A+ AK  GA+R+CMGAAWR PK +D+
Sbjct: 67  GGCAEDCEYCPQSARYDTGVEKQSMLDVNYIVEKAQIAKARGASRFCMGAAWRGPKPKDI 126

Query: 123 SIIVDMIKGVKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTF 182
             +  +IK VKSLGLETC T GML    A+ L +AGLDYYNHN+DT    Y  V  T + 
Sbjct: 127 ETVSAIIKAVKSLGLETCGTFGMLEEGMAEDLKEAGLDYYNHNLDTDPERYHQVIHTRSH 186

Query: 183 EDRLQTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGS 242
           +DR+ TL  VR +G+K+CCGGI+G+ E   +R  ++ +LANL   PES+PIN L+ + G+
Sbjct: 187 DDRMDTLGKVRSAGLKICCGGIVGMNETRAERAGLIASLANLDPQPESVPINQLVKVAGT 246

Query: 243 KFEENKKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTL 302
             E  + +D  E VR I+VARI MPKS +RL+AGR+ M + +QALCF +GANSIF GD L
Sbjct: 247 PLENAEDLDWTEFVRTIAVARITMPKSYVRLSAGRSNMPEAMQALCFMAGANSIFYGDKL 306

Query: 303 LTAKNPSYNKDTILFNRLGLIPDLSA 328
           LT +NP  + D +L  +L L P   +
Sbjct: 307 LTTENPEEDGDRVLMEKLNLYPLSCS 332


>gi|145588344|ref|YP_001154941.1| biotin synthase [Polynucleobacter necessarius subsp. asymbioticus
           QLW-P1DMWA-1]
 gi|254810771|sp|A4SV63|BIOB_POLSQ RecName: Full=Biotin synthase
 gi|145046750|gb|ABP33377.1| biotin synthase [Polynucleobacter necessarius subsp. asymbioticus
           QLW-P1DMWA-1]
          Length = 345

 Score =  299 bits (765), Expect = 4e-79,   Method: Composition-based stats.
 Identities = 161/321 (50%), Positives = 217/321 (67%)

Query: 7   VPEENPTKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCP 66
                       WT  ++  ++ +PFN+L+F +   H  NF    ++L+ LL+IKTGGCP
Sbjct: 18  ADLRKEVDASGEWTVSQIEALFALPFNELMFKAQQAHEANFPEGDVELATLLSIKTGGCP 77

Query: 67  ENCGYCNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIV 126
           E+C YC Q+    + +KA KL+ +++VL+ AK AK  G+ R+CMGAAWREPK+RD+  + 
Sbjct: 78  EDCSYCPQAARYDTDVKAEKLMGLEEVLEAAKAAKAAGSNRFCMGAAWREPKDRDIEKVT 137

Query: 127 DMIKGVKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRL 186
            MIKGVK+LGLETC TLGML   QA+ L +AGLD+YNHN+DTSE FY  V +T  ++DRL
Sbjct: 138 AMIKGVKALGLETCATLGMLEANQAKALQEAGLDFYNHNLDTSEDFYRSVISTRGYQDRL 197

Query: 187 QTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEE 246
            T+ NVR +G+ VCCGGI+G+GE  + R   L  LANLS  PES+PIN L+P+ G+   E
Sbjct: 198 DTISNVRAAGMSVCCGGIVGMGESREQRAAFLARLANLSPYPESVPINHLVPVAGTPLAE 257

Query: 247 NKKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAK 306
            K +DP+E VR I+VARI MPK+R+RL+AGR  +   +QA+CF +GANSIF G+ LLT  
Sbjct: 258 QKPLDPLEFVRTIAVARITMPKARVRLSAGRQELGRAIQAMCFMAGANSIFYGEQLLTTG 317

Query: 307 NPSYNKDTILFNRLGLIPDLS 327
           NP   +D  L   LGL    S
Sbjct: 318 NPEAEQDLALLAELGLKTKQS 338


>gi|319779074|ref|YP_004129987.1| Biotin synthase [Taylorella equigenitalis MCE9]
 gi|317109098|gb|ADU91844.1| Biotin synthase [Taylorella equigenitalis MCE9]
          Length = 330

 Score =  299 bits (765), Expect = 4e-79,   Method: Composition-based stats.
 Identities = 155/308 (50%), Positives = 218/308 (70%)

Query: 18  VWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQSVH 77
            W      +++ MPF DL+F +  +HR+  +PN +QLS L++IKTG CPE+C YC QS  
Sbjct: 13  KWNVNMALELFEMPFMDLIFLAQKIHREYHDPNKVQLSTLMSIKTGACPEDCKYCPQSNR 72

Query: 78  NKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLGL 137
            ++ ++  KL+ V++V++ AK AK +GATR+CMGAAWR PK++ L ++ +M++ VK LG+
Sbjct: 73  YQTHVEKEKLLAVEEVIEAAKVAKASGATRFCMGAAWRGPKDQHLEVVKEMVRAVKDLGM 132

Query: 138 ETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSGI 197
           ETC+TLGML   QA+ L +AGLDYYNHN+DTS  FY  + TT T+EDRL TL+ VR +GI
Sbjct: 133 ETCVTLGMLKEGQAEELKEAGLDYYNHNLDTSPEFYGEIITTRTYEDRLNTLQKVRDAGI 192

Query: 198 KVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEHVR 257
           K+CCGGI+G+GE    R  +L+ LANL+ PPES+PIN LI +PG+  E    +D  E +R
Sbjct: 193 KICCGGIVGMGESRAQRAGLLVQLANLNPPPESVPINQLIKVPGTPLESVDDLDQFEFIR 252

Query: 258 IISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTILF 317
            I+VARI+MPKS +RL+AGR  M + +QALCF +GA+++F G+ LLT  NP    D  L 
Sbjct: 253 TIAVARIMMPKSIVRLSAGREQMPETMQALCFMAGASAMFYGECLLTTSNPQITADRALM 312

Query: 318 NRLGLIPD 325
           + L + P 
Sbjct: 313 SNLKMEPV 320


>gi|54309496|ref|YP_130516.1| putative biotin synthase [Photobacterium profundum SS9]
 gi|81615145|sp|Q6LPR2|BIOB_PHOPR RecName: Full=Biotin synthase
 gi|46913932|emb|CAG20714.1| putative biotin synthase [Photobacterium profundum SS9]
          Length = 350

 Score =  299 bits (765), Expect = 4e-79,   Method: Composition-based stats.
 Identities = 163/313 (52%), Positives = 226/313 (72%)

Query: 16  PKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQS 75
              WT  EV  ++  PF DL+F +  VHR+  EPN +Q+S LL+IKTG CPE+C YC QS
Sbjct: 4   RHDWTVAEVQALFEKPFMDLVFEAQQVHRQYHEPNKVQVSTLLSIKTGACPEDCKYCPQS 63

Query: 76  VHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSL 135
            H ++ ++  +L+ V++VL  A+ AK +GATR+CMGAAW+ PKERD+  ++DMI+GVK +
Sbjct: 64  AHYRTDVERERLLEVEKVLDAAQKAKVSGATRFCMGAAWKNPKERDMPYLMDMIRGVKDI 123

Query: 136 GLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKS 195
           GLETCMTLGM++  QA  L+ AGLDYYNHN+DTS  +Y  V TT T++DRL TL +VR +
Sbjct: 124 GLETCMTLGMITGGQADELAGAGLDYYNHNLDTSPEYYGQVITTRTYQDRLDTLSHVRDA 183

Query: 196 GIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEH 255
           G+K+C GGI+G+GE   DR  +L+ LA L T PES+PIN+L+ + G+  E+ + VDP + 
Sbjct: 184 GMKICSGGIIGMGESSRDRAGLLVELATLPTHPESVPINMLVKVKGTPMEDVEDVDPFDF 243

Query: 256 VRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTI 315
           +RII+VARI+MP S +RL+AGR  M++++Q LCF +GANS+F G  LLT  NP  +KD  
Sbjct: 244 IRIIAVARIIMPMSSVRLSAGREDMNEQMQTLCFMAGANSVFYGCKLLTTPNPGEDKDMQ 303

Query: 316 LFNRLGLIPDLSA 328
           LF +LG+     A
Sbjct: 304 LFAKLGINSQEQA 316


>gi|88608192|ref|YP_506492.1| biotin synthase [Neorickettsia sennetsu str. Miyayama]
 gi|88600361|gb|ABD45829.1| biotin synthase [Neorickettsia sennetsu str. Miyayama]
          Length = 333

 Score =  299 bits (765), Expect = 4e-79,   Method: Composition-based stats.
 Identities = 168/297 (56%), Positives = 223/297 (75%)

Query: 17  KVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQSV 76
           KVW   E  +++++PF DLL+ +  VHR+NF  N +QL+ LL++KTGGCPENC YC QS 
Sbjct: 11  KVWQFSEAEELFHLPFLDLLYSAQHVHRENFPHNEVQLAMLLSVKTGGCPENCSYCPQSA 70

Query: 77  HNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLG 136
           H  + L+   +++V++VL+ AK A E GATR+C+GAAWR P+ +DL I+ +MI  +K LG
Sbjct: 71  HYDTGLRKEPVMHVEKVLEAAKRAVELGATRFCIGAAWRGPRGKDLDIVCEMISRIKKLG 130

Query: 137 LETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSG 196
           LETC +LG+LS+EQA  L  AGLD+YNHNIDTS+ +Y  + TT  F DR++TLENV K+G
Sbjct: 131 LETCASLGLLSYEQAVSLKAAGLDFYNHNIDTSQEYYSKIITTRRFSDRIETLENVAKAG 190

Query: 197 IKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEHV 256
           +K+C GGILG+GE  +DRI ML+ L++LS PPESIPIN LIPIPG+   E   VDP++ V
Sbjct: 191 LKICSGGILGMGESNEDRIKMLVELSHLSFPPESIPINKLIPIPGTPLAEKNAVDPLDFV 250

Query: 257 RIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKD 313
           RII++ARI+ PKS +RL+AGR  MSDELQ LCF +GANSIF G+ LLT+ N     D
Sbjct: 251 RIIALARIMFPKSYVRLSAGRESMSDELQTLCFIAGANSIFYGEKLLTSANSDPESD 307


>gi|90414521|ref|ZP_01222496.1| putative biotin synthase [Photobacterium profundum 3TCK]
 gi|90324429|gb|EAS40991.1| putative biotin synthase [Photobacterium profundum 3TCK]
          Length = 350

 Score =  299 bits (765), Expect = 4e-79,   Method: Composition-based stats.
 Identities = 163/313 (52%), Positives = 225/313 (71%)

Query: 16  PKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQS 75
              WT  EV  ++  PF DL+F +  VHR+  EPN +Q+S LL+IKTG CPE+C YC QS
Sbjct: 4   RHDWTVAEVQALFEKPFMDLVFEAQQVHRQYHEPNKVQVSTLLSIKTGACPEDCKYCPQS 63

Query: 76  VHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSL 135
            H ++ ++  +L+ V++VL  A+ AK +GATR+CMGAAW+ PKERD+  ++DMI+GVK +
Sbjct: 64  AHYRTDVERERLLEVEKVLDAAQKAKVSGATRFCMGAAWKNPKERDMPYLMDMIRGVKDI 123

Query: 136 GLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKS 195
           GLETCMTLGM++  QA  L+ AGLDYYNHN+DTS  +Y  V TT T++DRL TL +VR +
Sbjct: 124 GLETCMTLGMITGGQADELAGAGLDYYNHNLDTSPEYYGQVITTRTYQDRLDTLSHVRDA 183

Query: 196 GIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEH 255
           G+K+C GGI+G+GE   DR  +L+ LA L T PES+PIN+L+ + G+  E  + VDP + 
Sbjct: 184 GMKICSGGIIGMGESSRDRAGLLVELATLPTHPESVPINMLVKVKGTPMENVEDVDPFDF 243

Query: 256 VRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTI 315
           +RII+VARI+MP S +RL+AGR  M++++Q LCF +GANS+F G  LLT  NP  +KD  
Sbjct: 244 IRIIAVARIIMPMSSVRLSAGREDMNEQMQTLCFMAGANSVFYGCKLLTTPNPGEDKDMQ 303

Query: 316 LFNRLGLIPDLSA 328
           LF +LG+     A
Sbjct: 304 LFAKLGINSQEQA 316


>gi|326386480|ref|ZP_08208103.1| biotin synthase [Novosphingobium nitrogenifigens DSM 19370]
 gi|326209141|gb|EGD59935.1| biotin synthase [Novosphingobium nitrogenifigens DSM 19370]
          Length = 359

 Score =  299 bits (765), Expect = 4e-79,   Method: Composition-based stats.
 Identities = 162/316 (51%), Positives = 218/316 (68%), Gaps = 6/316 (1%)

Query: 16  PKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQS 75
              WT +E+  ++++PF +L+F +  VHR +     +QL  LL+IKTGGCPE+CGYC+QS
Sbjct: 25  RNDWTREEIAALFDLPFTELVFRAAEVHRAHHRAGEVQLCTLLSIKTGGCPEDCGYCSQS 84

Query: 76  VHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSL 135
           V   S ++A+KL++V  VL+ A  A+++G+ R+CMGAAWR PKERD+  IV M+KGV+ +
Sbjct: 85  VKADSGVEATKLMDVQAVLQAAAQARDSGSKRFCMGAAWRNPKERDMPAIVAMVKGVREM 144

Query: 136 GLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKS 195
           G+ETCMTLGML+  QA  L+ AGLDYYNHNIDTS   Y  V TT +FEDR+ TL+ VR +
Sbjct: 145 GMETCMTLGMLNDAQASQLADAGLDYYNHNIDTSPERYGEVITTRSFEDRIDTLDRVRAA 204

Query: 196 GIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDP--- 252
           GI VC GGI+G+GE   DR+  +  LA +   PES+P+N L+P+ G+   +     P   
Sbjct: 205 GINVCSGGIVGMGETRADRVGFVHALATMDHHPESVPVNALVPVKGTVLGDMLADTPLAK 264

Query: 253 ---IEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPS 309
              IE VR ++VARI MP S +RL+AGR  MS+  QALCF +GANSIF GD LLTA N  
Sbjct: 265 IDDIEFVRTVAVARITMPMSMVRLSAGRESMSEATQALCFLAGANSIFTGDKLLTAANAG 324

Query: 310 YNKDTILFNRLGLIPD 325
            + D+ +F RLGL P 
Sbjct: 325 DDADSAMFARLGLKPM 340


>gi|302877489|ref|YP_003846053.1| biotin synthase [Gallionella capsiferriformans ES-2]
 gi|302580278|gb|ADL54289.1| biotin synthase [Gallionella capsiferriformans ES-2]
          Length = 331

 Score =  299 bits (765), Expect = 5e-79,   Method: Composition-based stats.
 Identities = 156/315 (49%), Positives = 224/315 (71%)

Query: 10  ENPTKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENC 69
              T  P+ W+ + V  ++ +PF DLL+ +  VHR++F+PN +QLS LL+IKTGGC E+C
Sbjct: 12  VKRTATPERWSVEAVESLFALPFADLLYRAQQVHREHFDPNQVQLSTLLSIKTGGCSEDC 71

Query: 70  GYCNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMI 129
           GYC QS  + + ++  K++ +D V++ AK A+  GA R+CMGAAWREP E D+  +VDM+
Sbjct: 72  GYCPQSAFHSTGVEDRKMLALDAVIEAAKAAQAAGADRFCMGAAWREPSEADMLSVVDMV 131

Query: 130 KGVKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTL 189
           + V+ LG+ETC TLGML+  Q + L  AGLDYYNHN+DTS  FY  + +T  ++DRL TL
Sbjct: 132 QAVRGLGMETCATLGMLNDAQTEQLRAAGLDYYNHNLDTSPEFYGDIISTRDYQDRLDTL 191

Query: 190 ENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKK 249
           E VR++G+ VC GGI+G+GE + +R  ++  LANL+  PES+PIN L+ + G+   +  +
Sbjct: 192 ERVRRAGMHVCSGGIVGMGESLTERAGLVAQLANLNPYPESVPINNLVKVEGTPLADAAE 251

Query: 250 VDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPS 309
           +DP++ VR I+VARI MP +R+RL+AGR  MSD +QALCF +GANSIF G+ LLT  NP 
Sbjct: 252 LDPLDFVRTIAVARITMPTARVRLSAGRQAMSDAIQALCFLAGANSIFYGEQLLTTGNPE 311

Query: 310 YNKDTILFNRLGLIP 324
             +D  L ++LG+ P
Sbjct: 312 VERDRALMDKLGMYP 326


>gi|254810869|sp|Q2GDF4|BIOB_NEOSM RecName: Full=Biotin synthase
          Length = 325

 Score =  299 bits (765), Expect = 5e-79,   Method: Composition-based stats.
 Identities = 168/297 (56%), Positives = 223/297 (75%)

Query: 17  KVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQSV 76
           KVW   E  +++++PF DLL+ +  VHR+NF  N +QL+ LL++KTGGCPENC YC QS 
Sbjct: 3   KVWQFSEAEELFHLPFLDLLYSAQHVHRENFPHNEVQLAMLLSVKTGGCPENCSYCPQSA 62

Query: 77  HNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLG 136
           H  + L+   +++V++VL+ AK A E GATR+C+GAAWR P+ +DL I+ +MI  +K LG
Sbjct: 63  HYDTGLRKEPVMHVEKVLEAAKRAVELGATRFCIGAAWRGPRGKDLDIVCEMISRIKKLG 122

Query: 137 LETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSG 196
           LETC +LG+LS+EQA  L  AGLD+YNHNIDTS+ +Y  + TT  F DR++TLENV K+G
Sbjct: 123 LETCASLGLLSYEQAVSLKAAGLDFYNHNIDTSQEYYSKIITTRRFSDRIETLENVAKAG 182

Query: 197 IKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEHV 256
           +K+C GGILG+GE  +DRI ML+ L++LS PPESIPIN LIPIPG+   E   VDP++ V
Sbjct: 183 LKICSGGILGMGESNEDRIKMLVELSHLSFPPESIPINKLIPIPGTPLAEKNAVDPLDFV 242

Query: 257 RIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKD 313
           RII++ARI+ PKS +RL+AGR  MSDELQ LCF +GANSIF G+ LLT+ N     D
Sbjct: 243 RIIALARIMFPKSYVRLSAGRESMSDELQTLCFIAGANSIFYGEKLLTSANSDPESD 299


>gi|320166303|gb|EFW43202.1| biotin synthase [Capsaspora owczarzaki ATCC 30864]
          Length = 393

 Score =  298 bits (764), Expect = 5e-79,   Method: Composition-based stats.
 Identities = 153/318 (48%), Positives = 215/318 (67%), Gaps = 2/318 (0%)

Query: 9   EENPTKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPEN 68
                +    WT  E+ +I++ P  DL++ + TVHR + +P  +Q   LL+IKTGGC E+
Sbjct: 70  ARRDIRIRHDWTRAEIQEIFDTPLLDLMYRAATVHRTHHDPRQVQQCTLLSIKTGGCSED 129

Query: 69  CGYCNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWRE--PKERDLSIIV 126
           C YC QS    + +KA +L+ +  V+  A+ AKE G+TR+CMGAAWR+   ++ + + ++
Sbjct: 130 CAYCPQSSKYTTNVKAERLMQLQSVVDAARKAKEAGSTRFCMGAAWRDVIHRKSNFAHVL 189

Query: 127 DMIKGVKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRL 186
           +M+  V+S+GLE C TLGMLS EQA  L  AGL  YNHN+DTS  FYP + TT T+++RL
Sbjct: 190 EMVSEVRSMGLEVCATLGMLSPEQAVQLKNAGLTAYNHNLDTSREFYPKIITTRTYDERL 249

Query: 187 QTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEE 246
            T+ N R +G+ VC GGI+GLGE ++DR+ +L TL+ L T PES+P+N L+P+PG+   +
Sbjct: 250 NTIANARDAGLSVCSGGIIGLGEDLNDRVGLLHTLSTLPTHPESVPVNALVPVPGTPLGD 309

Query: 247 NKKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAK 306
            +KV   E VR+I+ ARILMP S +RL+AGR   +   QALCFF+GANSIF GD LLT  
Sbjct: 310 REKVKIWEMVRMIATARILMPGSMVRLSAGRVNFTPIEQALCFFAGANSIFTGDKLLTTA 369

Query: 307 NPSYNKDTILFNRLGLIP 324
           N ++N D  LFN LG  P
Sbjct: 370 NNAFNDDQTLFNLLGKRP 387


>gi|310799487|gb|EFQ34380.1| biotin synthase [Glomerella graminicola M1.001]
          Length = 417

 Score =  298 bits (764), Expect = 5e-79,   Method: Composition-based stats.
 Identities = 149/330 (45%), Positives = 217/330 (65%), Gaps = 4/330 (1%)

Query: 2   SRSTVVPEENPTKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIK 61
           ++  +    + T     WT  E+  IY  P  +L F + +VHR+   P  +QL  L+NIK
Sbjct: 75  AKKILQKAASATTVRHDWTKDEISAIYYQPLMELAFQAGSVHRRFHNPAEVQLCTLMNIK 134

Query: 62  TGGCPENCGYCNQSVHNK--SKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKE 119
           TGGC E+C YC QS   +  + LKA K+ +V+ VL  A+ AKENG+TR+CMGAAWR+ + 
Sbjct: 135 TGGCTEDCSYCAQSTRYQDGTGLKAKKVESVESVLAAARKAKENGSTRFCMGAAWRDMRG 194

Query: 120 R--DLSIIVDMIKGVKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVT 177
           R   L  I +M+ GV+ +G+E C+TLGM+  +QA+ L +AGL  YNHN+DTS  FYP V 
Sbjct: 195 RKNSLKNIKEMVSGVRGMGMEVCVTLGMIDEQQARELKEAGLTAYNHNVDTSREFYPSVI 254

Query: 178 TTHTFEDRLQTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLI 237
           +T ++++RL+TL +VR +GI VC GGILGLGE  +DR+ +L T++ L + PES P+N L+
Sbjct: 255 STRSYDERLKTLGHVRDAGINVCSGGILGLGESSEDRVGLLHTVSTLPSHPESFPVNALV 314

Query: 238 PIPGSKFEENKKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIF 297
           PI G+   +   +     +R I+ ARI+MP + +R+AAGR  MS+E QA+CF +GAN+IF
Sbjct: 315 PIKGTPLGDRTPIQFSSMLRTIAAARIIMPATIIRIAAGRKTMSEEQQAMCFMAGANAIF 374

Query: 298 VGDTLLTAKNPSYNKDTILFNRLGLIPDLS 327
            G+ +LT    S+++D  +F R GL P  S
Sbjct: 375 TGEKMLTTDCNSWDEDNAMFGRWGLKPMKS 404


>gi|312796320|ref|YP_004029242.1| biotin synthase [Burkholderia rhizoxinica HKI 454]
 gi|312168095|emb|CBW75098.1| Biotin synthase (EC 2.8.1.6) [Burkholderia rhizoxinica HKI 454]
          Length = 390

 Score =  298 bits (763), Expect = 6e-79,   Method: Composition-based stats.
 Identities = 172/318 (54%), Positives = 237/318 (74%)

Query: 11  NPTKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCG 70
           +       WT +++  ++++PF+DLL+ +HTV R+      +Q+S+LL+IKTGGCPE+CG
Sbjct: 63  DAAPIRHDWTHEQIAALFDLPFDDLLYRAHTVQRRYHAGRGLQISQLLSIKTGGCPEDCG 122

Query: 71  YCNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIK 130
           YC+QSVH ++ LKAS L++VD VL+ A  AK  G  R+CMGAAWR P+ERDL  +  M++
Sbjct: 123 YCSQSVHAETDLKASALMSVDAVLQAAAQAKAAGVQRFCMGAAWRSPRERDLERVCAMVE 182

Query: 131 GVKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLE 190
           GVK+LGLETC+TLGML+  QAQ L+++GLDYYNHNIDTS  +YP V TT T ++RL TLE
Sbjct: 183 GVKALGLETCVTLGMLTGAQAQRLAESGLDYYNHNIDTSPEYYPSVITTRTLQERLDTLE 242

Query: 191 NVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKV 250
           +VR +G+KVCCGGI+G+GE  +DR+ ML TLANL   PES+P+N L+ + G++    + V
Sbjct: 243 HVRNAGLKVCCGGIIGMGESREDRVGMLQTLANLPAHPESVPVNSLMRVEGTRLAHERDV 302

Query: 251 DPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSY 310
           D +E VR I+VARI+MP S +RL+AGR  MSDELQALC F+GA S+F+G+ LLT  NP+ 
Sbjct: 303 DGLEFVRTIAVARIVMPASVIRLSAGREHMSDELQALCLFAGAGSVFIGEKLLTTPNPAP 362

Query: 311 NKDTILFNRLGLIPDLSA 328
           ++D  L +RLG     +A
Sbjct: 363 SQDRELIDRLGATSQEAA 380


>gi|313668294|ref|YP_004048578.1| biotin synthase [Neisseria lactamica ST-640]
 gi|313005756|emb|CBN87210.1| putative biotin synthase [Neisseria lactamica 020-06]
          Length = 350

 Score =  298 bits (763), Expect = 7e-79,   Method: Composition-based stats.
 Identities = 152/316 (48%), Positives = 214/316 (67%)

Query: 9   EENPTKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPEN 68
           E  P    + W   +V  ++ +PF +L++ +  VHR+NF P  IQLS LL+IKTGGCPE+
Sbjct: 13  ERKPHPTARYWKKCDVEALFGLPFLELVYQAAEVHRQNFNPREIQLSTLLSIKTGGCPED 72

Query: 69  CGYCNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDM 128
           C YC QS H+ + L   ++++VD+++++AK A+  GA+R+CMGAAWR PK +D+  +  +
Sbjct: 73  CAYCPQSAHHNTNLGKEQMMDVDEIVEKAKIAQSRGASRFCMGAAWRGPKPKDVETVSAI 132

Query: 129 IKGVKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQT 188
           IK VK LG+ETC T GML    A+ L +AGLDYYNHN+DT    Y  +  T   EDR+ T
Sbjct: 133 IKAVKGLGMETCGTFGMLEEGMAEDLKEAGLDYYNHNLDTDPDRYNDIIHTRQHEDRMDT 192

Query: 189 LENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENK 248
           L  VR +G+KVCCGGI+G+ E   +R  ++ +LANL   PES+PIN L+ + G+   + +
Sbjct: 193 LGKVRNAGLKVCCGGIVGMNETRAERAGLIASLANLDPQPESVPINQLVKVEGTPLADAE 252

Query: 249 KVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNP 308
            +D  E VR I+VARI MP+S +RL+AGR+ MS+ +QA+CF +GANSIF GD LLT  NP
Sbjct: 253 DLDWTEFVRTIAVARITMPQSYVRLSAGRSNMSEAMQAMCFMAGANSIFYGDKLLTTGNP 312

Query: 309 SYNKDTILFNRLGLIP 324
             + D IL  +L L P
Sbjct: 313 DEDGDRILMEKLNLYP 328


>gi|299755082|ref|XP_001828414.2| biotin synthase [Coprinopsis cinerea okayama7#130]
 gi|298411061|gb|EAU93406.2| biotin synthase [Coprinopsis cinerea okayama7#130]
          Length = 351

 Score =  298 bits (763), Expect = 7e-79,   Method: Composition-based stats.
 Identities = 143/312 (45%), Positives = 217/312 (69%), Gaps = 2/312 (0%)

Query: 14  KKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCN 73
                W  +E+  IY+ P  +L+F + ++HR++ +P+ IQL  L+NIKTGGC E+C YC+
Sbjct: 17  ATRHDWRREEIQTIYDSPLMELVFRAASIHRQHQDPSKIQLCTLMNIKTGGCTEDCSYCS 76

Query: 74  QSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREP--KERDLSIIVDMIKG 131
           QS    +  KAS+L++++ VL+ A+ AKENG+TR+CMGAAWR+   ++R    I+ M++ 
Sbjct: 77  QSSRYSTPTKASRLVDIEPVLEAARKAKENGSTRFCMGAAWRDLAGRKRGFERILQMVRE 136

Query: 132 VKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLEN 191
           V+ +G+E C TLGMLS EQA+ L +AGL  YNHN+DTS  FYP V TT ++++RL T+  
Sbjct: 137 VRGMGMEVCTTLGMLSPEQARQLKEAGLTAYNHNLDTSREFYPQVITTRSYDERLDTIAA 196

Query: 192 VRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVD 251
           VR++GI VC GGILGLGE   DR+ ++  ++N+   PES P+N L+PI G+  E+N++V 
Sbjct: 197 VREAGISVCSGGILGLGESDADRVGLIWEVSNMPEHPESFPVNALVPIEGTPLEKNERVP 256

Query: 252 PIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYN 311
               +R I+ ARI+MPK+ +RLAAGR  +S+  QA+CF +GAN++F G+ +LT     ++
Sbjct: 257 HHTLLRTIATARIVMPKTIIRLAAGRNTLSEAEQAMCFMAGANAVFTGEQMLTTPCSPWD 316

Query: 312 KDTILFNRLGLI 323
           +D  + +R GL 
Sbjct: 317 EDKAMMSRWGLE 328


>gi|197103557|ref|YP_002128934.1| biotin synthase BioB [Phenylobacterium zucineum HLK1]
 gi|254810769|sp|B4RBP5|BIOB_PHEZH RecName: Full=Biotin synthase
 gi|196476977|gb|ACG76505.1| biotin synthase BioB [Phenylobacterium zucineum HLK1]
          Length = 331

 Score =  298 bits (763), Expect = 7e-79,   Method: Composition-based stats.
 Identities = 169/319 (52%), Positives = 221/319 (69%)

Query: 10  ENPTKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENC 69
            +P +    WT +EV  ++ +PF +L+F +  VHR+ F+P  +QLS+LL++KTGGCPE+C
Sbjct: 13  VDPAQPRHDWTLEEVEALFELPFTELVFRAAEVHRRWFDPTELQLSQLLSVKTGGCPEDC 72

Query: 70  GYCNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMI 129
           GYC QS   K+ L ASKL+  + V+  A  AK  GA R+CMGAAWR+ K+RDL  +  MI
Sbjct: 73  GYCAQSQKFKTGLAASKLMEAETVIAAAAEAKAGGAQRFCMGAAWRDLKDRDLPKVAAMI 132

Query: 130 KGVKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTL 189
            GVK+LGLETC TLGML+ +QA+ L  AGLDYYNHN+DT   +Y  V TT T++DRL TL
Sbjct: 133 SGVKALGLETCATLGMLTADQAKALKAAGLDYYNHNLDTGPDYYDKVVTTRTYQDRLDTL 192

Query: 190 ENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKK 249
             VR +G+  CCGGI+G+GE   DR  +L  LA L   P+S+PIN L+PIPG+   ++K 
Sbjct: 193 AAVRDAGMATCCGGIVGMGETRRDRAGLLHQLATLPAHPDSLPINDLMPIPGTPLGDSKA 252

Query: 250 VDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPS 309
           VDP+E VR+I+VARI+ PKS +R+AAGR  M+ ELQALCF +GANSIFVG  LLT  NP 
Sbjct: 253 VDPLEFVRMIAVARIVCPKSMVRIAAGREHMTKELQALCFLAGANSIFVGARLLTTDNPE 312

Query: 310 YNKDTILFNRLGLIPDLSA 328
              D  L   L + P   A
Sbjct: 313 KTADEALLADLKMKPMAMA 331


>gi|254811611|sp|Q8D2A1|BIOB_WIGBR RecName: Full=Biotin synthase
          Length = 341

 Score =  298 bits (763), Expect = 8e-79,   Method: Composition-based stats.
 Identities = 168/307 (54%), Positives = 226/307 (73%)

Query: 19  WTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQSVHN 78
           W  K   +++  PF DL+F +  +HRKNF  N IQ+S LL+IKTG CPE+C YC+QS   
Sbjct: 7   WNLKNTKKLFYKPFFDLMFKAQKIHRKNFSSNKIQISTLLSIKTGLCPEDCKYCSQSSRY 66

Query: 79  KSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLGLE 138
           K+ L + KLI +++V+  AK AK++G TR+CMGAAW+ PK++D+ ++ +MIK VK LGLE
Sbjct: 67  KTGLVSEKLIKIEKVINAAKKAKKSGVTRFCMGAAWKNPKDKDIPLLEEMIKSVKKLGLE 126

Query: 139 TCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSGIK 198
           TCMTLGML+  QA  L  AGLDYYNHN+DTS+ FY  + TT  +EDR+ T++NVR +GIK
Sbjct: 127 TCMTLGMLNDYQANRLHNAGLDYYNHNLDTSKEFYKKIITTRKYEDRISTIQNVRNAGIK 186

Query: 199 VCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEHVRI 258
           VC GGILGLGE   DRI +L+ LANL  PPES+PIN+L+ I G+  E+NK VD  + +RI
Sbjct: 187 VCSGGILGLGESDKDRIKLLIQLANLPKPPESVPINMLVRIKGTPMEKNKDVDAFDFIRI 246

Query: 259 ISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTILFN 318
           I++ARI+MPKSR+RL+AGR  M+++ QALCF +G NSIF G  LLT  N S  +D +LF 
Sbjct: 247 IALARIMMPKSRIRLSAGRENMNEQTQALCFMAGVNSIFYGCKLLTTTNSSSKRDALLFK 306

Query: 319 RLGLIPD 325
           +L +  +
Sbjct: 307 KLNMKME 313


>gi|167648580|ref|YP_001686243.1| biotin synthase [Caulobacter sp. K31]
 gi|254810596|sp|B0T1Y4|BIOB_CAUSK RecName: Full=Biotin synthase
 gi|167351010|gb|ABZ73745.1| biotin synthase [Caulobacter sp. K31]
          Length = 340

 Score =  298 bits (763), Expect = 8e-79,   Method: Composition-based stats.
 Identities = 163/326 (50%), Positives = 228/326 (69%), Gaps = 4/326 (1%)

Query: 7   VPEENPTKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCP 66
           +  +   +    WT  +V  ++++PF +L+F + TVHR  F+P+ +QLS+LL++KTGGC 
Sbjct: 4   INAQLAHEPRHDWTLPQVEALFDLPFMELMFQAATVHRAWFDPSELQLSQLLSVKTGGCA 63

Query: 67  ENCGYCNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIV 126
           ENCGYC+QS H K+ LKA KL++ + V+ +A+ A++ GA R+CMGAAWRE K+RDL  + 
Sbjct: 64  ENCGYCSQSAHFKTGLKAEKLMDAEVVIAKAREARDGGAQRFCMGAAWRELKDRDLPKLA 123

Query: 127 DMIKGVKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRL 186
            MI GVK+LGLETC TLGML+ EQA+ L  AGLDYYNHN+DT   +Y  V +T T+++RL
Sbjct: 124 AMIGGVKALGLETCATLGMLTAEQAKQLKDAGLDYYNHNLDTGPEYYGDVVSTRTYQERL 183

Query: 187 QTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEE 246
            TL  VR +G+  CCGGI+G+GE   DR  +L  LA L + P+S+P+N L+P+ G+   +
Sbjct: 184 DTLAYVRDAGMSTCCGGIVGMGETRRDRASLLHQLATLPSHPDSLPVNALVPVAGTPLGD 243

Query: 247 ----NKKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTL 302
                 ++D +E VR ++VARI+ PKS +RL+AGR  MS ELQALCF +GANSIFVG  L
Sbjct: 244 KVKREGEIDGLEFVRTVAVARIVCPKSMVRLSAGRDDMSRELQALCFMAGANSIFVGGKL 303

Query: 303 LTAKNPSYNKDTILFNRLGLIPDLSA 328
           LT   P+ + D+ LF  L + P  SA
Sbjct: 304 LTTPLPNMDDDSKLFLDLNMRPMGSA 329


>gi|32491202|ref|NP_871456.1| hypothetical protein WGLp453 [Wigglesworthia glossinidia
           endosymbiont of Glossina brevipalpis]
 gi|25166409|dbj|BAC24599.1| bioB [Wigglesworthia glossinidia endosymbiont of Glossina
           brevipalpis]
          Length = 389

 Score =  298 bits (763), Expect = 8e-79,   Method: Composition-based stats.
 Identities = 168/307 (54%), Positives = 226/307 (73%)

Query: 19  WTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQSVHN 78
           W  K   +++  PF DL+F +  +HRKNF  N IQ+S LL+IKTG CPE+C YC+QS   
Sbjct: 55  WNLKNTKKLFYKPFFDLMFKAQKIHRKNFSSNKIQISTLLSIKTGLCPEDCKYCSQSSRY 114

Query: 79  KSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLGLE 138
           K+ L + KLI +++V+  AK AK++G TR+CMGAAW+ PK++D+ ++ +MIK VK LGLE
Sbjct: 115 KTGLVSEKLIKIEKVINAAKKAKKSGVTRFCMGAAWKNPKDKDIPLLEEMIKSVKKLGLE 174

Query: 139 TCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSGIK 198
           TCMTLGML+  QA  L  AGLDYYNHN+DTS+ FY  + TT  +EDR+ T++NVR +GIK
Sbjct: 175 TCMTLGMLNDYQANRLHNAGLDYYNHNLDTSKEFYKKIITTRKYEDRISTIQNVRNAGIK 234

Query: 199 VCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEHVRI 258
           VC GGILGLGE   DRI +L+ LANL  PPES+PIN+L+ I G+  E+NK VD  + +RI
Sbjct: 235 VCSGGILGLGESDKDRIKLLIQLANLPKPPESVPINMLVRIKGTPMEKNKDVDAFDFIRI 294

Query: 259 ISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTILFN 318
           I++ARI+MPKSR+RL+AGR  M+++ QALCF +G NSIF G  LLT  N S  +D +LF 
Sbjct: 295 IALARIMMPKSRIRLSAGRENMNEQTQALCFMAGVNSIFYGCKLLTTTNSSSKRDALLFK 354

Query: 319 RLGLIPD 325
           +L +  +
Sbjct: 355 KLNMKME 361


>gi|307292843|ref|ZP_07572689.1| biotin synthase [Sphingobium chlorophenolicum L-1]
 gi|306880909|gb|EFN12125.1| biotin synthase [Sphingobium chlorophenolicum L-1]
          Length = 335

 Score =  298 bits (763), Expect = 8e-79,   Method: Composition-based stats.
 Identities = 176/321 (54%), Positives = 235/321 (73%), Gaps = 7/321 (2%)

Query: 13  TKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYC 72
           T     WT  E+  ++++PFNDL+F + ++HR NF  N +QLS LL+IKTGGCPE+CGYC
Sbjct: 4   TTARTDWTRDEIAALFDLPFNDLMFEAQSIHRANFPRNEVQLSTLLSIKTGGCPEDCGYC 63

Query: 73  NQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGV 132
           +QS   +S LKA+KL++V  VL+ A  AK++G+ R+CMGAAWR PKERD+  +++M+KGV
Sbjct: 64  SQSTEAESGLKATKLMDVQAVLQAAAQAKDHGSGRFCMGAAWRNPKERDMPKLIEMVKGV 123

Query: 133 KSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENV 192
           + +G+ETCMTLGMLS  QA+ L+ AGLDYYNHNIDTS   Y +V TT TFEDR++TLENV
Sbjct: 124 RQMGMETCMTLGMLSAGQAKQLADAGLDYYNHNIDTSPENYANVITTRTFEDRIETLENV 183

Query: 193 RKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDP 252
           R +GI VCCGGI+G+GE   DRI  L  LA +   PES+PIN L+P+ G+   +  K  P
Sbjct: 184 RSAGINVCCGGIVGMGETRSDRIGFLHALATM-PHPESVPINALVPVAGTVLGDMLKDTP 242

Query: 253 I------EHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAK 306
           +      E VR ++VARI+MP+S +RL+AGR  MS+  QALCF +GANSIF GD LLTA 
Sbjct: 243 LAKIDEVEFVRTVAVARIVMPQSMVRLSAGRESMSEACQALCFMAGANSIFTGDKLLTAA 302

Query: 307 NPSYNKDTILFNRLGLIPDLS 327
           N   +KD+ L ++LGL P ++
Sbjct: 303 NAGDDKDSALLSKLGLTPMMA 323


>gi|225433839|ref|XP_002263125.1| PREDICTED: hypothetical protein [Vitis vinifera]
 gi|297743757|emb|CBI36640.3| unnamed protein product [Vitis vinifera]
          Length = 381

 Score =  298 bits (763), Expect = 8e-79,   Method: Composition-based stats.
 Identities = 152/312 (48%), Positives = 209/312 (66%), Gaps = 2/312 (0%)

Query: 15  KPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQ 74
               WT  E+  IY+ P  DLLF    VHR       +Q   LL++KTGGC E+C YC Q
Sbjct: 44  PRNDWTRPEIKSIYDSPLLDLLFHGAQVHRHAHNFREVQQCTLLSVKTGGCSEDCSYCPQ 103

Query: 75  SVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKER--DLSIIVDMIKGV 132
           S    + +KA +L+N D VL+ A+ AKE G+TR+CMGAAWR+   R  + + I++ +K +
Sbjct: 104 SSRYSTGVKAQRLMNKDAVLQAAQKAKEAGSTRFCMGAAWRDTVGRKTNFNQILEYVKEI 163

Query: 133 KSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENV 192
           + +G+E C TLGML  +QA  L KAGL  YNHN+DTS  +YP++  T ++++RL+TL+ V
Sbjct: 164 RDMGMEVCCTLGMLEKQQAIELKKAGLTAYNHNLDTSREYYPNIIRTRSYDERLETLQLV 223

Query: 193 RKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDP 252
           R++GI VC GGI+GLGE  +DR+ +L TLA L T PES+PIN L+ + G+  E+ K V+ 
Sbjct: 224 REAGINVCSGGIIGLGEAEEDRVGLLHTLATLPTHPESVPINALLAVKGTPLEDQKPVEI 283

Query: 253 IEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNK 312
            E VR+I+ ARI+MPK+ +RL+AGR   S   QALCF +GANSIF GD LLT  N  ++ 
Sbjct: 284 WEMVRMIATARIVMPKAMVRLSAGRVRFSVPEQALCFLAGANSIFTGDKLLTTPNNDFDA 343

Query: 313 DTILFNRLGLIP 324
           D  +F  LGLIP
Sbjct: 344 DQQMFKLLGLIP 355


>gi|126641556|ref|YP_001084540.1| biotin synthase [Acinetobacter baumannii ATCC 17978]
          Length = 309

 Score =  298 bits (762), Expect = 9e-79,   Method: Composition-based stats.
 Identities = 164/293 (55%), Positives = 220/293 (75%)

Query: 33  NDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQSVHNKSKLKASKLINVDQ 92
            DL+F +  VHR++F  N IQ+S LL+IKTG CPE+C YC+QS H  SKL+A K I V++
Sbjct: 1   MDLVFKAQQVHREHFTANTIQVSTLLSIKTGKCPEDCKYCSQSAHYDSKLEAEKRIAVEK 60

Query: 93  VLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLGLETCMTLGMLSFEQAQ 152
           V+ EAK AK++G++R+CMGAAWR P ERD+  +++M++ VK+LG+ETCMTLGML+  QA+
Sbjct: 61  VISEAKAAKDSGSSRFCMGAAWRNPHERDMPYVLEMVREVKALGMETCMTLGMLNQSQAE 120

Query: 153 ILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSGIKVCCGGILGLGEMID 212
            L  AGLDYYNHN+DTS  +Y H+ +T TF+DRL TL+ VR++G+KVC GGI+GLGE  +
Sbjct: 121 RLKDAGLDYYNHNLDTSREYYSHIISTRTFDDRLNTLDYVRQAGMKVCSGGIVGLGESRE 180

Query: 213 DRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEHVRIISVARILMPKSRLR 272
           DRI +L  LA L   PES+PIN+L+PI G+   + +K+D IE +R I+VARI+MP S +R
Sbjct: 181 DRIGLLHELATLPIHPESVPINMLVPIEGTPLADVEKLDVIEWIRTIAVARIIMPHSYIR 240

Query: 273 LAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTILFNRLGLIPD 325
           L+AGR  +SD  QAL F +GANS+F GD LLT  N    KD  LFN+LGL  +
Sbjct: 241 LSAGRESLSDSDQALAFMAGANSLFSGDKLLTTPNAGEGKDQALFNKLGLTAE 293


>gi|71906258|ref|YP_283845.1| biotin synthase [Dechloromonas aromatica RCB]
 gi|123774526|sp|Q47IF6|BIOB_DECAR RecName: Full=Biotin synthase
 gi|71845879|gb|AAZ45375.1| Biotin synthase [Dechloromonas aromatica RCB]
          Length = 327

 Score =  298 bits (762), Expect = 1e-78,   Method: Composition-based stats.
 Identities = 164/307 (53%), Positives = 223/307 (72%)

Query: 17  KVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQSV 76
           + WT +EV  +Y+MP  DL++ +  VHR+NF+PN IQ S LL++KTGGC E+C YC+QS 
Sbjct: 19  RRWTVEEVLGLYDMPLMDLIWRAQGVHRENFDPNAIQRSTLLSVKTGGCSEDCSYCSQSA 78

Query: 77  HNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLG 136
              +  +  +L+ +DQV+  AK AK+ GA+R+CMGAAW+ PK+ DL  ++DM++ VK+LG
Sbjct: 79  RYDTDTERERLMPLDQVVAAAKAAKDKGASRFCMGAAWKGPKDNDLDRVLDMVREVKALG 138

Query: 137 LETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSG 196
           ++TC+TLGML   QA+ L  AGLDYYNHN+DT + FY  V  +HT +DRL TL+ VR +G
Sbjct: 139 MQTCVTLGMLKDGQAEKLKDAGLDYYNHNLDTDKEFYGQVIKSHTHDDRLDTLDQVRDAG 198

Query: 197 IKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEHV 256
           I VC GGI+G+GE   +R  +++ LANL  PPES+PIN L+PIPG+   +N ++DP E V
Sbjct: 199 INVCSGGIIGMGESRKNRAALIVQLANLPKPPESVPINNLVPIPGTPLADNPRLDPFEFV 258

Query: 257 RIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTIL 316
           R I+ ARI MP S +RL+AGR  MSDELQA+CF +GANS+F GD LLT  NP   +D  L
Sbjct: 259 RTIAAARIAMPTSWVRLSAGRQEMSDELQAMCFLAGANSMFYGDFLLTTGNPDIERDDAL 318

Query: 317 FNRLGLI 323
           F RLG+ 
Sbjct: 319 FARLGVK 325


>gi|82702258|ref|YP_411824.1| biotin synthase [Nitrosospira multiformis ATCC 25196]
 gi|123754367|sp|Q2Y9Y9|BIOB_NITMU RecName: Full=Biotin synthase
 gi|82410323|gb|ABB74432.1| biotin synthase [Nitrosospira multiformis ATCC 25196]
          Length = 342

 Score =  298 bits (762), Expect = 1e-78,   Method: Composition-based stats.
 Identities = 157/307 (51%), Positives = 213/307 (69%)

Query: 17  KVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQSV 76
           + W  + V  + ++PF+DL+  +  VHR+  +PN +QLS L+++KTGGCPE+CGYC Q+ 
Sbjct: 34  RRWDVRRVEALLDLPFSDLIHRAQLVHRQYHDPNGVQLSTLISVKTGGCPEDCGYCPQAA 93

Query: 77  HNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLG 136
              + ++   ++ V+ V+  A  AK  GATR+CMGAAWR PKERD+  +V+M++ VK+LG
Sbjct: 94  RYHTNVENQDMLTVEDVIAAAAAAKAQGATRFCMGAAWRGPKERDMKSVVEMVRAVKALG 153

Query: 137 LETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSG 196
           LE C TLGML   QA+ L +AGLDYYNHN+DTS  FY  + TT  +EDRL TL+ VR +G
Sbjct: 154 LEACTTLGMLKPGQAEQLQEAGLDYYNHNLDTSPEFYGEIITTRDYEDRLDTLQKVRHAG 213

Query: 197 IKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEHV 256
           I VCCGGI+G+GE    R  ++  LANL   PES+PIN L+ + G+     + +DP+E V
Sbjct: 214 INVCCGGIVGMGESRRARAGLIAQLANLDPYPESVPINHLVQVEGTPLHGTEALDPLEFV 273

Query: 257 RIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTIL 316
           R I+ ARI MPK+ +RL+AGR  M D +QALCF +GANSIF GD LLT  NP   +D  L
Sbjct: 274 RTIAAARITMPKAMVRLSAGRREMPDAVQALCFLAGANSIFYGDKLLTTGNPEAERDKAL 333

Query: 317 FNRLGLI 323
           F+RLGL 
Sbjct: 334 FDRLGLH 340


>gi|119467532|ref|XP_001257572.1| biotin synthase, putative [Neosartorya fischeri NRRL 181]
 gi|119405724|gb|EAW15675.1| biotin synthase, putative [Neosartorya fischeri NRRL 181]
          Length = 396

 Score =  298 bits (762), Expect = 1e-78,   Method: Composition-based stats.
 Identities = 148/325 (45%), Positives = 214/325 (65%), Gaps = 2/325 (0%)

Query: 5   TVVPEENPTKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGG 64
            +      T     W+ +EV QIY  P + L + +  VHR+  +P  IQ+  L+NIKTGG
Sbjct: 38  ALQEATAATAPRTNWSREEVQQIYETPLSQLTYAAAAVHRRFHDPAAIQMCTLMNIKTGG 97

Query: 65  CPENCGYCNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKER--DL 122
           C E+C YC QS    + LKA+K+  VD+VLK A+ AK+NG+TR+CMGAAWR+ + R   L
Sbjct: 98  CSEDCSYCAQSSRYSTGLKATKMSPVDEVLKAARIAKDNGSTRFCMGAAWRDMRGRKTSL 157

Query: 123 SIIVDMIKGVKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTF 182
             + +M+ GV+++G+E C+TLGM+   QA+ L  AGL  YNHN+DTS  FYP + TT ++
Sbjct: 158 KNVKEMVSGVRAMGMEVCVTLGMIDENQAKELKDAGLTAYNHNLDTSREFYPSIITTRSY 217

Query: 183 EDRLQTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGS 242
           ++RLQTL +VR +GI VC GGILGLGE   DRI ++ T+ANL + PES P+N L+PI G+
Sbjct: 218 DERLQTLSHVRDAGINVCSGGILGLGEADSDRIGLIHTVANLPSHPESFPVNALVPIKGT 277

Query: 243 KFEENKKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTL 302
              + K +   + +R I+ ARI++P + +RLAAGR  +S+E Q  CF +GAN++F G+ +
Sbjct: 278 PLGDRKMIPFDKLLRTIATARIVLPATIVRLAAGRISLSEEQQVACFMAGANAVFTGEKM 337

Query: 303 LTAKNPSYNKDTILFNRLGLIPDLS 327
           LT     +++D  +F R G  P  S
Sbjct: 338 LTTDCNGWDEDREMFERWGFYPMRS 362


>gi|261493559|ref|ZP_05990079.1| biotin synthase [Mannheimia haemolytica serotype A2 str. BOVINE]
 gi|261495397|ref|ZP_05991845.1| biotin synthase [Mannheimia haemolytica serotype A2 str. OVINE]
 gi|261308902|gb|EEY10157.1| biotin synthase [Mannheimia haemolytica serotype A2 str. OVINE]
 gi|261310741|gb|EEY11924.1| biotin synthase [Mannheimia haemolytica serotype A2 str. BOVINE]
          Length = 333

 Score =  297 bits (761), Expect = 1e-78,   Method: Composition-based stats.
 Identities = 154/322 (47%), Positives = 216/322 (67%)

Query: 3   RSTVVPEENPTKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKT 62
           R     E  P    + W   +V +++++PF DL+F +  VHR+NF+ N IQLS LL+IKT
Sbjct: 7   RLKAKDELTPHPTAQYWRKCQVEELFDLPFMDLVFRAAQVHRENFDANAIQLSTLLSIKT 66

Query: 63  GGCPENCGYCNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDL 122
           GGCPE+C YC QS    + ++   +++V+ ++++AK AKE GA+R+CMGAAWR P+ +D+
Sbjct: 67  GGCPEDCEYCPQSARYDTGIEKQTMLDVETIVEKAKIAKERGASRFCMGAAWRGPRPKDI 126

Query: 123 SIIVDMIKGVKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTF 182
            ++ ++I  VKSLGLETC T GML    A+ L +AGLDYYNHN+DT    Y  +  T   
Sbjct: 127 KVVSEIINAVKSLGLETCGTFGMLEEGMAEELKQAGLDYYNHNLDTDPERYNKIIHTRNH 186

Query: 183 EDRLQTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGS 242
           EDR+ TL  VR +G+KVCCGGI+G+ E   +R  ++ +LANL   PES+PIN LI + G+
Sbjct: 187 EDRMDTLGKVRNAGLKVCCGGIVGMNETRPERAGLIASLANLDPQPESVPINQLIKVEGT 246

Query: 243 KFEENKKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTL 302
                + +D  E VR I+VARI MP+S +RL+AGR  M + +QALCF +GANSIF GD L
Sbjct: 247 PLTNAEDLDWTEFVRTIAVARITMPQSFVRLSAGRTTMPEAMQALCFMAGANSIFYGDKL 306

Query: 303 LTAKNPSYNKDTILFNRLGLIP 324
           LT +NP  + D  L ++L L P
Sbjct: 307 LTTENPEEDHDRQLMDKLDLYP 328


>gi|73667271|ref|YP_303287.1| biotin synthase [Ehrlichia canis str. Jake]
 gi|123732194|sp|Q3YRG6|BIOB_EHRCJ RecName: Full=Biotin synthase
 gi|72394412|gb|AAZ68689.1| Biotin synthase [Ehrlichia canis str. Jake]
          Length = 324

 Score =  297 bits (761), Expect = 1e-78,   Method: Composition-based stats.
 Identities = 167/309 (54%), Positives = 224/309 (72%)

Query: 13  TKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYC 72
           T     W   E+ ++++  FNDL+  SH +HR+ F  N +Q+S LLNIKTGGCPENC YC
Sbjct: 5   TPTRNDWQLDEILELFHTAFNDLILQSHLLHRQFFSNNEVQISSLLNIKTGGCPENCKYC 64

Query: 73  NQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGV 132
           +QS H K+ LK   L++++ + K  + AK+NGA R+C  AAWR+ ++RDL  I D+I  +
Sbjct: 65  SQSAHYKTDLKKESLLDIESIKKAIQTAKKNGADRFCFAAAWRQVRDRDLEYICDIIDLI 124

Query: 133 KSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENV 192
           KS  LE+C +LGM++ EQA+ L  AGLD+YNHNIDTS  FYP+VTTT +++DRL +L N+
Sbjct: 125 KSENLESCASLGMVTLEQAKKLKNAGLDFYNHNIDTSRDFYPNVTTTRSYDDRLTSLNNI 184

Query: 193 RKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDP 252
            ++GI +C GGILGLGE ++DR  MLLTLANL   P S+PIN L+PI G+ FE N K+D 
Sbjct: 185 HEAGINICSGGILGLGESVEDRAKMLLTLANLKEHPLSVPINRLVPIKGTPFENNAKIDN 244

Query: 253 IEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNK 312
           I+ ++ I+VARILMPKS +RLAAGR  MS+E+QALC F+GANSIF G+ LLT  N   N 
Sbjct: 245 IDFIKTIAVARILMPKSYIRLAAGRMSMSEEMQALCLFAGANSIFYGEKLLTTPNADCND 304

Query: 313 DTILFNRLG 321
           D  L ++LG
Sbjct: 305 DRNLLSKLG 313


>gi|89901070|ref|YP_523541.1| biotin synthase [Rhodoferax ferrireducens T118]
 gi|123091268|sp|Q21W43|BIOB_RHOFD RecName: Full=Biotin synthase
 gi|89345807|gb|ABD70010.1| biotin synthase [Rhodoferax ferrireducens T118]
          Length = 349

 Score =  297 bits (760), Expect = 1e-78,   Method: Composition-based stats.
 Identities = 150/301 (49%), Positives = 209/301 (69%)

Query: 13  TKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYC 72
             +   W   +V  ++ +PFNDL+F +   HR +F    ++L+ LL+IKTGGC E+C YC
Sbjct: 23  LPESATWPLADVLALFELPFNDLMFQAQQTHRAHFPKGDVELATLLSIKTGGCEEDCSYC 82

Query: 73  NQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGV 132
            Q+    + ++A K++ ++QVL  A+ A+ +GATR+CMGAAWR PKERDL  +  M++GV
Sbjct: 83  PQAARYDTGVEAQKILELEQVLDAAREARASGATRFCMGAAWRSPKERDLEKVEAMVRGV 142

Query: 133 KSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENV 192
           K LGLETC TLGML   QA  L +AGLDYYNHN+D++  FY +V +T  ++DRL TL  V
Sbjct: 143 KQLGLETCATLGMLEEGQADRLKQAGLDYYNHNLDSAPEFYSNVISTREYQDRLDTLGRV 202

Query: 193 RKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDP 252
           R++G+K+CCGGI+G+GE    R  ++  LANL+  PES+P+N L+ + G+     + +DP
Sbjct: 203 RQAGLKICCGGIVGMGESRQQRAGLIAQLANLNPYPESVPVNHLVQVEGTPLYGIEPLDP 262

Query: 253 IEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNK 312
           IE VR I+VARI MPK+R+RL+AGR  M D +QA+CF +GANSIF GD LLT  NP    
Sbjct: 263 IEFVRTIAVARITMPKARVRLSAGRRQMGDAVQAMCFLAGANSIFYGDKLLTTGNPEAGD 322

Query: 313 D 313
           D
Sbjct: 323 D 323


>gi|198282576|ref|YP_002218897.1| biotin synthase [Acidithiobacillus ferrooxidans ATCC 53993]
 gi|218667747|ref|YP_002424766.1| biotin synthase [Acidithiobacillus ferrooxidans ATCC 23270]
 gi|254810535|sp|B7J403|BIOB_ACIF2 RecName: Full=Biotin synthase
 gi|254810536|sp|B5ELR8|BIOB_ACIF5 RecName: Full=Biotin synthase
 gi|198247097|gb|ACH82690.1| biotin synthase [Acidithiobacillus ferrooxidans ATCC 53993]
 gi|218519960|gb|ACK80546.1| biotin synthase [Acidithiobacillus ferrooxidans ATCC 23270]
          Length = 316

 Score =  297 bits (760), Expect = 1e-78,   Method: Composition-based stats.
 Identities = 172/304 (56%), Positives = 216/304 (71%)

Query: 20  TSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQSVHNK 79
           T   + +IY  PFNDL++ +  VHR +F+PN IQ S LL+IKTGGCPE+CGYC+QSVH++
Sbjct: 9   TLDAILEIYARPFNDLIYAAQQVHRLHFDPNAIQCSTLLSIKTGGCPEDCGYCSQSVHHQ 68

Query: 80  SKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLGLET 139
           + L+A  L++++QV   A+ AK NGA R CMGAAWR P +RD+  +  MI  VK  GLE+
Sbjct: 69  TALQAEPLMDLEQVRAAAREAKANGAQRLCMGAAWRSPHDRDIEKVAAMIGVVKEYGLES 128

Query: 140 CMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSGIKV 199
           C+TLGML   QA+ L  AGLDYYNHN+DTS  FY  V  T +++DRL TLE VR +GI++
Sbjct: 129 CVTLGMLKPGQAERLQHAGLDYYNHNLDTSPEFYGEVIHTRSYQDRLDTLEAVRDAGIRI 188

Query: 200 CCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEHVRII 259
           C GGILG+GE   DR  ML  LA L   PESIPIN L+PIPG+  E  + +D  E VR +
Sbjct: 189 CSGGILGMGESRRDRARMLQVLAQLPQAPESIPINALVPIPGTPLEAAEPIDGFEFVRTV 248

Query: 260 SVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTILFNR 319
           +V RIL PK+ +RL+AGR  MSDELQAL F +GANSIF+GD LLT  N S   D  LFNR
Sbjct: 249 AVTRILFPKAYVRLSAGREAMSDELQALAFLAGANSIFLGDRLLTTGNASTGHDQALFNR 308

Query: 320 LGLI 323
           LGL 
Sbjct: 309 LGLH 312


>gi|255946119|ref|XP_002563827.1| Pc20g13470 [Penicillium chrysogenum Wisconsin 54-1255]
 gi|211588562|emb|CAP86676.1| Pc20g13470 [Penicillium chrysogenum Wisconsin 54-1255]
          Length = 389

 Score =  297 bits (760), Expect = 2e-78,   Method: Composition-based stats.
 Identities = 148/325 (45%), Positives = 214/325 (65%), Gaps = 2/325 (0%)

Query: 5   TVVPEENPTKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGG 64
           T+      T     WT  EV QIY  P + L + +  VHR+  +P+ IQ+  L+NIKTGG
Sbjct: 34  TLTDATGATAPRTTWTRDEVKQIYETPLSQLTYAAAAVHRRFHDPSAIQMCTLMNIKTGG 93

Query: 65  CPENCGYCNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKER--DL 122
           C E+C YC QS  + + LKA+K+  VD+VL +A+NAK NG+TR+CMGAAWR+ + R   L
Sbjct: 94  CSEDCSYCAQSSKHNTGLKATKMSPVDEVLTKARNAKANGSTRFCMGAAWRDMRGRKTSL 153

Query: 123 SIIVDMIKGVKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTF 182
             +  MI G++ + +E C+TLGM+   QA+ L +AGL  YNHN+DTS  FYP + TT ++
Sbjct: 154 KNVKQMITGIREMNMEVCVTLGMIDEHQAKELKEAGLTAYNHNLDTSREFYPTIITTRSY 213

Query: 183 EDRLQTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGS 242
           ++RL+TL +VR +GI VC GGILGLGE   DRI +L T+++L   PES P+N L+PIPG+
Sbjct: 214 DERLKTLSHVRDAGINVCSGGILGLGESDADRIGLLHTVSSLPAHPESFPVNALVPIPGT 273

Query: 243 KFEENKKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTL 302
              + K +     +R ++ ARI+MP + +RLAAGR  +S+E Q  CF +GAN++F G+ +
Sbjct: 274 PLGDRKMIPFDRLLRTVATARIVMPSTIVRLAAGRIALSEEQQVACFQAGANAVFTGEKM 333

Query: 303 LTAKNPSYNKDTILFNRLGLIPDLS 327
           LT     +++D  +F+R G  P  S
Sbjct: 334 LTTDCNGWDEDRAMFDRWGYYPMKS 358


>gi|28392925|gb|AAO41898.1| putative biotin synthase (Bio B) [Arabidopsis thaliana]
          Length = 378

 Score =  297 bits (760), Expect = 2e-78,   Method: Composition-based stats.
 Identities = 152/312 (48%), Positives = 208/312 (66%), Gaps = 2/312 (0%)

Query: 15  KPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQ 74
               W+  E+  +Y+ P  DLLF    VHR       +Q   LL+IKTGGC E+C YC Q
Sbjct: 44  PRNDWSRDEIKSVYDSPLLDLLFHGAQVHRHVHNFREVQQCTLLSIKTGGCSEDCSYCPQ 103

Query: 75  SVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKER--DLSIIVDMIKGV 132
           S    + +KA +L++ D V+  AK AKE G+TR+CMGAAWR+   R  + S I++ IK +
Sbjct: 104 SSRYSTGVKAQRLMSKDAVIDAAKKAKEAGSTRFCMGAAWRDTIGRKTNFSQILEYIKEI 163

Query: 133 KSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENV 192
           + +G+E C TLGM+  +QA  L KAGL  YNHN+DTS  +YP+V TT +++DRL+TL +V
Sbjct: 164 RGMGMEVCCTLGMIEEQQALELKKAGLTAYNHNLDTSREYYPNVITTRSYDDRLETLSHV 223

Query: 193 RKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDP 252
           R +GI VC GGI+GLGE  +DRI +L TLA L + PES+PIN L+ + G+  E+ K V+ 
Sbjct: 224 RDAGINVCSGGIIGLGEAEEDRIGLLHTLATLPSHPESVPINALLAVKGTPLEDQKPVEI 283

Query: 253 IEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNK 312
            E +R+I  ARI+MPK+ +RL+AGR   S   QALCF +GANSIF G+ LLT  N  ++ 
Sbjct: 284 WEMIRMIGTARIVMPKAMVRLSAGRVRFSMSEQALCFLAGANSIFTGEKLLTTPNNDFDA 343

Query: 313 DTILFNRLGLIP 324
           D ++F  LGLIP
Sbjct: 344 DQLMFKTLGLIP 355


>gi|255577757|ref|XP_002529753.1| biotin synthase, putative [Ricinus communis]
 gi|223530751|gb|EEF32619.1| biotin synthase, putative [Ricinus communis]
          Length = 375

 Score =  297 bits (760), Expect = 2e-78,   Method: Composition-based stats.
 Identities = 154/320 (48%), Positives = 210/320 (65%), Gaps = 2/320 (0%)

Query: 7   VPEENPTKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCP 66
                       WT +E+  +Y+ P  DLLF    VHR       +Q   LL+IKTGGC 
Sbjct: 30  AERTIKEGPRNDWTRQEIKNVYDSPLLDLLFHGAQVHRHFQNFREVQQCTLLSIKTGGCS 89

Query: 67  ENCGYCNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKER--DLSI 124
           E+C YC QS    + LKA KL+  D VL+ AK AKE G+TR+CMGAAWR+   R  + + 
Sbjct: 90  EDCSYCPQSSRYNTGLKAQKLMTKDDVLQAAKRAKEAGSTRFCMGAAWRDTIGRKTNFNQ 149

Query: 125 IVDMIKGVKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFED 184
           I+D +K ++ +G+E C TLGML  +QA  L KAGL  YNHN+DTS  +YP++ +T ++++
Sbjct: 150 ILDYVKEIRDMGMEVCCTLGMLEKQQAAELKKAGLTAYNHNLDTSREYYPNIISTRSYDE 209

Query: 185 RLQTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKF 244
           RL+TLE+VR+ GI VC GGI+GLGE  +DR+ +L TL+ L   PES+PIN LI + G+  
Sbjct: 210 RLKTLEHVREVGINVCSGGIIGLGEAEEDRVGLLHTLSTLPMHPESVPINALIAVKGTPL 269

Query: 245 EENKKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLT 304
           E+ K V+  E +R+I+ ARI+MPK+ +RL+AGR   S   QALCF SGANSIF G+ LLT
Sbjct: 270 EDQKPVEIWEMIRMIATARIIMPKAMVRLSAGRVRFSIAEQALCFLSGANSIFTGEKLLT 329

Query: 305 AKNPSYNKDTILFNRLGLIP 324
             N  ++ D ++F  LGLIP
Sbjct: 330 TPNNDFDADQLMFKLLGLIP 349


>gi|254496433|ref|ZP_05109312.1| biotin synthase BioB [Legionella drancourtii LLAP12]
 gi|254354346|gb|EET13002.1| biotin synthase BioB [Legionella drancourtii LLAP12]
          Length = 315

 Score =  297 bits (760), Expect = 2e-78,   Method: Composition-based stats.
 Identities = 185/311 (59%), Positives = 239/311 (76%)

Query: 13  TKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYC 72
           T+  K WT  E+  +Y  PFNDLL  +HT HR+N + N +Q + LL+IKTG CPE+CGYC
Sbjct: 2   TQVKKQWTISEITALYEQPFNDLLNQAHTAHRENHDANSLQFATLLSIKTGACPEDCGYC 61

Query: 73  NQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGV 132
           +QS H+++ ++  KL++V +VLK A+ AK+ GA R+CMGAAWR P ++ +  + +M++GV
Sbjct: 62  SQSGHHQTHVEKEKLMSVAEVLKSAQEAKDGGAKRFCMGAAWRCPPDKVMPQLQEMVEGV 121

Query: 133 KSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENV 192
           K+LGLETCMTLGML+ EQA  L +AGLDYYNHNIDTS  +Y  V TT  F DRL+TLENV
Sbjct: 122 KALGLETCMTLGMLNKEQATCLKEAGLDYYNHNIDTSPSYYEKVVTTRKFSDRLETLENV 181

Query: 193 RKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDP 252
           R +GI VCCGGILGLGE  +DRI+ LLTLANL TPPES+PIN LIP+ G+   + ++V+ 
Sbjct: 182 RAAGINVCCGGILGLGETREDRIEFLLTLANLETPPESVPINRLIPVEGTPLAKARQVEG 241

Query: 253 IEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNK 312
           IE VR I+ ARILMP+S +RL AGR  MSDELQALC+F+GANS+F+GD LLT +NP   K
Sbjct: 242 IELVRTIATARILMPQSAIRLTAGRTEMSDELQALCYFAGANSVFIGDKLLTEENPQRAK 301

Query: 313 DTILFNRLGLI 323
           D +LFN+LGL 
Sbjct: 302 DKVLFNKLGLT 312


>gi|237751742|ref|ZP_04582222.1| biotin synthase [Helicobacter bilis ATCC 43879]
 gi|229373108|gb|EEO23499.1| biotin synthase [Helicobacter bilis ATCC 43879]
          Length = 314

 Score =  297 bits (759), Expect = 2e-78,   Method: Composition-based stats.
 Identities = 170/303 (56%), Positives = 230/303 (75%)

Query: 20  TSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQSVHNK 79
           T +E  +I+ +PF +LL+ +HT+HR+NF PN +Q S LL++KTG C ENC YC QS H  
Sbjct: 2   TYEEAHKIFELPFMELLYKAHTLHRENFNPNSLQTSTLLSVKTGACTENCSYCAQSAHYN 61

Query: 80  SKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLGLET 139
           +  K   +++ +Q+LK AK AKE G++R+CMGA+ R P ++DL ++ ++I  VK LG+ET
Sbjct: 62  TGTKKENMLDKEQILKYAKAAKEKGSSRFCMGASGRSPSDKDLEVLCEVIGEVKDLGMET 121

Query: 140 CMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSGIKV 199
           C+TLG+L+  QAQ L  +GLD+YNHNIDTS+ +Y +V TT TFEDRL T++NVR +G+K+
Sbjct: 122 CVTLGLLNENQAQKLKDSGLDFYNHNIDTSKEYYSNVITTRTFEDRLNTIKNVRDAGLKI 181

Query: 200 CCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEHVRII 259
           C GGILGLGE  +DRI+ML+ LANL TPPESIPIN L+ IPG+  E  + +D  + VRII
Sbjct: 182 CVGGILGLGESNEDRINMLVLLANLPTPPESIPINQLVRIPGTPLENGETLDCFDFVRII 241

Query: 260 SVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTILFNR 319
           ++ARILMPKS +RL+AGRA M D LQALCFF+GANS+F GD LLT +N +  +D +LF R
Sbjct: 242 ALARILMPKSYIRLSAGRAQMDDSLQALCFFAGANSVFYGDRLLTTENAAPTRDDMLFAR 301

Query: 320 LGL 322
           L L
Sbjct: 302 LNL 304


>gi|261400229|ref|ZP_05986354.1| biotin synthase [Neisseria lactamica ATCC 23970]
 gi|269210028|gb|EEZ76483.1| biotin synthase [Neisseria lactamica ATCC 23970]
 gi|309379963|emb|CBX21374.1| unnamed protein product [Neisseria lactamica Y92-1009]
          Length = 350

 Score =  297 bits (759), Expect = 2e-78,   Method: Composition-based stats.
 Identities = 151/316 (47%), Positives = 213/316 (67%)

Query: 9   EENPTKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPEN 68
           E  P    + W   +V  ++ +PF +L++ +  VHR+NF P  IQLS LL+IKTGGCPE+
Sbjct: 13  ERKPHPTARYWKKCDVEALFGLPFLELVYQAAEVHRQNFNPREIQLSTLLSIKTGGCPED 72

Query: 69  CGYCNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDM 128
           C YC QS H+ + L   ++++VD+++++AK A+  GA+R+CMGAAWR PK +D+  +  +
Sbjct: 73  CAYCPQSAHHNTNLGKEQMMDVDEIVEKAKIAQSRGASRFCMGAAWRGPKPKDVETVSAI 132

Query: 129 IKGVKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQT 188
           IK VK LG+ETC T GML    A+   +AGLDYYNHN+DT    Y  +  T   EDR+ T
Sbjct: 133 IKAVKGLGMETCGTFGMLEEGMAEDFKEAGLDYYNHNLDTDPDRYNDIIHTRQHEDRMDT 192

Query: 189 LENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENK 248
           L  VR +G+KVCCGGI+G+ E   +R  ++ +LANL   PES+PIN L+ + G+   + +
Sbjct: 193 LGKVRNAGLKVCCGGIVGMNETRAERAGLIASLANLDPQPESVPINQLVKVEGTPLADAE 252

Query: 249 KVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNP 308
            +D  E VR I+VARI MP+S +RL+AGR+ MS+ +QA+CF +GANSIF GD LLT  NP
Sbjct: 253 DLDWTEFVRTIAVARITMPQSYVRLSAGRSNMSEAMQAMCFMAGANSIFYGDKLLTTGNP 312

Query: 309 SYNKDTILFNRLGLIP 324
             + D IL  +L L P
Sbjct: 313 DEDGDRILMEKLNLYP 328


>gi|114332103|ref|YP_748325.1| biotin synthase [Nitrosomonas eutropha C91]
 gi|122313215|sp|Q0AE72|BIOB_NITEC RecName: Full=Biotin synthase
 gi|114309117|gb|ABI60360.1| biotin synthase [Nitrosomonas eutropha C91]
          Length = 338

 Score =  297 bits (759), Expect = 2e-78,   Method: Composition-based stats.
 Identities = 150/306 (49%), Positives = 208/306 (67%)

Query: 18  VWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQSVH 77
            W   +V  +  +PFNDL+F + TVHR+  + N +QLS LL++KTGGC E+C YC Q+  
Sbjct: 31  RWLVADVESLLGLPFNDLIFQAQTVHRQYHDANGVQLSTLLSVKTGGCSEDCAYCPQAAR 90

Query: 78  NKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLGL 137
             + ++   +++ ++V+  A  AKE+GATR+CMGAAWR PK+RD+  + ++I  VK LGL
Sbjct: 91  YHTGVENQAILSREEVVMAATKAKESGATRFCMGAAWRGPKQRDIEHMTELISAVKDLGL 150

Query: 138 ETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSGI 197
           ETC TLG+L   QA  L +AGLDYYNHN+DTS  FY  V TT  +++RL TL+ VR + I
Sbjct: 151 ETCATLGILKPGQAVQLKQAGLDYYNHNLDTSPEFYGEVITTREYQNRLDTLDEVRGANI 210

Query: 198 KVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEHVR 257
            VCCGGI+G+GE    R  ++  LA+L   PES+PIN L+ + G+      ++DP E VR
Sbjct: 211 NVCCGGIVGMGESRTARAGLIAQLASLDPYPESVPINYLVQVEGTPLYGIPELDPFEFVR 270

Query: 258 IISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTILF 317
            I+ ARI MP++++RL+AGR  MS+ +QALCF +GANSIF GD LLT  NP   +D  L 
Sbjct: 271 SIAAARITMPRAKVRLSAGRRQMSEAIQALCFLAGANSIFYGDKLLTTGNPDTEQDAALL 330

Query: 318 NRLGLI 323
            +LGL 
Sbjct: 331 EKLGLH 336


>gi|322700381|gb|EFY92136.1| biotin synthase, putative [Metarhizium acridum CQMa 102]
          Length = 419

 Score =  297 bits (759), Expect = 2e-78,   Method: Composition-based stats.
 Identities = 150/330 (45%), Positives = 218/330 (66%), Gaps = 4/330 (1%)

Query: 2   SRSTVVPEENPTKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIK 61
           ++  +      T   + WT +E+  IY  P  +L   +  VHR+   P  +QL  L+NIK
Sbjct: 73  AKKILQDAVAATGPRQNWTRQEISAIYYQPLLELAHQASLVHRRFHSPGEVQLCTLMNIK 132

Query: 62  TGGCPENCGYCNQSVHNK--SKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKE 119
           TGGC E+C YC Q+   +  + L+A ++ +V+ VL  A+ AKENG+TR+CMGAAWR+ + 
Sbjct: 133 TGGCTEDCSYCAQATRYQKGTGLEAKRVESVESVLAAARTAKENGSTRFCMGAAWRDMRG 192

Query: 120 R--DLSIIVDMIKGVKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVT 177
           R  +L  I +M+KGVK++G+E C+TLGM+  EQA+ L +AGL  YNHN+DTS  FYP + 
Sbjct: 193 RKNNLKNITEMVKGVKAMGMEVCVTLGMIDAEQAKQLKEAGLTAYNHNVDTSREFYPSII 252

Query: 178 TTHTFEDRLQTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLI 237
           TT ++++RL+TL NVR +GI VC GGILGLGE  +DR+ +L T++ L   PES P+N L+
Sbjct: 253 TTRSYDERLKTLSNVRDAGINVCSGGILGLGESSEDRVGLLHTVSTLPCHPESFPVNALV 312

Query: 238 PIPGSKFEENKKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIF 297
           PI G+   +   +     +R I+ ARILMP + +R+AAGR  MS+E QALCF +GAN+IF
Sbjct: 313 PIKGTPLGDTTPIAFTSMLRTIATARILMPATIIRIAAGRKTMSEEKQALCFMAGANAIF 372

Query: 298 VGDTLLTAKNPSYNKDTILFNRLGLIPDLS 327
            G+ +LT     +++D+ +F R GL P  S
Sbjct: 373 TGEKMLTTDCNGWDEDSAMFGRWGLEPMKS 402


>gi|15224273|ref|NP_181864.1| BIO2 (BIOTIN AUXOTROPH 2); biotin synthase [Arabidopsis thaliana]
 gi|1705463|sp|P54967|BIOB_ARATH RecName: Full=Biotin synthase
 gi|1045316|gb|AAA80226.1| biotin sythase [Arabidopsis thaliana]
 gi|1403662|gb|AAC49445.1| BIO2 protein [Arabidopsis thaliana]
 gi|1769457|gb|AAB39953.1| biotin synthase [Arabidopsis thaliana]
 gi|2288983|gb|AAB64312.1| biotin synthase (Bio B) [Arabidopsis thaliana]
 gi|90093314|gb|ABD85170.1| At2g43360 [Arabidopsis thaliana]
 gi|330255162|gb|AEC10256.1| biotin synthase [Arabidopsis thaliana]
 gi|1589016|prf||2209438A biotin synthase
          Length = 378

 Score =  297 bits (759), Expect = 2e-78,   Method: Composition-based stats.
 Identities = 152/312 (48%), Positives = 208/312 (66%), Gaps = 2/312 (0%)

Query: 15  KPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQ 74
               W+  E+  +Y+ P  DLLF    VHR       +Q   LL+IKTGGC E+C YC Q
Sbjct: 44  PRNDWSRDEIKSVYDSPLLDLLFHGAQVHRHVHNFREVQQCTLLSIKTGGCSEDCSYCPQ 103

Query: 75  SVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKER--DLSIIVDMIKGV 132
           S    + +KA +L++ D V+  AK AKE G+TR+CMGAAWR+   R  + S I++ IK +
Sbjct: 104 SSRYSTGVKAQRLMSKDAVIDAAKKAKEAGSTRFCMGAAWRDTIGRKTNFSQILEYIKEI 163

Query: 133 KSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENV 192
           + +G+E C TLGM+  +QA  L KAGL  YNHN+DTS  +YP+V TT +++DRL+TL +V
Sbjct: 164 RGMGMEVCCTLGMIEKQQALELKKAGLTAYNHNLDTSREYYPNVITTRSYDDRLETLSHV 223

Query: 193 RKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDP 252
           R +GI VC GGI+GLGE  +DRI +L TLA L + PES+PIN L+ + G+  E+ K V+ 
Sbjct: 224 RDAGINVCSGGIIGLGEAEEDRIGLLHTLATLPSHPESVPINALLAVKGTPLEDQKPVEI 283

Query: 253 IEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNK 312
            E +R+I  ARI+MPK+ +RL+AGR   S   QALCF +GANSIF G+ LLT  N  ++ 
Sbjct: 284 WEMIRMIGTARIVMPKAMVRLSAGRVRFSMSEQALCFLAGANSIFTGEKLLTTPNNDFDA 343

Query: 313 DTILFNRLGLIP 324
           D ++F  LGLIP
Sbjct: 344 DQLMFKTLGLIP 355


>gi|309973490|gb|ADO96691.1| Biotin synthetase [Haemophilus influenzae R2846]
          Length = 333

 Score =  297 bits (759), Expect = 2e-78,   Method: Composition-based stats.
 Identities = 152/327 (46%), Positives = 222/327 (67%)

Query: 1   MSRSTVVPEENPTKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNI 60
           ++    +    P    + W+  +V  ++  PF +L++ +  +HRK+F P  IQLS L++I
Sbjct: 2   LAEKLQINSITPHPSVEYWSVCKVEALFETPFLELVYRAAQIHRKHFNPRTIQLSTLMSI 61

Query: 61  KTGGCPENCGYCNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKER 120
           KTGGCPE+CGYC QS    + ++  +L++V++++ +AK AK  GA R+CMGAAWR PK +
Sbjct: 62  KTGGCPEDCGYCPQSARYHTGVQNQQLLDVNEIIAKAKIAKARGAGRFCMGAAWRGPKPK 121

Query: 121 DLSIIVDMIKGVKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTH 180
           D+  + ++IK VKSLGLETC T G+L    A+ L +AGLDYYNHN+DT+   Y  V  T 
Sbjct: 122 DIEKVTEIIKAVKSLGLETCGTFGLLQDGMAEDLKEAGLDYYNHNLDTAPEHYAEVIGTR 181

Query: 181 TFEDRLQTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIP 240
            F+DRL TL  VRK+G+KVCCGGI+G+ E   +R  ++ +LANL   PES+PIN L+ + 
Sbjct: 182 RFDDRLSTLGKVRKAGLKVCCGGIVGMNETRKERAGLIASLANLDPQPESVPINQLVKVE 241

Query: 241 GSKFEENKKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGD 300
           G+   + +++D  E VR I+VARI MPKS +RL+AGR+ M++E+QA+CF +GANSIF GD
Sbjct: 242 GTPLADAEELDWTEFVRTIAVARITMPKSYVRLSAGRSGMTEEMQAMCFMAGANSIFYGD 301

Query: 301 TLLTAKNPSYNKDTILFNRLGLIPDLS 327
            LL   NP  + D +L  +L L P+ +
Sbjct: 302 KLLVTDNPEEDGDQLLMAKLDLEPETA 328


>gi|125562375|gb|EAZ07823.1| hypothetical protein OsI_30080 [Oryza sativa Indica Group]
          Length = 377

 Score =  297 bits (759), Expect = 2e-78,   Method: Composition-based stats.
 Identities = 153/312 (49%), Positives = 212/312 (67%), Gaps = 2/312 (0%)

Query: 15  KPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQ 74
               W+  E+  +Y+ P  DLLF    VHR   +   +Q   LL+IKTGGC E+C YC Q
Sbjct: 43  PRNDWSRPEIQAVYDSPLLDLLFHGAQVHRSVHKFREVQQCTLLSIKTGGCSEDCSYCPQ 102

Query: 75  SVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKER--DLSIIVDMIKGV 132
           S    + LKA KL+N D VL+ AK AKE G+TR+CMGAAWRE   R  + + I++ +K +
Sbjct: 103 SSRYSTGLKAQKLMNKDAVLEAAKKAKEAGSTRFCMGAAWRETIGRKTNFNQILEYVKDI 162

Query: 133 KSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENV 192
           + +G+E C TLGML  +QA+ L KAGL  YNHN+DTS  +YP++ +T +++DRLQTLE+V
Sbjct: 163 RGMGMEVCCTLGMLEKQQAEELKKAGLTAYNHNLDTSREYYPNIISTRSYDDRLQTLEHV 222

Query: 193 RKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDP 252
           R++GI +C GGI+GLGE  +DR+ +L TLA L   PES+PIN L+ + G+  ++ K V+ 
Sbjct: 223 REAGISICSGGIIGLGEAEEDRVGLLHTLATLPAHPESVPINALVAVKGTPLQDQKPVEI 282

Query: 253 IEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNK 312
            E +R+I+ ARI+MPK+ +RL+AGR   S   QALCF +GANSIF G+ LLT  N  ++ 
Sbjct: 283 WEMIRMIATARIVMPKAMVRLSAGRVRFSMPEQALCFLAGANSIFAGEKLLTTANNDFDA 342

Query: 313 DTILFNRLGLIP 324
           D  +F  LGLIP
Sbjct: 343 DQAMFKILGLIP 354


>gi|317404678|gb|EFV85071.1| biotin synthase [Achromobacter xylosoxidans C54]
          Length = 341

 Score =  297 bits (759), Expect = 2e-78,   Method: Composition-based stats.
 Identities = 164/319 (51%), Positives = 221/319 (69%)

Query: 7   VPEENPTKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCP 66
           VP+ +  +    W+S  V ++Y++PF DL++ +   HR +F+PN IQLS LL+IKTGGCP
Sbjct: 8   VPKPSRPQPASAWSSAAVMELYDLPFMDLVYRAQQTHRAHFDPNGIQLSSLLSIKTGGCP 67

Query: 67  ENCGYCNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIV 126
           E+CGYC+QS    + L+A KL+ +D+VL  A+ A+  GA R+CMGAAWR PK   L  + 
Sbjct: 68  EDCGYCSQSSRYDTGLEAEKLMPLDEVLAAARAAQAGGAQRFCMGAAWRSPKPHHLEAVA 127

Query: 127 DMIKGVKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRL 186
           +M+  VK+LGLETC+TLGML   QA+ L  AGLDYYNHN+DT+  FY  V TT T++DRL
Sbjct: 128 EMVSAVKALGLETCVTLGMLREGQAEQLKDAGLDYYNHNLDTAPEFYGKVVTTRTYQDRL 187

Query: 187 QTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEE 246
            TLE VR +GI VCCGGI+G+GE   +R  ++  LAN+   PES+PIN L+ + G+   +
Sbjct: 188 DTLERVRGAGINVCCGGIVGMGESRQERAGLIAQLANMEPYPESVPINNLMRVEGTPLAD 247

Query: 247 NKKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAK 306
            + +DP E VR I+VARI MP++ +RL+AGR  M D +QALCF +GANS+F GD LLT  
Sbjct: 248 AEPLDPFEFVRTIAVARITMPRAMVRLSAGREAMDDAMQALCFMAGANSMFYGDVLLTTG 307

Query: 307 NPSYNKDTILFNRLGLIPD 325
           NP    D  L  RLG+  D
Sbjct: 308 NPRMEADQRLLQRLGMRID 326


>gi|224095708|ref|XP_002310445.1| predicted protein [Populus trichocarpa]
 gi|222853348|gb|EEE90895.1| predicted protein [Populus trichocarpa]
          Length = 382

 Score =  296 bits (758), Expect = 2e-78,   Method: Composition-based stats.
 Identities = 152/312 (48%), Positives = 211/312 (67%), Gaps = 2/312 (0%)

Query: 15  KPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQ 74
               WT +E+ ++Y+ P  DLLF    VHR       +Q   LL+IKTGGC E+C YC Q
Sbjct: 42  PRNDWTRQEIKEVYDSPLLDLLFHGAQVHRYAHNFREVQQCTLLSIKTGGCSEDCSYCPQ 101

Query: 75  SVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKER--DLSIIVDMIKGV 132
           S    + LK  +L+  + V++ AK AKE G+TR+CMGAAWR+   R  + + I+D +K +
Sbjct: 102 SSRYNTGLKPQRLMTKETVIEAAKRAKEAGSTRFCMGAAWRDTIGRKTNFNQILDYVKEI 161

Query: 133 KSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENV 192
           + +G+E C TLGML  +QA  L KAGL  YNHN+DTS  +YP++ TT ++++RL+TLE+V
Sbjct: 162 RGMGMEVCCTLGMLEKQQAAELKKAGLTAYNHNLDTSREYYPNIITTRSYDERLETLEHV 221

Query: 193 RKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDP 252
           R++GI VC GGI+GLGE  +DR+ +L TLA L T PES+PIN L+ + G+  +E K V+ 
Sbjct: 222 REAGISVCSGGIIGLGEAEEDRVGLLHTLATLPTHPESVPINALVAVKGTPLQEQKPVEI 281

Query: 253 IEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNK 312
            E +R+I  ARI+MPK+ +RL+AGR   S   QALCF +GANSIF G+ LLT  N  Y+ 
Sbjct: 282 WEMIRMIGSARIVMPKAMVRLSAGRVSFSMAEQALCFLAGANSIFTGEKLLTTPNNDYDA 341

Query: 313 DTILFNRLGLIP 324
           D ++F  LGLIP
Sbjct: 342 DQLMFKVLGLIP 353


>gi|222111048|ref|YP_002553312.1| biotin synthase [Acidovorax ebreus TPSY]
 gi|254810695|sp|B9MJH4|BIOB_DIAST RecName: Full=Biotin synthase
 gi|221730492|gb|ACM33312.1| biotin synthase [Acidovorax ebreus TPSY]
          Length = 350

 Score =  296 bits (758), Expect = 3e-78,   Method: Composition-based stats.
 Identities = 157/317 (49%), Positives = 220/317 (69%)

Query: 7   VPEENPTKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCP 66
           V E   T++ + W+ + V ++ ++PF +LL+ +   HR ++    I+L+ LL++KTGGCP
Sbjct: 20  VAESVATQRGEGWSIQAVQELLDLPFMELLWRAQATHRAHWPQGDIELATLLSVKTGGCP 79

Query: 67  ENCGYCNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIV 126
           ENCGYC QS    + +KA KL++V +V + A+ AK+ GATR+CMGAAWR PK+RD+  + 
Sbjct: 80  ENCGYCPQSAEFDTGVKAEKLMSVQEVTQAAQAAKDAGATRFCMGAAWRAPKDRDIEKMS 139

Query: 127 DMIKGVKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRL 186
           ++I  VK LGL+TC TLGML   QA  L  AGLDYYNHN+DT+  +Y  V +T  ++DRL
Sbjct: 140 ELITAVKDLGLQTCATLGMLQSHQALALKDAGLDYYNHNLDTAPEYYSDVVSTRQYQDRL 199

Query: 187 QTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEE 246
            TL +VR +GI VCCGGI+G+GE    R  ++  LANL+  PES+PIN L+ + G+    
Sbjct: 200 DTLRHVRDAGINVCCGGIVGMGEAPVHRAGLIAQLANLNPYPESVPINSLVRVAGTPLAN 259

Query: 247 NKKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAK 306
           ++ VDP++ VR+I+VARI MPK+R+RL+AGR  + D +QALCF +GANSIF GD LL   
Sbjct: 260 SEPVDPLDFVRVIAVARITMPKARVRLSAGRQQLGDAVQALCFLAGANSIFYGDKLLVTS 319

Query: 307 NPSYNKDTILFNRLGLI 323
           NP    DT L  +LGL 
Sbjct: 320 NPDVEADTQLLAKLGLK 336


>gi|326483795|gb|EGE07805.1| biotin synthase [Trichophyton equinum CBS 127.97]
          Length = 405

 Score =  296 bits (758), Expect = 3e-78,   Method: Composition-based stats.
 Identities = 148/326 (45%), Positives = 215/326 (65%), Gaps = 2/326 (0%)

Query: 4   STVVPEENPTKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTG 63
           + +      +     WT +E+ QIY  P N L F +  VHR   +P  IQ+  L+NIKTG
Sbjct: 47  AALQDAIAASAPRTSWTREEITQIYQTPLNQLTFAAAAVHRNFHDPAAIQMCTLMNIKTG 106

Query: 64  GCPENCGYCNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKER--D 121
           GC E+C YC+QS    + LKA+KL +VD VL+ A+ AKENG+TR+CMGAAWR+ + R  +
Sbjct: 107 GCSEDCSYCSQSSRYDTGLKATKLSSVDSVLEAARIAKENGSTRFCMGAAWRDMRGRKSN 166

Query: 122 LSIIVDMIKGVKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHT 181
           L  I  M+ GV+ +G+E C+TLGM+  EQA+ L +AGL  YNHN+DTS  FYP + TT +
Sbjct: 167 LKNIKAMVSGVREMGMEVCVTLGMIDGEQAKELKEAGLTAYNHNVDTSREFYPSIITTRS 226

Query: 182 FEDRLQTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPG 241
           +++R+QTL +VR +GI VC GGILGLGE   DR+ ++ T+A L   PES P+N L+PI G
Sbjct: 227 YDERIQTLGHVRDAGINVCSGGILGLGEEDSDRVGLIHTVATLPAHPESFPVNALVPIKG 286

Query: 242 SKFEENKKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDT 301
           +     K ++  + +R ++ ARI++P + +RLAAGR  +++E Q  CF SGAN+IF G+ 
Sbjct: 287 TPLGNRKMIEFDKLLRTVATARIVLPATIVRLAAGRISLTEEQQVTCFMSGANAIFTGER 346

Query: 302 LLTAKNPSYNKDTILFNRLGLIPDLS 327
           +LT     +++D  +F++ G  P  S
Sbjct: 347 MLTTDCTGWDEDKKMFDKWGYYPMKS 372


>gi|326474932|gb|EGD98941.1| biotin synthase [Trichophyton tonsurans CBS 112818]
          Length = 405

 Score =  296 bits (758), Expect = 3e-78,   Method: Composition-based stats.
 Identities = 148/326 (45%), Positives = 215/326 (65%), Gaps = 2/326 (0%)

Query: 4   STVVPEENPTKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTG 63
           + +      +     WT +E+ QIY  P N L F +  VHR   +P  IQ+  L+NIKTG
Sbjct: 47  AALQDAIAASAPRTSWTREEITQIYQTPLNQLTFAAAAVHRNFHDPAAIQMCTLMNIKTG 106

Query: 64  GCPENCGYCNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKER--D 121
           GC E+C YC+QS    + LKA+KL +VD VL+ A+ AKENG+TR+CMGAAWR+ + R  +
Sbjct: 107 GCSEDCSYCSQSSRYDTGLKATKLSSVDSVLEAARIAKENGSTRFCMGAAWRDMRGRKSN 166

Query: 122 LSIIVDMIKGVKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHT 181
           L  I  M+ GV+ +G+E C+TLGM+  EQA+ L +AGL  YNHN+DTS  FYP + TT +
Sbjct: 167 LKNIKAMVSGVREMGMEVCVTLGMIDGEQAKELKEAGLTAYNHNVDTSREFYPSIITTRS 226

Query: 182 FEDRLQTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPG 241
           +++R+QTL +VR +GI VC GGILGLGE   DR+ ++ T+A L   PES P+N L+PI G
Sbjct: 227 YDERIQTLGHVRDAGINVCSGGILGLGEEDSDRVGLIHTVATLPAHPESFPVNALVPIKG 286

Query: 242 SKFEENKKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDT 301
           +     K ++  + +R ++ ARI++P + +RLAAGR  +++E Q  CF SGAN+IF G+ 
Sbjct: 287 TPLGNRKMIEFDKLLRTVATARIVLPATIVRLAAGRISLTEEQQVTCFMSGANAIFTGER 346

Query: 302 LLTAKNPSYNKDTILFNRLGLIPDLS 327
           +LT     +++D  +F++ G  P  S
Sbjct: 347 MLTTDCTGWDEDKKMFDKWGYYPMKS 372


>gi|259416237|ref|ZP_05740157.1| biotin synthase [Silicibacter sp. TrichCH4B]
 gi|259347676|gb|EEW59453.1| biotin synthase [Silicibacter sp. TrichCH4B]
          Length = 325

 Score =  296 bits (758), Expect = 3e-78,   Method: Composition-based stats.
 Identities = 185/307 (60%), Positives = 234/307 (76%)

Query: 16  PKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQS 75
              WT +E  +IY  PF DLLF + ++HR+ F+PN +Q S+LL+IKTGGC E+C YC+QS
Sbjct: 8   RTDWTRQEAEEIYAQPFMDLLFQAQSLHRQMFDPNAVQKSRLLSIKTGGCAEDCAYCSQS 67

Query: 76  VHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSL 135
             N ++L ASKLI V +V+ EAK  ++ GATRYCMGAAWR PK RD++ +  MI+GVK+L
Sbjct: 68  ARNGAQLPASKLIEVQRVIAEAKKVRDAGATRYCMGAAWRSPKARDMAQLEAMIEGVKAL 127

Query: 136 GLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKS 195
           G+ETCMTLGML  +Q   L  AGLDYYNHNIDTSER+YP VTTT +F DRL+TL  VR++
Sbjct: 128 GMETCMTLGMLEQDQVLRLRDAGLDYYNHNIDTSERYYPEVTTTRSFADRLETLARVREA 187

Query: 196 GIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEH 255
           GI VC GGILG+GE   DRIDMLL+LA L   P+S+PIN+LIP+  +   +   +DPIE 
Sbjct: 188 GINVCSGGILGMGEERGDRIDMLLSLATLPEHPQSVPINMLIPMADTPLADTPPLDPIEF 247

Query: 256 VRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTI 315
           VR I++ARILMP++ +RL+AGR  MSDELQA+C F+GANSIF+GDTLLTA NP  + D  
Sbjct: 248 VRTIALARILMPRAHVRLSAGRTEMSDELQAMCIFAGANSIFMGDTLLTADNPEEDADEA 307

Query: 316 LFNRLGL 322
           LF RLGL
Sbjct: 308 LFKRLGL 314


>gi|119385641|ref|YP_916696.1| biotin synthase [Paracoccus denitrificans PD1222]
 gi|254810527|sp|A1B656|BIOB2_PARDP RecName: Full=Biotin synthase 2
 gi|119376236|gb|ABL71000.1| biotin synthase [Paracoccus denitrificans PD1222]
          Length = 320

 Score =  296 bits (758), Expect = 3e-78,   Method: Composition-based stats.
 Identities = 186/302 (61%), Positives = 237/302 (78%)

Query: 24  VFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQSVHNKSKLK 83
             +IY+ P  DLLF + TVHR +F+PN +Q SKLL+IKTGGCPE+C YC+QS  N S+L 
Sbjct: 8   AAEIYHQPLMDLLFQAQTVHRAHFDPNVVQCSKLLSIKTGGCPEDCAYCSQSARNGSELS 67

Query: 84  ASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLGLETCMTL 143
           ASKL+ V +VL EA+ AKE GATRYCMGAAWR PKERD+  ++ MI+GVK++G+ETCMTL
Sbjct: 68  ASKLMEVQRVLAEARRAKEAGATRYCMGAAWRSPKERDMPAVLAMIRGVKAMGMETCMTL 127

Query: 144 GMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSGIKVCCGG 203
           GML  +QA  L  AGLDYYNHNIDTSER+Y  + TT TF+DR++TLE V+ +GI VC GG
Sbjct: 128 GMLDADQALRLKDAGLDYYNHNIDTSERYYSEIITTRTFQDRIETLERVQAAGINVCAGG 187

Query: 204 ILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEHVRIISVAR 263
           I+G+GE  +DRI ML TLA L  PP+S+PIN+L+P+ G+   +  ++D IE VR I+ AR
Sbjct: 188 IVGMGETAEDRISMLETLAGLEVPPQSVPINMLMPMAGTPLADVPRLDAIEMVRTIATAR 247

Query: 264 ILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTILFNRLGLI 323
           ILMP S +RL+AGR+ MSDE+QA+CFF+GANSIFVGDTLLTA NP  +KD +LF +LGL 
Sbjct: 248 ILMPASYVRLSAGRSEMSDEMQAMCFFAGANSIFVGDTLLTAGNPDEDKDALLFAKLGLR 307

Query: 324 PD 325
            +
Sbjct: 308 AE 309


>gi|296314255|ref|ZP_06864196.1| biotin synthase [Neisseria polysaccharea ATCC 43768]
 gi|296839053|gb|EFH22991.1| biotin synthase [Neisseria polysaccharea ATCC 43768]
          Length = 350

 Score =  296 bits (757), Expect = 3e-78,   Method: Composition-based stats.
 Identities = 151/314 (48%), Positives = 212/314 (67%)

Query: 11  NPTKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCG 70
            P    + W   +V  ++ +PF +L++ +  VHR+NF P  IQLS LL+IKTGGCPE+C 
Sbjct: 15  KPHPTARYWKKCDVEALFGLPFLELVYQAAEVHRQNFNPREIQLSTLLSIKTGGCPEDCA 74

Query: 71  YCNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIK 130
           YC QS H+ + L   ++++VD+++++AK AK  GA+R+CMGAAWR PK +D+  +  +IK
Sbjct: 75  YCPQSAHHNTNLGKEQMMDVDEIVEKAKIAKSRGASRFCMGAAWRGPKPKDVETVSAIIK 134

Query: 131 GVKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLE 190
            VK LG+ETC T GML    A+   +AGLDYYNHN+DT    Y  +  T   EDR+ TL 
Sbjct: 135 AVKGLGMETCGTFGMLEEGMAEDFKEAGLDYYNHNLDTDPDRYNDIIHTRQHEDRMDTLG 194

Query: 191 NVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKV 250
            VR +G+KVCCGGI+G+ E   +R  ++ +LANL   PES+PIN L+ + G+   + + +
Sbjct: 195 KVRNAGLKVCCGGIVGMNETRAERAGLIASLANLDPQPESVPINQLVKVEGTPLADAEDL 254

Query: 251 DPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSY 310
           D  E VR I+VARI MP+S +RL+AGR+ MS+ +QA+CF +GANSIF GD LLT  NP  
Sbjct: 255 DWTEFVRTIAVARITMPQSYVRLSAGRSNMSEAMQAMCFMAGANSIFYGDKLLTTGNPDE 314

Query: 311 NKDTILFNRLGLIP 324
           + D IL  +L L P
Sbjct: 315 DGDRILMEKLNLYP 328


>gi|321259884|ref|XP_003194662.1| biotin synthase [Cryptococcus gattii WM276]
 gi|317461134|gb|ADV22875.1| biotin synthase, putative [Cryptococcus gattii WM276]
          Length = 388

 Score =  296 bits (757), Expect = 3e-78,   Method: Composition-based stats.
 Identities = 141/310 (45%), Positives = 210/310 (67%), Gaps = 2/310 (0%)

Query: 16  PKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQS 75
              W   E+ +I++ P  ++++ + TVHR + + + IQL  L+NIKTGGC E+C YC+QS
Sbjct: 51  RHDWRRSEIQKIFDAPLMEIIYRAATVHRLHQDASRIQLCTLMNIKTGGCTEDCKYCSQS 110

Query: 76  VHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREP--KERDLSIIVDMIKGVK 133
              K+  KAS+L+N++ VL+ A+ AK NG+TR+CMGAAWR+   K+     I++M+K V+
Sbjct: 111 SSYKTPTKASRLVNIEPVLEAARQAKANGSTRFCMGAAWRDLAGKKSGFEKILEMVKEVR 170

Query: 134 SLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVR 193
            +G+E C TLGML+ EQA  L +AGL  YNHN+DTS  FYP V T+ +++DRL T+  VR
Sbjct: 171 GMGMEVCTTLGMLTPEQAIRLKEAGLSAYNHNLDTSREFYPEVITSRSYDDRLSTIAAVR 230

Query: 194 KSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPI 253
           ++GI VC GGILGLGE  +DR+ ++  ++ +   PES P+N L+PIPG+  E N+ V   
Sbjct: 231 EAGISVCSGGILGLGEQDEDRVGLIHEVSRMPEHPESFPVNTLVPIPGTPLEGNEPVKVH 290

Query: 254 EHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKD 313
             +R I+ ARI++PK+ +RLAAGR   S+  QA+ F +GAN+IF G+ +LT     ++ D
Sbjct: 291 TVLRTIATARIVLPKTIIRLAAGRHEFSETEQAMAFMAGANAIFTGEKMLTTPCSGWDDD 350

Query: 314 TILFNRLGLI 323
             + +R GL 
Sbjct: 351 KAMLDRWGLR 360


>gi|114327163|ref|YP_744320.1| biotin synthase [Granulibacter bethesdensis CGDNIH1]
 gi|114315337|gb|ABI61397.1| biotin synthase [Granulibacter bethesdensis CGDNIH1]
          Length = 342

 Score =  296 bits (757), Expect = 4e-78,   Method: Composition-based stats.
 Identities = 166/314 (52%), Positives = 230/314 (73%)

Query: 10  ENPTKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENC 69
                    W+ +EV  + ++PF +LLF +  +HR  F+P  +Q+S LL+IKTGGCPE+C
Sbjct: 27  AEAVVIRHDWSREEVRSLLDLPFPELLFRAAAIHRACFDPREVQISTLLSIKTGGCPEDC 86

Query: 70  GYCNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMI 129
            YC Q+    + ++AS+L+ VD VL+EA+ AK  GA+R+CMGAAWR PKERD+  + +MI
Sbjct: 87  AYCPQAAQYDTGVEASRLMRVDAVLEEARAAKAAGASRFCMGAAWRSPKERDMDTVCEMI 146

Query: 130 KGVKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTL 189
           +GVK+LG+E+C+TLGML+ +QA  L +AGLDYYNHN+DTS  +Y  V +T T+EDRL+TL
Sbjct: 147 EGVKALGMESCVTLGMLTDQQALRLKQAGLDYYNHNLDTSPEYYGAVISTRTYEDRLETL 206

Query: 190 ENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKK 249
            +VR +GI VCCGGILGLGE +DDR  +++ LANL   PES+PIN L+ + G+  +  + 
Sbjct: 207 AHVRDAGINVCCGGILGLGEGLDDRAGLIVALANLPRHPESVPINALVQVEGTPLKGQEP 266

Query: 250 VDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPS 309
           VD I+ VR+I+VARI MP +R+RL+AGR  M+DE QALCF +GANSIF G+ LLT  NP+
Sbjct: 267 VDTIDFVRMIAVARITMPHARVRLSAGREAMTDEAQALCFLAGANSIFYGEKLLTTGNPA 326

Query: 310 YNKDTILFNRLGLI 323
             +D  L +RLG+ 
Sbjct: 327 AERDRALLSRLGMR 340


>gi|121594401|ref|YP_986297.1| biotin synthase [Acidovorax sp. JS42]
 gi|254810537|sp|A1W7J6|BIOB_ACISJ RecName: Full=Biotin synthase
 gi|120606481|gb|ABM42221.1| biotin synthase [Acidovorax sp. JS42]
          Length = 350

 Score =  296 bits (757), Expect = 4e-78,   Method: Composition-based stats.
 Identities = 160/317 (50%), Positives = 222/317 (70%)

Query: 7   VPEENPTKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCP 66
           V E   T++ + W+ + V ++ ++PF +LL+ +   HR ++    I+L+ LL++KTGGCP
Sbjct: 20  VAESVATQRGEGWSIQAVQELLDLPFMELLWRAQATHRTHWPQGDIELATLLSVKTGGCP 79

Query: 67  ENCGYCNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIV 126
           ENCGYC QS    + +KA KL+NV +V + A+ AK+ GATR+CMGAAWR PK+RD+  I 
Sbjct: 80  ENCGYCPQSAEFDTGVKAEKLMNVQEVTQAAQAAKDAGATRFCMGAAWRAPKDRDIEKIS 139

Query: 127 DMIKGVKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRL 186
           ++I  VK LGL+TC TLGML   QAQ L  AGLDYYNHN+DT+  +Y  V +T  ++DRL
Sbjct: 140 ELITAVKDLGLQTCATLGMLQSHQAQALKDAGLDYYNHNLDTAPEYYSDVVSTRQYQDRL 199

Query: 187 QTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEE 246
            TL +VR +GI VCCGGI+G+GE    R  ++  LANL+  PES+PIN L+ + G+   +
Sbjct: 200 DTLRHVRDAGINVCCGGIVGMGEAPVHRAGLIAQLANLNPYPESVPINSLVRVAGTPLAD 259

Query: 247 NKKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAK 306
           ++ VDP++ VR+I+VARI MPK+R+RL+AGR  + D +QALCF +GANSIF GD LL   
Sbjct: 260 SEPVDPLDFVRVIAVARITMPKARVRLSAGRQQLGDAVQALCFLAGANSIFYGDKLLVTG 319

Query: 307 NPSYNKDTILFNRLGLI 323
           NP    DT L  +LGL 
Sbjct: 320 NPDVEADTQLLAKLGLK 336


>gi|254361116|ref|ZP_04977261.1| biotin synthase [Mannheimia haemolytica PHL213]
 gi|153092602|gb|EDN73657.1| biotin synthase [Mannheimia haemolytica PHL213]
          Length = 333

 Score =  296 bits (757), Expect = 4e-78,   Method: Composition-based stats.
 Identities = 154/322 (47%), Positives = 215/322 (66%)

Query: 3   RSTVVPEENPTKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKT 62
           R     E  P    + W   +V  ++++PF DL+F +  VHR+NF+ N IQLS LL+IKT
Sbjct: 7   RLKAKDELTPHPTAQYWRKCQVEGLFDLPFMDLVFRAAQVHRENFDANAIQLSTLLSIKT 66

Query: 63  GGCPENCGYCNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDL 122
           GGCPE+C YC QS    + ++   +++V+ ++++AK AKE GA+R+CMGAAWR P+ +D+
Sbjct: 67  GGCPEDCEYCPQSARYDTGIEKQTMLDVETIVEKAKIAKERGASRFCMGAAWRGPRPKDI 126

Query: 123 SIIVDMIKGVKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTF 182
            ++ ++I  VKSLGLETC T GML    A+ L +AGLDYYNHN+DT    Y  +  T   
Sbjct: 127 KVVSEIINAVKSLGLETCGTFGMLEEGMAEELKQAGLDYYNHNLDTDPERYNKIIHTRNH 186

Query: 183 EDRLQTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGS 242
           EDR+ TL  VR +G+KVCCGGI+G+ E   +R  ++ +LANL   PES+PIN LI + G+
Sbjct: 187 EDRMDTLGKVRNAGLKVCCGGIVGMNETRPERAGLIASLANLDPQPESVPINQLIKVEGT 246

Query: 243 KFEENKKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTL 302
                + +D  E VR I+VARI MP+S +RL+AGR  M + +QALCF +GANSIF GD L
Sbjct: 247 PLTNAEDLDWTEFVRTIAVARITMPQSFVRLSAGRTTMPEAMQALCFMAGANSIFYGDKL 306

Query: 303 LTAKNPSYNKDTILFNRLGLIP 324
           LT +NP  + D  L ++L L P
Sbjct: 307 LTTENPEEDHDRQLMDKLDLYP 328


>gi|225024781|ref|ZP_03713973.1| hypothetical protein EIKCOROL_01668 [Eikenella corrodens ATCC
           23834]
 gi|224942488|gb|EEG23697.1| hypothetical protein EIKCOROL_01668 [Eikenella corrodens ATCC
           23834]
          Length = 362

 Score =  296 bits (757), Expect = 4e-78,   Method: Composition-based stats.
 Identities = 154/322 (47%), Positives = 221/322 (68%), Gaps = 2/322 (0%)

Query: 3   RSTVVPEENPTKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKT 62
           R    P+ +PT   + W   +V  ++ +PF DL+F +  +HR+NF P  IQLS LL+IKT
Sbjct: 10  RRQTEPKPHPTA--QYWKKCDVEALFGLPFLDLVFRAAEIHRQNFNPREIQLSTLLSIKT 67

Query: 63  GGCPENCGYCNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDL 122
           GGCPE+C YC QS H+ + L   ++++V +++++AK AK  GA+R+CMGAAWR PK +D+
Sbjct: 68  GGCPEDCAYCPQSAHHNTNLGKEQMMDVGEIVEKAKIAKSRGASRFCMGAAWRGPKPKDV 127

Query: 123 SIIVDMIKGVKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTF 182
           +++ ++IK VK LG+ETC T GML    A+   KAGLDYYNHN+DT    Y  +  T   
Sbjct: 128 AVVSEIIKAVKGLGMETCGTFGMLEDGMAEDFKKAGLDYYNHNLDTDPERYNDIIHTRKH 187

Query: 183 EDRLQTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGS 242
           EDR+ TL  VR +G+K+CCGGI+G+ E   +R  ++ +LANL   PES+PIN L+ + G+
Sbjct: 188 EDRMDTLGKVRNAGLKICCGGIVGMNETRAERAGLIASLANLDPQPESVPINQLVKVEGT 247

Query: 243 KFEENKKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTL 302
              + + +D  E VR I+VARI MPKS +RL+AGR+ MS+ +QA+CF +GANSIF GD L
Sbjct: 248 PLADAEDLDWTEFVRTIAVARITMPKSFVRLSAGRSNMSESMQAMCFMAGANSIFYGDKL 307

Query: 303 LTAKNPSYNKDTILFNRLGLIP 324
           LT +NP  + D +L  +L L+P
Sbjct: 308 LTTENPDEDGDRLLMAKLDLVP 329


>gi|37523897|ref|NP_927274.1| biotin synthase [Gloeobacter violaceus PCC 7421]
 gi|81708214|sp|Q7NDA8|BIOB_GLOVI RecName: Full=Biotin synthase
 gi|35214903|dbj|BAC92269.1| biotin synthase [Gloeobacter violaceus PCC 7421]
          Length = 318

 Score =  295 bits (756), Expect = 4e-78,   Method: Composition-based stats.
 Identities = 154/309 (49%), Positives = 215/309 (69%), Gaps = 1/309 (0%)

Query: 20  TSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQSVHNK 79
           T  E+ +IY+ P  DLLF +  VHR + +P  +QL  L NIKTG CPENCGYC+QSVH+K
Sbjct: 9   TVSEISRIYHQPLPDLLFEAQRVHRAHHDPREVQLCTLSNIKTGLCPENCGYCSQSVHHK 68

Query: 80  SKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERD-LSIIVDMIKGVKSLGLE 138
           S L A +L ++D V+ EA+ AK  G+TR+CMGAAWRE K+      +++M++ V +L +E
Sbjct: 69  SGLAAQELSSLDAVMAEAQAAKAAGSTRFCMGAAWREIKDGPPFERVLEMVRSVAALDME 128

Query: 139 TCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSGIK 198
            C TLGM+   QA+ L +AGL  YNHN+DT   +YP V TT T++DRL+T+  V  +GI 
Sbjct: 129 VCCTLGMVKPHQAERLKQAGLTAYNHNLDTGPGYYPQVVTTRTYKDRLETIRAVGAAGIS 188

Query: 199 VCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEHVRI 258
           VCCGGILG+GE + DR ++L +L +L   PESIPIN L+P+ G+   ++  V+P++ VR+
Sbjct: 189 VCCGGILGMGESLTDRFELLESLGSLDPTPESIPINCLVPVAGTPLADSSPVEPLDLVRM 248

Query: 259 ISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTILFN 318
           ++  RIL P + +RL+AGR  MS+ELQALCF +GANSIF G  LLT  NP ++ D  L  
Sbjct: 249 VATTRILFPDAMVRLSAGRLQMSEELQALCFLAGANSIFTGPKLLTTPNPEHSHDQKLLE 308

Query: 319 RLGLIPDLS 327
           +LG+ P  +
Sbjct: 309 KLGMEPKTT 317


>gi|209545508|ref|YP_002277737.1| biotin synthase [Gluconacetobacter diazotrophicus PAl 5]
 gi|209533185|gb|ACI53122.1| biotin synthase [Gluconacetobacter diazotrophicus PAl 5]
          Length = 336

 Score =  295 bits (756), Expect = 5e-78,   Method: Composition-based stats.
 Identities = 165/309 (53%), Positives = 219/309 (70%), Gaps = 1/309 (0%)

Query: 16  PKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQS 75
              WT  E+  +  +PF +L+F + +VHR  F+P  IQ+S LL+IKTGGCPE+C YC QS
Sbjct: 22  RTDWTRDEIAALIALPFPELMFRAQSVHRARFDPTEIQISTLLSIKTGGCPEDCAYCPQS 81

Query: 76  VHN-KSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKS 134
             +    +KAS+L+ V+ VLKEA+ A++ GA R+CMGAAWR PK+ DL  +  M++GVKS
Sbjct: 82  AKHEDGGVKASRLMAVEAVLKEARAARDAGAARFCMGAAWRSPKDHDLETVCAMVEGVKS 141

Query: 135 LGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRK 194
           LG+ETC+TLGML   QA  L +AGLDYYNHN+DTS   Y  + +T T+++RL TL +VR 
Sbjct: 142 LGMETCVTLGMLDDRQAHRLREAGLDYYNHNLDTSPEHYGSIISTRTYQERLDTLAHVRD 201

Query: 195 SGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIE 254
           +GI VCCGGI+G+GE  DDR  ++ +LA+L   PES+PINLL+ + G+       VDPI+
Sbjct: 202 AGINVCCGGIVGMGENDDDRAGLIASLASLPRHPESVPINLLVRVAGTPLAGADPVDPID 261

Query: 255 HVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDT 314
            VRII+ ARI MP SR+RLAAGR  M+DE Q LCF +GANSIF G+ LLT  NP  ++D 
Sbjct: 262 FVRIIAAARIAMPASRVRLAAGREDMTDEAQTLCFLAGANSIFYGEKLLTTPNPEASRDA 321

Query: 315 ILFNRLGLI 323
            L  RLG+ 
Sbjct: 322 RLLARLGMH 330


>gi|164661293|ref|XP_001731769.1| hypothetical protein MGL_1037 [Malassezia globosa CBS 7966]
 gi|159105670|gb|EDP44555.1| hypothetical protein MGL_1037 [Malassezia globosa CBS 7966]
          Length = 401

 Score =  295 bits (756), Expect = 5e-78,   Method: Composition-based stats.
 Identities = 146/327 (44%), Positives = 213/327 (65%), Gaps = 2/327 (0%)

Query: 3   RSTVVPEENPTKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKT 62
           R+T   E       K W   EV  +++ P  +L+F + +VHR + +   IQL  L+NIK 
Sbjct: 17  RATSSSEAWSPSARKSWERSEVQALFDQPLLELVFQAASVHRMHHDARKIQLCTLMNIKE 76

Query: 63  GGCPENCGYCNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREP--KER 120
           GGC E+C YC+QS   ++   ASKL +++ VL+EA+ AK NG+TR+CMGAAWRE   ++R
Sbjct: 77  GGCSEDCAYCSQSSRYETHSHASKLEDLENVLEEARRAKANGSTRFCMGAAWREIGGRKR 136

Query: 121 DLSIIVDMIKGVKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTH 180
             + I+DM++ ++ +G+E C TLGML+ EQAQ L +AGL  YNHN+DTS  +Y  V T+ 
Sbjct: 137 GFNRILDMVREIRGMGMEVCTTLGMLTAEQAQQLKEAGLSAYNHNLDTSREYYGKVITSR 196

Query: 181 TFEDRLQTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIP 240
           T++DRLQT+ +VR +GI VC GGILGLGE   DR+ ++  ++ L   PES P+N L+ IP
Sbjct: 197 TYDDRLQTIAHVRDAGISVCSGGILGLGEDESDRVGLIWEMSRLPEAPESFPVNALVAIP 256

Query: 241 GSKFEENKKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGD 300
           G+  E    V   E +R ++ ARI++P S +R+AAGR M ++  QA+ F +GAN+IF G 
Sbjct: 257 GTPMEGQPPVQFQEMLRTVATARIVLPTSIVRIAAGRQMFTESEQAMLFLAGANAIFTGH 316

Query: 301 TLLTAKNPSYNKDTILFNRLGLIPDLS 327
            +LT    S+++D  +  R GL P  S
Sbjct: 317 RMLTTPTSSWDQDRAMLERWGLSPMKS 343


>gi|121703840|ref|XP_001270184.1| biotin synthase, putative [Aspergillus clavatus NRRL 1]
 gi|119398328|gb|EAW08758.1| biotin synthase, putative [Aspergillus clavatus NRRL 1]
          Length = 399

 Score =  295 bits (756), Expect = 5e-78,   Method: Composition-based stats.
 Identities = 148/325 (45%), Positives = 212/325 (65%), Gaps = 2/325 (0%)

Query: 5   TVVPEENPTKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGG 64
            +      T     W+ +EV Q+Y  P N L + +  VHR+  +P  IQ+  L+NIKTGG
Sbjct: 38  ALQEATAATAPRTNWSREEVQQVYETPLNQLTYAAAIVHRRFHDPAAIQMCTLMNIKTGG 97

Query: 65  CPENCGYCNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKER--DL 122
           C E+C YC QS    + LKA+K+  VD+VLK A+ AK+NG+TR+CMGAAWR+ + R   L
Sbjct: 98  CSEDCSYCAQSSRYTTGLKATKMSPVDEVLKAARIAKDNGSTRFCMGAAWRDMRGRKTSL 157

Query: 123 SIIVDMIKGVKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTF 182
             I +M+ GV+ +G+E C+TLGM+   QA+ L  AGL  YNHN+DTS  FYP + +T ++
Sbjct: 158 KNIKEMVSGVRGMGMEVCVTLGMIDETQAKELKDAGLTAYNHNLDTSREFYPSIISTRSY 217

Query: 183 EDRLQTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGS 242
           ++RLQTL  VR +GI VC GGILGLGE   DRI +L T+ANL   PES P+N L+PI G+
Sbjct: 218 DERLQTLARVRDAGINVCSGGILGLGEADADRIGLLHTVANLPAHPESFPVNALVPIKGT 277

Query: 243 KFEENKKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTL 302
              + K +   + +R ++ ARI++P + +RLAAGR  +S+E Q  CF +GAN++F G+ +
Sbjct: 278 PLGDRKMISFDKLLRTVATARIVLPATIVRLAAGRISLSEEQQVACFMAGANAVFTGEKM 337

Query: 303 LTAKNPSYNKDTILFNRLGLIPDLS 327
           LT     +++D  +F+R G  P  S
Sbjct: 338 LTTDCNGWDEDREMFDRWGFYPMRS 362


>gi|119193883|ref|XP_001247545.1| biotin synthase [Coccidioides immitis RS]
          Length = 403

 Score =  295 bits (756), Expect = 5e-78,   Method: Composition-based stats.
 Identities = 152/322 (47%), Positives = 220/322 (68%), Gaps = 2/322 (0%)

Query: 6   VVPEENPTKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGC 65
           +    + T     WT +E+ +IY+ P  +L + S TVHR+  +P  IQ+  L+NIKTGGC
Sbjct: 45  LQEAVSATAPRMNWTREEIQKIYDAPLTELTYASATVHRRFHDPAAIQMCTLMNIKTGGC 104

Query: 66  PENCGYCNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKER--DLS 123
            E+C YC QS   K+ LKA+KL +VD VL+ A+ AKENG+TR+CMGAAWR+ + R  +L 
Sbjct: 105 SEDCSYCAQSSRYKTGLKATKLSSVDSVLEAARVAKENGSTRFCMGAAWRDMRGRKTNLR 164

Query: 124 IIVDMIKGVKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFE 183
            I +M+ GV+++G+E C+TLGM+  EQA+ L  AGL  YNHN+DTS  FYP + TT +++
Sbjct: 165 NIKEMVSGVRAMGMEVCVTLGMIDGEQAKELKDAGLTAYNHNLDTSREFYPSIITTRSYD 224

Query: 184 DRLQTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSK 243
           +RLQTLE+VR +GI VC GGILGLGE   DR+ ++ T+A L + PES P+N L+PI G+ 
Sbjct: 225 ERLQTLEHVRDAGINVCSGGILGLGEQDSDRVGLIHTVATLPSHPESFPVNALVPIKGTP 284

Query: 244 FEENKKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLL 303
             E K +   + +R ++ ARI++P S +RLAAGR  M++E Q  CF +GAN+IF G+ +L
Sbjct: 285 LGERKMISFDKVLRTVATARIVLPMSIVRLAAGRISMTEEQQVTCFQAGANAIFTGEKML 344

Query: 304 TAKNPSYNKDTILFNRLGLIPD 325
           T     +++D  +F++ G  P 
Sbjct: 345 TTDCSGWDEDKKIFDKWGYYPM 366


>gi|319638136|ref|ZP_07992899.1| biotin synthetase [Neisseria mucosa C102]
 gi|317400409|gb|EFV81067.1| biotin synthetase [Neisseria mucosa C102]
          Length = 350

 Score =  295 bits (755), Expect = 6e-78,   Method: Composition-based stats.
 Identities = 150/316 (47%), Positives = 213/316 (67%)

Query: 9   EENPTKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPEN 68
           E  P    + W   +V  ++ +PF DL+F +  +HR+NF P  IQLS LL+IKTGGCPE+
Sbjct: 13  ERKPHPTARYWKKCDVEALFGLPFLDLVFQAAEIHRQNFNPREIQLSTLLSIKTGGCPED 72

Query: 69  CGYCNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDM 128
           C YC QS H+ + L   ++++VD+++++AK A+  GA+R+CMGAAWR PK +D++++ ++
Sbjct: 73  CAYCPQSAHHNTNLGKEQMMDVDEIVEKAKIAQSRGASRFCMGAAWRGPKPKDVAVVSEI 132

Query: 129 IKGVKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQT 188
           I  VKSLG+E C T GML    A+   KAGLDYYNHN+DT    Y  +  T   EDR+ T
Sbjct: 133 ISAVKSLGMEVCGTFGMLEDGMAEDFKKAGLDYYNHNLDTDPERYNDIIHTRKHEDRMDT 192

Query: 189 LENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENK 248
           L  VR +G+KVCCGGI+G+ E   +R  ++ +LANL   PES+PIN L+ + G+   + +
Sbjct: 193 LGKVRNAGLKVCCGGIVGMNETRAERAGLIASLANLDPQPESVPINQLVKVEGTPLADAE 252

Query: 249 KVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNP 308
            +D  E VR I+VARI MP S +RL+AGR+ M + +QA+CF +GANSIF GD LLT  NP
Sbjct: 253 DLDWTEFVRTIAVARITMPHSYVRLSAGRSNMPESMQAMCFMAGANSIFYGDKLLTTGNP 312

Query: 309 SYNKDTILFNRLGLIP 324
             + D +L  +L L P
Sbjct: 313 DEDGDRLLMEKLNLYP 328


>gi|325140578|gb|EGC63099.1| biotin synthase [Neisseria meningitidis CU385]
          Length = 599

 Score =  295 bits (755), Expect = 6e-78,   Method: Composition-based stats.
 Identities = 151/314 (48%), Positives = 212/314 (67%)

Query: 11  NPTKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCG 70
            P    + W   +V  ++ +PF DL++ +  +HR+NF P  IQLS LL+IKTGGCPE+C 
Sbjct: 264 KPHPTARYWKKCDVEALFGLPFLDLIYQAAEIHRQNFNPREIQLSTLLSIKTGGCPEDCA 323

Query: 71  YCNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIK 130
           YC QS H+ + L   ++++VD+++++AK AK  GA+R+CMGAAWR PK +D+  +  +IK
Sbjct: 324 YCPQSAHHNTNLGKEQMMDVDEIVEKAKIAKSRGASRFCMGAAWRGPKPKDVETVSAIIK 383

Query: 131 GVKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLE 190
            VK LG+ETC T GML    A+ L +AGLDYYNHN+DT    Y  +  T   EDR+ TL 
Sbjct: 384 AVKGLGMETCGTFGMLEEGMAEDLKEAGLDYYNHNLDTDPDRYNDIIHTRQHEDRMDTLG 443

Query: 191 NVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKV 250
            VR +G+KVCCGGI+G+ E   +R  ++ +LANL   PES+PIN L+ + G+   + + +
Sbjct: 444 KVRNAGLKVCCGGIVGMNETRAERAGLIASLANLDPQPESVPINRLVKVEGTPLADAEDL 503

Query: 251 DPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSY 310
           D  E VR I+VARI MP+S +RL+AGR+ M + +QA+CF +GANSIF GD LLT  NP  
Sbjct: 504 DWTEFVRTIAVARITMPQSYVRLSAGRSNMPEAMQAMCFMAGANSIFYGDKLLTTGNPDE 563

Query: 311 NKDTILFNRLGLIP 324
           + D IL  +L L P
Sbjct: 564 DGDRILMEKLNLYP 577


>gi|303311717|ref|XP_003065870.1| biotin synthase, mitochondrial precursor, putative [Coccidioides
           posadasii C735 delta SOWgp]
 gi|240105532|gb|EER23725.1| biotin synthase, mitochondrial precursor, putative [Coccidioides
           posadasii C735 delta SOWgp]
 gi|320039779|gb|EFW21713.1| biotin synthase [Coccidioides posadasii str. Silveira]
          Length = 403

 Score =  295 bits (755), Expect = 6e-78,   Method: Composition-based stats.
 Identities = 152/322 (47%), Positives = 220/322 (68%), Gaps = 2/322 (0%)

Query: 6   VVPEENPTKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGC 65
           +    + T     WT +E+ +IY+ P  +L + S TVHR+  +P  IQ+  L+NIKTGGC
Sbjct: 45  LQEAVSATAPRMNWTREEIQKIYDAPLTELTYASATVHRRFHDPAAIQMCTLMNIKTGGC 104

Query: 66  PENCGYCNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKER--DLS 123
            E+C YC QS   K+ LKA+KL +VD VL+ A+ AKENG+TR+CMGAAWR+ + R  +L 
Sbjct: 105 SEDCSYCAQSSRYKTGLKATKLSSVDSVLEAARVAKENGSTRFCMGAAWRDMRGRKTNLR 164

Query: 124 IIVDMIKGVKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFE 183
            I +M+ GV+++G+E C+TLGM+  EQA+ L  AGL  YNHN+DTS  FYP + TT +++
Sbjct: 165 NIKEMVSGVRAMGMEVCVTLGMIDGEQAKELKDAGLTAYNHNLDTSREFYPSIITTRSYD 224

Query: 184 DRLQTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSK 243
           +RLQTLE+VR +GI VC GGILGLGE   DR+ ++ T+A L + PES P+N L+PI G+ 
Sbjct: 225 ERLQTLEHVRDAGINVCSGGILGLGEQDSDRVGLIHTVATLPSHPESFPVNALVPIKGTP 284

Query: 244 FEENKKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLL 303
             E K +   + +R ++ ARI++P S +RLAAGR  M++E Q  CF +GAN+IF G+ +L
Sbjct: 285 LGERKMISFDKVLRTVATARIVLPMSIVRLAAGRISMTEEQQVTCFQAGANAIFTGEKML 344

Query: 304 TAKNPSYNKDTILFNRLGLIPD 325
           T     +++D  +F++ G  P 
Sbjct: 345 TTDCSGWDEDKKIFDKWGYYPM 366


>gi|159903634|ref|YP_001550978.1| biotin synthase [Prochlorococcus marinus str. MIT 9211]
 gi|254810777|sp|A9BB12|BIOB_PROM4 RecName: Full=Biotin synthase
 gi|159888810|gb|ABX09024.1| Biotin synthase [Prochlorococcus marinus str. MIT 9211]
          Length = 332

 Score =  295 bits (755), Expect = 6e-78,   Method: Composition-based stats.
 Identities = 147/322 (45%), Positives = 212/322 (65%), Gaps = 1/322 (0%)

Query: 7   VPEENPTKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCP 66
             ++   +    W+  EV  +   P  DLL+ +  VHR       +QL+ LL++KTGGC 
Sbjct: 8   AADQKEVQLRYDWSFSEVESLLQKPLMDLLWDAQRVHRLTNPGYKVQLASLLSVKTGGCE 67

Query: 67  ENCGYCNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKER-DLSII 125
           E+C YC+QS+HN S + +     V++VLK AK AK+ GA R+CMG AWRE ++      +
Sbjct: 68  EDCAYCSQSIHNSSDITSYSDFEVEEVLKRAKTAKDAGADRFCMGWAWREIRDGQPFESM 127

Query: 126 VDMIKGVKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDR 185
           + M++GV+ LG+E C+T GML+  QA  L++AGL  YNHN+DTS   Y  + TT T+++R
Sbjct: 128 LKMVRGVRDLGMEACVTAGMLTDNQALRLAEAGLTAYNHNLDTSPENYDQIITTRTYQER 187

Query: 186 LQTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFE 245
           ++TLE VR +GI +C GGI+GLGE + DR  +L  LAN+S  PES+PIN L+ + G+  +
Sbjct: 188 IETLERVRSAGITLCTGGIIGLGESLKDRASLLKVLANMSPHPESVPINALVAVEGTPLQ 247

Query: 246 ENKKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTA 305
           +   +DPIE VR+++ ARILMP SR+RL+AGR  + DE Q LCF +GA+SIF GDTLLT 
Sbjct: 248 DLPSIDPIEMVRMVATARILMPLSRVRLSAGREQLGDEAQILCFLAGADSIFYGDTLLTT 307

Query: 306 KNPSYNKDTILFNRLGLIPDLS 327
            NP+   D  L ++ G+  + S
Sbjct: 308 SNPAIQADRELLSKAGVQVNWS 329


>gi|103486709|ref|YP_616270.1| biotin synthase [Sphingopyxis alaskensis RB2256]
 gi|122985089|sp|Q1GTT5|BIOB_SPHAL RecName: Full=Biotin synthase
 gi|98976786|gb|ABF52937.1| biotin synthase [Sphingopyxis alaskensis RB2256]
          Length = 329

 Score =  295 bits (755), Expect = 6e-78,   Method: Composition-based stats.
 Identities = 170/318 (53%), Positives = 223/318 (70%), Gaps = 6/318 (1%)

Query: 16  PKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQS 75
              WT +E+  ++++PF++L++ +  VHR++     IQL  LL+IKTGGC E+CGYC+QS
Sbjct: 2   RTDWTREEIAALFDLPFDELMWEAQGVHRRHHARGEIQLCTLLSIKTGGCVEDCGYCSQS 61

Query: 76  VHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSL 135
            H  + LKA+KL++V  VL+ A  AK+ G+ R+CMGAAWR PK+RD+  IV+MI+GV+++
Sbjct: 62  AHADTGLKATKLMDVRAVLQAAAQAKDAGSKRFCMGAAWRNPKDRDMPAIVEMIEGVRAM 121

Query: 136 GLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKS 195
           G+ETCMTLGMLS EQAQ+L  AGLDYYNHNIDTS   Y +V TT +F+DRL TLE VR +
Sbjct: 122 GMETCMTLGMLSKEQAQVLGMAGLDYYNHNIDTSPEHYGNVITTRSFQDRLDTLEEVRAA 181

Query: 196 GIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDP--- 252
           GI VC GGI+G+GE   DR+  + TLA L   P S+PIN L+P+ G+   +     P   
Sbjct: 182 GINVCSGGIVGMGETRADRVGFIHTLATLPEHPGSVPINALVPVKGTVLGDMLADTPLAK 241

Query: 253 ---IEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPS 309
              IE VR ++VARI MPKS +RL+AGR  MS+  QALCF +GANSIF GD LLT  N  
Sbjct: 242 IDDIEFVRTVAVARITMPKSMVRLSAGRESMSEATQALCFMAGANSIFTGDKLLTTANAG 301

Query: 310 YNKDTILFNRLGLIPDLS 327
            N D  LF +LGL P  S
Sbjct: 302 DNADAALFAKLGLRPMES 319


>gi|148828189|ref|YP_001292942.1| thiamin transporter membrane protein [Haemophilus influenzae
           PittGG]
 gi|254810711|sp|A5UIF3|BIOB_HAEIG RecName: Full=Biotin synthase
 gi|148719431|gb|ABR00559.1| thiamin transporter membrane protein [Haemophilus influenzae
           PittGG]
          Length = 332

 Score =  295 bits (755), Expect = 6e-78,   Method: Composition-based stats.
 Identities = 151/327 (46%), Positives = 221/327 (67%)

Query: 1   MSRSTVVPEENPTKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNI 60
           ++    +    P    + W+  +V  ++  PF +L++ +  +HRK+F    IQLS L++I
Sbjct: 2   LAEKLQINSITPHPSVEYWSVCKVEALFETPFLELVYRAAQIHRKHFNSRTIQLSTLMSI 61

Query: 61  KTGGCPENCGYCNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKER 120
           KTGGCPE+CGYC QS    + ++  +L++V++++ +AK AK  GA R+CMGAAWR PK +
Sbjct: 62  KTGGCPEDCGYCPQSARYHTGVQNQQLLDVNEIIAKAKIAKARGAGRFCMGAAWRGPKPK 121

Query: 121 DLSIIVDMIKGVKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTH 180
           D+  + ++IK VKSLGLETC T G+L    A+ L +AGLDYYNHN+DT+   Y  V  T 
Sbjct: 122 DIEKVTEIIKAVKSLGLETCGTFGLLQDGMAEDLKEAGLDYYNHNLDTAPEHYAEVIGTR 181

Query: 181 TFEDRLQTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIP 240
            F+DRL TL  VRK+G+KVCCGGI+G+ E   +R  ++ +LANL   PES+PIN L+ + 
Sbjct: 182 RFDDRLSTLGKVRKAGLKVCCGGIVGMNETRKERAGLIASLANLDPQPESVPINQLVKVE 241

Query: 241 GSKFEENKKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGD 300
           G+   + +++D  E VR I+VARI MPKS +RL+AGR+ M++E+QA+CF +GANSIF GD
Sbjct: 242 GTPLADAEELDWTEFVRTIAVARITMPKSYVRLSAGRSGMTEEMQAMCFMAGANSIFYGD 301

Query: 301 TLLTAKNPSYNKDTILFNRLGLIPDLS 327
            LL   NP  + D +L  +L L P+ +
Sbjct: 302 KLLVTDNPEEDGDQLLMAKLDLEPETA 328


>gi|294011689|ref|YP_003545149.1| biotin synthetase [Sphingobium japonicum UT26S]
 gi|292675019|dbj|BAI96537.1| biotin synthetase [Sphingobium japonicum UT26S]
          Length = 328

 Score =  295 bits (755), Expect = 7e-78,   Method: Composition-based stats.
 Identities = 175/316 (55%), Positives = 234/316 (74%), Gaps = 7/316 (2%)

Query: 18  VWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQSVH 77
            WT +E+  ++++PFNDL+F + ++HR NF  N +QLS LL+IKTGGCPE+CGYC+QS  
Sbjct: 4   DWTREEIAALFDLPFNDLMFEAQSIHRANFPRNEVQLSTLLSIKTGGCPEDCGYCSQSTE 63

Query: 78  NKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLGL 137
            +S LKA+KL++V  VL+ A  AK++G+ R+CMGAAWR PKERD+  +++M+KGV+ +G+
Sbjct: 64  AESGLKATKLMDVQAVLQAAAQAKDHGSGRFCMGAAWRNPKERDMPKLIEMVKGVRQMGM 123

Query: 138 ETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSGI 197
           ETCMTLGMLS  QA+ L+ AGLDYYNHNIDTS   Y +V TT TFEDR++TLENVR +GI
Sbjct: 124 ETCMTLGMLSAGQAKQLADAGLDYYNHNIDTSPENYANVITTRTFEDRIETLENVRSAGI 183

Query: 198 KVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPI---- 253
            VCCGGI+G+GE   DRI  L  LA +   PES+PIN L+P+ G+   +  K  P+    
Sbjct: 184 NVCCGGIVGMGETRSDRIGFLHALATM-PHPESVPINALVPVEGTVLGDMLKDTPLAKID 242

Query: 254 --EHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYN 311
             E VR ++VARI+MP+S +RL+AGR  MS+  QALCF +GANSIF GD LLTA N   +
Sbjct: 243 EVEFVRTVAVARIVMPQSMVRLSAGRESMSEACQALCFMAGANSIFTGDKLLTAANAGDD 302

Query: 312 KDTILFNRLGLIPDLS 327
           KD+ L  +LGL P ++
Sbjct: 303 KDSALLGKLGLTPMMA 318


>gi|302658864|ref|XP_003021130.1| hypothetical protein TRV_04744 [Trichophyton verrucosum HKI 0517]
 gi|291185012|gb|EFE40512.1| hypothetical protein TRV_04744 [Trichophyton verrucosum HKI 0517]
          Length = 408

 Score =  295 bits (755), Expect = 7e-78,   Method: Composition-based stats.
 Identities = 148/326 (45%), Positives = 215/326 (65%), Gaps = 2/326 (0%)

Query: 4   STVVPEENPTKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTG 63
           + +      +     WT +E+ QIY  P N L F +  VHR   +P  IQ+  L+NIKTG
Sbjct: 50  AALQDAIAASAPRTSWTREEITQIYQTPLNQLTFAAAAVHRNFHDPAAIQMCTLMNIKTG 109

Query: 64  GCPENCGYCNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKER--D 121
           GC E+C YC+QS    + LKA+KL +VD VL+ A+ AKENG+TR+CMGAAWR+ + R  +
Sbjct: 110 GCSEDCSYCSQSSRYDTGLKATKLSSVDSVLEAARIAKENGSTRFCMGAAWRDMRGRKSN 169

Query: 122 LSIIVDMIKGVKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHT 181
           L  I  M+ GV+ +G+E C+TLGM+  EQA+ L +AGL  YNHN+DTS  FYP + TT +
Sbjct: 170 LKNIKAMVSGVREMGMEVCVTLGMIDGEQAKELKEAGLTAYNHNVDTSREFYPSIITTRS 229

Query: 182 FEDRLQTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPG 241
           +++R+QTL +VR +GI VC GGILGLGE   DR+ ++ T+A L   PES P+N L+PI G
Sbjct: 230 YDERIQTLGHVRDAGINVCSGGILGLGEEDSDRVGLIHTVATLPAHPESFPVNALVPIKG 289

Query: 242 SKFEENKKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDT 301
           +     K ++  + +R ++ ARI++P + +RLAAGR  +++E Q  CF SGAN+IF G+ 
Sbjct: 290 TPLGNRKMIEFDKLLRTVATARIVLPATIVRLAAGRISLTEEQQVTCFMSGANAIFTGER 349

Query: 302 LLTAKNPSYNKDTILFNRLGLIPDLS 327
           +LT     +++D  +F++ G  P  S
Sbjct: 350 MLTTDCTGWDEDKKMFDKWGYYPMKS 375


>gi|261380284|ref|ZP_05984857.1| biotin synthase [Neisseria subflava NJ9703]
 gi|284796796|gb|EFC52143.1| biotin synthase [Neisseria subflava NJ9703]
          Length = 350

 Score =  295 bits (755), Expect = 7e-78,   Method: Composition-based stats.
 Identities = 149/316 (47%), Positives = 212/316 (67%)

Query: 9   EENPTKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPEN 68
           E  P    + W   +V  ++ +PF DL+F +  +HR+NF P  IQLS LL+IKTGGCPE+
Sbjct: 13  ERKPHPTARYWKKCDVEALFGLPFLDLVFQAAEIHRQNFNPREIQLSTLLSIKTGGCPED 72

Query: 69  CGYCNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDM 128
           C YC QS H+ + L   ++++VD+++++AK A+  GA+R+CMGAAWR PK +D++++ ++
Sbjct: 73  CAYCPQSAHHNTNLGKEQMMDVDEIVEKAKIAQSRGASRFCMGAAWRGPKPKDVAVVSEI 132

Query: 129 IKGVKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQT 188
           I  VK LG+E C T GML    A+   KAGLDYYNHN+DT    Y  +  T   EDR+ T
Sbjct: 133 ISAVKGLGMEVCGTFGMLEDGMAEDFKKAGLDYYNHNLDTDPERYNDIIHTRKHEDRMDT 192

Query: 189 LENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENK 248
           L  VR +G+KVCCGGI+G+ E   +R  ++ +LANL   PES+PIN L+ + G+   + +
Sbjct: 193 LGKVRNAGLKVCCGGIVGMNETRAERAGLIASLANLDPQPESVPINQLVKVEGTPLADAE 252

Query: 249 KVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNP 308
            +D  E VR I+VARI MP S +RL+AGR+ M + +QA+CF +GANSIF GD LLT  NP
Sbjct: 253 DLDWTEFVRTIAVARITMPHSYVRLSAGRSNMPESMQAMCFMAGANSIFYGDKLLTTGNP 312

Query: 309 SYNKDTILFNRLGLIP 324
             + D +L  +L L P
Sbjct: 313 DEDGDRLLMEKLNLYP 328


>gi|315055955|ref|XP_003177352.1| biotin synthase [Arthroderma gypseum CBS 118893]
 gi|311339198|gb|EFQ98400.1| biotin synthase [Arthroderma gypseum CBS 118893]
          Length = 402

 Score =  295 bits (754), Expect = 7e-78,   Method: Composition-based stats.
 Identities = 148/325 (45%), Positives = 213/325 (65%), Gaps = 2/325 (0%)

Query: 5   TVVPEENPTKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGG 64
            +      +     WT +E+ QIY  P N L F +  VHR   +P  IQ+  L+NIKTGG
Sbjct: 46  ALQDAIAASAPRTSWTREEITQIYRTPLNQLTFAAAAVHRNFHDPAAIQMCTLMNIKTGG 105

Query: 65  CPENCGYCNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKER--DL 122
           C E+C YC+QS    + LKA+KL  VD VL+ A+ AKENG+TR+CMGAAWR+ + R  +L
Sbjct: 106 CSEDCSYCSQSSRYNTGLKATKLSTVDSVLEAARIAKENGSTRFCMGAAWRDMRGRKSNL 165

Query: 123 SIIVDMIKGVKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTF 182
             I  M+ GV+ +G+E C+TLGM+  EQA+ L +AGL  YNHN+DTS  FYP + TT ++
Sbjct: 166 KNIKAMVSGVREMGMEVCVTLGMIDGEQAKELKEAGLTAYNHNVDTSREFYPSIITTRSY 225

Query: 183 EDRLQTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGS 242
           ++R+QTL +VR +GI VC GGILGLGE   DR+ ++ T+A L   PES P+N L+PI G+
Sbjct: 226 DERIQTLSHVRDAGINVCSGGILGLGEEDSDRVGLIHTVATLPAHPESFPVNALVPIKGT 285

Query: 243 KFEENKKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTL 302
                K ++  + +R ++ ARI++P + +RLAAGR  +++E Q  CF SGAN+IF G+ +
Sbjct: 286 PLGNRKMIEFDKLLRTVATARIVLPATIVRLAAGRISLTEEQQVTCFMSGANAIFTGERM 345

Query: 303 LTAKNPSYNKDTILFNRLGLIPDLS 327
           LT     +++D  +F++ G  P  S
Sbjct: 346 LTTDCTGWDEDKKMFDKWGYYPMKS 370


>gi|120611187|ref|YP_970865.1| biotin synthase [Acidovorax citrulli AAC00-1]
 gi|254810529|sp|A1TQ53|BIOB_ACIAC RecName: Full=Biotin synthase
 gi|120589651|gb|ABM33091.1| biotin synthase [Acidovorax citrulli AAC00-1]
          Length = 354

 Score =  295 bits (754), Expect = 8e-78,   Method: Composition-based stats.
 Identities = 154/316 (48%), Positives = 221/316 (69%)

Query: 8   PEENPTKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPE 67
           P   P      W+ + V ++ ++PF +LL+ + +VHR+++    ++L+ LL++KTGGCPE
Sbjct: 22  PARTPAPAAGTWSVQAVQELLDLPFMELLWRAQSVHREHWPAGDVELATLLSVKTGGCPE 81

Query: 68  NCGYCNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVD 127
           NCGYC QS    + +KA KL++VD+V   A+ A++ GATR+CMGAAWR PK+RD+  + +
Sbjct: 82  NCGYCPQSAEFDTGVKAQKLMSVDEVTTAARAARDAGATRFCMGAAWRAPKDRDIEKVGE 141

Query: 128 MIKGVKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQ 187
           +I  VK LG++TC TLGML   QAQ L  AGLDYYNHN+DT+  +Y  V +T  +++RL 
Sbjct: 142 LIAAVKGLGMQTCATLGMLEPHQAQALKGAGLDYYNHNLDTAPEYYTDVVSTRAYQERLD 201

Query: 188 TLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEEN 247
           TL +VR++GI VCCGGI+G+GE    R  ++  LANL   PES+PIN L+ +PG+   ++
Sbjct: 202 TLRHVREAGISVCCGGIIGMGEAPVHRAGLIAQLANLDPYPESVPINSLVRVPGTPLADS 261

Query: 248 KKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKN 307
             VDP++ VR+I+VARI MP++R+RL+AGR  M D +QALCF +GANSIF GD LL   N
Sbjct: 262 DPVDPLDFVRVIAVARITMPRARVRLSAGRQQMGDAVQALCFLAGANSIFYGDKLLVTGN 321

Query: 308 PSYNKDTILFNRLGLI 323
           P  + D  L  +LG+ 
Sbjct: 322 PDVDADVQLLAKLGMN 337


>gi|171677125|ref|XP_001903514.1| hypothetical protein [Podospora anserina S mat+]
 gi|170936630|emb|CAP61289.1| unnamed protein product [Podospora anserina S mat+]
          Length = 410

 Score =  295 bits (754), Expect = 8e-78,   Method: Composition-based stats.
 Identities = 147/330 (44%), Positives = 216/330 (65%), Gaps = 4/330 (1%)

Query: 2   SRSTVVPEENPTKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIK 61
           +R  +            W+ +E   IY+ P  +L F +  VHR+   P+ +QL  L+NIK
Sbjct: 72  ARQVLRDAVAAAAPRYTWSKEETAAIYHQPLMELAFQAAQVHRRFHNPSEVQLCTLMNIK 131

Query: 62  TGGCPENCGYCNQSVHNK--SKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKE 119
           TGGC E+C YC QS   +  + L+A ++  V+ VL+ A+ AK NG+TR+CMGAAWR+ + 
Sbjct: 132 TGGCSEDCSYCAQSTRYQKGTGLQAKRVETVETVLEAARIAKANGSTRFCMGAAWRDMRG 191

Query: 120 RD--LSIIVDMIKGVKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVT 177
           R+  L  + +M+ GV+++G+E C+TLGM+  EQA+ L +AGL  YNHN+DTS  FYP + 
Sbjct: 192 RNNSLRNVKEMVSGVRAMGMEVCVTLGMIDAEQAKELREAGLTAYNHNLDTSREFYPSII 251

Query: 178 TTHTFEDRLQTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLI 237
           +T T+++RL TL +VR +GI VC GGILGLGE   DRI +L T A L + PES P+N L+
Sbjct: 252 STRTYDERLATLGHVRDAGINVCSGGILGLGETDKDRIGLLHTAATLPSHPESFPVNALV 311

Query: 238 PIPGSKFEENKKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIF 297
           PI G+   + K +D    +R I+ ARI+MP + +R+AAGR  M++E QA+CF +GAN++F
Sbjct: 312 PIKGTPLGDRKPIDFTSMLRTIAAARIIMPATIIRIAAGRKTMTEEQQAMCFMAGANAVF 371

Query: 298 VGDTLLTAKNPSYNKDTILFNRLGLIPDLS 327
            G+ +LT +   ++ D +LF R GL P  S
Sbjct: 372 TGEKMLTTECNGWDDDAVLFERWGLQPMKS 401


>gi|294678879|ref|YP_003579494.1| biotin synthase [Rhodobacter capsulatus SB 1003]
 gi|294477699|gb|ADE87087.1| biotin synthase [Rhodobacter capsulatus SB 1003]
          Length = 315

 Score =  295 bits (754), Expect = 8e-78,   Method: Composition-based stats.
 Identities = 186/302 (61%), Positives = 235/302 (77%)

Query: 24  VFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQSVHNKSKLK 83
              +Y +P  DLLF + +VHR+NF+PN IQ +KLL+IKTGGC E+C YC QS  N + L 
Sbjct: 5   AQDLYTLPLMDLLFRAQSVHRQNFDPNRIQCAKLLSIKTGGCGEDCAYCAQSRRNGATLP 64

Query: 84  ASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLGLETCMTL 143
           A+KL+ V +VL EA+ AKE GATRYCMGAAWR PK+RD+  ++ M++GVK+LGLETCMTL
Sbjct: 65  AAKLLEVQKVLAEAQKAKEAGATRYCMGAAWRSPKDRDMPAVLAMVEGVKALGLETCMTL 124

Query: 144 GMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSGIKVCCGG 203
           GML   Q + L  AGLDYYNHNIDTSERFYP V +TH+F DRL+TL+ VR +GI VC GG
Sbjct: 125 GMLDDRQVRQLKAAGLDYYNHNIDTSERFYPSVISTHSFADRLETLDRVRAAGINVCSGG 184

Query: 204 ILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEHVRIISVAR 263
           I+G+GE  DDRI M+ TLA+L  PP+S+PIN+L+P+  +   +   +DPIE VR I+ AR
Sbjct: 185 IVGMGETADDRISMIQTLADLPEPPQSVPINMLMPMADTPLADAAPLDPIEMVRTIATAR 244

Query: 264 ILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTILFNRLGLI 323
           ILMPKS +RL+AGR+ MSDELQA+CFF+GANSIFVGDTLLTA+NP  + D  LF +LGL 
Sbjct: 245 ILMPKSYVRLSAGRSAMSDELQAMCFFAGANSIFVGDTLLTAENPDDSADARLFAKLGLR 304

Query: 324 PD 325
           P+
Sbjct: 305 PE 306


>gi|311086028|gb|ADP66110.1| biotin synthetase [Buchnera aphidicola str. LL01 (Acyrthosiphon
           pisum)]
          Length = 322

 Score =  295 bits (754), Expect = 8e-78,   Method: Composition-based stats.
 Identities = 159/290 (54%), Positives = 219/290 (75%)

Query: 36  LFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQSVHNKSKLKASKLINVDQVLK 95
           +F +   HRKNF+PN IQ+S LL+IKTG CPE+C YC QS   K+ LK   L+ ++Q+L 
Sbjct: 1   MFQAQEEHRKNFDPNTIQISTLLSIKTGSCPEDCKYCPQSSRYKTGLKKEPLLEIEQILS 60

Query: 96  EAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLGLETCMTLGMLSFEQAQILS 155
            AK AK++G++R+CMGAAW+ PKE+D+  +  +IK +K +G+ETCMTLG L+  QA+ L+
Sbjct: 61  AAKKAKDSGSSRFCMGAAWKNPKEKDMPYLEKIIKKIKEMGMETCMTLGTLNSTQAKKLA 120

Query: 156 KAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSGIKVCCGGILGLGEMIDDRI 215
            AGLD+YNHN+DTS+ FY ++ TT T+++RL TL  VR SG+KVC GGI+GLGE   DRI
Sbjct: 121 DAGLDFYNHNLDTSKNFYSNIITTRTYQERLHTLHAVRSSGMKVCSGGIIGLGEKKQDRI 180

Query: 216 DMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEHVRIISVARILMPKSRLRLAA 275
           ++L+ L+NLS  PES+PIN+L+ IPG+   +NK V+P + +RII+VARI+MPKS +RL+A
Sbjct: 181 ELLMELSNLSIQPESVPINMLVKIPGTPMADNKDVEPFDFIRIIAVARIMMPKSYIRLSA 240

Query: 276 GRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTILFNRLGLIPD 325
           GR  M+D+ QA+CF +GANSIF G  LLT+ NP    D  LF +L LIP+
Sbjct: 241 GRHKMNDQTQAMCFMAGANSIFYGCKLLTSDNPEEKHDLELFKKLDLIPE 290


>gi|114324485|gb|ABI63585.1| biotin synthase [Brassica rapa subsp. pekinensis]
          Length = 375

 Score =  295 bits (754), Expect = 8e-78,   Method: Composition-based stats.
 Identities = 150/312 (48%), Positives = 209/312 (66%), Gaps = 2/312 (0%)

Query: 15  KPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQ 74
               W+  E+  +Y+ P  DLLF    VHR       +Q   LL+IKTGGC E+C YC Q
Sbjct: 42  PRNDWSKDEIKAVYDSPVLDLLFHGAQVHRHVHNFREVQQCTLLSIKTGGCSEDCSYCPQ 101

Query: 75  SVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKER--DLSIIVDMIKGV 132
           S    + +KA +L++ D V+  AK AKE G+TR+CMGAAWR+   R  + + I++ IK +
Sbjct: 102 SSRYDTGVKAQRLMSKDAVIVAAKKAKEAGSTRFCMGAAWRDTIGRKTNFNQILEYIKEI 161

Query: 133 KSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENV 192
           + +G+E C TLGM+  +QA  L KAGL  YNHN+DTS  +YP+V TT ++++RL+TLE+V
Sbjct: 162 RGMGMEVCCTLGMIEKQQALELKKAGLTAYNHNLDTSREYYPNVITTRSYDERLETLEHV 221

Query: 193 RKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDP 252
           R +GI VC GGI+GLGE  +DR+ +L TLA L + PES+PIN L+ + G+  E+ K V+ 
Sbjct: 222 RDAGINVCSGGIIGLGEAEEDRVGLLHTLATLPSHPESVPINALLAVKGTPLEDQKPVEI 281

Query: 253 IEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNK 312
            E +R+I  ARI+MPK+ +RL+AGR   S   QALCF +GANSIF G+ LLT  N  ++ 
Sbjct: 282 WEMIRMIGTARIVMPKAMVRLSAGRVRFSMPEQALCFLAGANSIFTGEKLLTTPNNDFDA 341

Query: 313 DTILFNRLGLIP 324
           D ++F  LGLIP
Sbjct: 342 DQLMFKTLGLIP 353


>gi|254811615|sp|A9EXH2|BIOB_SORC5 RecName: Full=Biotin synthase
          Length = 349

 Score =  295 bits (754), Expect = 8e-78,   Method: Composition-based stats.
 Identities = 150/313 (47%), Positives = 216/313 (69%), Gaps = 1/313 (0%)

Query: 14  KKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCN 73
                WT ++   ++++P  +L+  +  VHR     + +QL  LL++KTGGCPE+C YC 
Sbjct: 28  APRHDWTVQQAVALHDLPLFELIDRARAVHRAFHGEHEVQLCTLLSVKTGGCPEDCAYCP 87

Query: 74  QSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERD-LSIIVDMIKGV 132
           QS H ++++   ++++V  VL  A+ A+E G+TR+CMGAAWRE K+      ++DM++GV
Sbjct: 88  QSSHYETEVGPERMLDVGAVLAAAERAREGGSTRFCMGAAWREVKDGPAFERVLDMVRGV 147

Query: 133 KSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENV 192
           K+LGLE C TLGML+ +QA+ L +AGLD YNHN+DTS + Y  + +T T+++RL TL NV
Sbjct: 148 KALGLEACCTLGMLTDDQARRLKEAGLDAYNHNLDTSRKAYKSIISTRTYDERLVTLRNV 207

Query: 193 RKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDP 252
           R++GI VC GGI+G+GE I DR +ML+ LA L   PES+PIN L+  PG+  E    VDP
Sbjct: 208 RRAGITVCSGGIIGMGESIADRCEMLVELARLDPHPESVPINALVRSPGTPLESLPPVDP 267

Query: 253 IEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNK 312
           IE VR+I+VAR++MP++ +RL+AGR  +S E Q LC ++GANSIF GD LLT  NP  ++
Sbjct: 268 IEFVRMIAVARVMMPRAMVRLSAGRTELSRETQLLCMYAGANSIFYGDRLLTTPNPGQDE 327

Query: 313 DTILFNRLGLIPD 325
           D  L  + GL P 
Sbjct: 328 DRALIEKAGLQPM 340


>gi|261205248|ref|XP_002627361.1| biotin synthase [Ajellomyces dermatitidis SLH14081]
 gi|239592420|gb|EEQ75001.1| biotin synthase [Ajellomyces dermatitidis SLH14081]
 gi|239611421|gb|EEQ88408.1| biotin synthase [Ajellomyces dermatitidis ER-3]
          Length = 378

 Score =  295 bits (754), Expect = 8e-78,   Method: Composition-based stats.
 Identities = 151/327 (46%), Positives = 217/327 (66%), Gaps = 3/327 (0%)

Query: 2   SRSTVVPEENPTKKPK-VWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNI 60
           S STV+ +    + P+  WT  E+ QIY  P + L   + TVHR+  +P+ IQL  L+NI
Sbjct: 36  STSTVLQDAIAAEAPRINWTRDEIRQIYETPLHQLTHAAATVHRRFHDPSAIQLCTLMNI 95

Query: 61  KTGGCPENCGYCNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKER 120
           K GGC E+C YC+QS    + LKA+K+ +VD VL+ A+ AKENG+TR+C+GAAWR+ + R
Sbjct: 96  KVGGCSEDCSYCSQSSRYDTGLKATKMSSVDAVLEAARIAKENGSTRFCLGAAWRDMRGR 155

Query: 121 --DLSIIVDMIKGVKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTT 178
              L  +  MI GV+ L +E C+TLGM+  EQA+ L +AGL  YNHN+DTS  FYP + +
Sbjct: 156 KSSLRNVKQMISGVRKLDMEVCVTLGMIDGEQAKELKEAGLTAYNHNVDTSREFYPSIIS 215

Query: 179 THTFEDRLQTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIP 238
           T T+++RLQTL +VR +GI VC GGILGLGE   DR+ +L T A L   PES P+N L+P
Sbjct: 216 TRTYDERLQTLSHVRDAGINVCSGGILGLGEEDSDRVGLLHTAATLPAHPESFPVNALVP 275

Query: 239 IPGSKFEENKKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFV 298
           I G+   + K ++  + +R ++ ARI++PK+ +RL+AGR  M++E Q  CF +GANS+F 
Sbjct: 276 IKGTPLGDRKPIEFDKLLRTVATARIILPKTTVRLSAGRINMTEEQQVACFMAGANSVFT 335

Query: 299 GDTLLTAKNPSYNKDTILFNRLGLIPD 325
           G+ +LT     + +D  +F + G  P 
Sbjct: 336 GEKMLTTDCSGWEEDKKMFEKWGFYPM 362


>gi|58269052|ref|XP_571682.1| biotin synthase [Cryptococcus neoformans var. neoformans JEC21]
 gi|134112758|ref|XP_774922.1| hypothetical protein CNBF0870 [Cryptococcus neoformans var.
           neoformans B-3501A]
 gi|50257570|gb|EAL20275.1| hypothetical protein CNBF0870 [Cryptococcus neoformans var.
           neoformans B-3501A]
 gi|57227917|gb|AAW44375.1| biotin synthase, putative [Cryptococcus neoformans var. neoformans
           JEC21]
          Length = 388

 Score =  295 bits (754), Expect = 9e-78,   Method: Composition-based stats.
 Identities = 141/310 (45%), Positives = 210/310 (67%), Gaps = 2/310 (0%)

Query: 16  PKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQS 75
              W   E+ ++++ P  ++++ + TVHR + + + IQL  L+NIKTGGC ENC YC+QS
Sbjct: 51  RHDWRRSEIQKVFDAPLMEIIYRAATVHRLHQDASRIQLCTLMNIKTGGCTENCKYCSQS 110

Query: 76  VHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKER--DLSIIVDMIKGVK 133
              K+  KAS+L++++ VL+ A+ AK NG+TR+CMGAAWR+   R      I++M+K V+
Sbjct: 111 SSYKTPTKASRLVSIEPVLEAARQAKANGSTRFCMGAAWRDLAGRKSGFEKILEMVKEVR 170

Query: 134 SLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVR 193
            +G+E C TLGMLS EQA  L +AGL  YNHN+DTS  FYP V T+ +++DRL T+  VR
Sbjct: 171 GMGMEVCTTLGMLSPEQAIRLKEAGLSAYNHNLDTSREFYPEVVTSRSYDDRLSTIAAVR 230

Query: 194 KSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPI 253
           ++GI VC GGILGLGE  +DR+ ++  ++ +   PES P+N L+PIPG+  E N+ V   
Sbjct: 231 EAGISVCSGGILGLGERDEDRVGLIHEVSRMPEHPESFPVNTLVPIPGTPLEGNEPVKVH 290

Query: 254 EHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKD 313
             +R I+ ARI++PK+ +RLAAGR   S+  QA+ F +GAN+IF G+ +LT     +++D
Sbjct: 291 TVLRTIATARIVLPKTIIRLAAGRHEFSETEQAMAFMAGANAIFTGEKMLTTPCSGWDED 350

Query: 314 TILFNRLGLI 323
             + +R GL 
Sbjct: 351 KAMLDRWGLR 360


>gi|261392541|emb|CAX50096.1| biotin synthase (biotin synthetase) [Neisseria meningitidis 8013]
          Length = 350

 Score =  294 bits (753), Expect = 9e-78,   Method: Composition-based stats.
 Identities = 151/314 (48%), Positives = 213/314 (67%)

Query: 11  NPTKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCG 70
            P    + W   +V  ++ +PF DL++ +  +HR+NF P  IQLS LL+IKTGGCPE+C 
Sbjct: 15  KPHPTARYWKKCDVEALFGLPFLDLIYQAAEIHRQNFNPREIQLSTLLSIKTGGCPEDCA 74

Query: 71  YCNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIK 130
           YC QS H+ + L   ++++VD+++++AK AK  GA+R+CMGAAWR PK +D+  +  +IK
Sbjct: 75  YCPQSAHHNTNLGKEQMMDVDEIVEKAKIAKSRGASRFCMGAAWRGPKPKDVETVSAIIK 134

Query: 131 GVKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLE 190
            VK LG+ETC T GML    A+ L +AGLDYYNHN+DT    Y  +  T   EDR+ TL 
Sbjct: 135 AVKGLGMETCGTFGMLEEGMAEDLKEAGLDYYNHNLDTDPDRYNDIIHTRRHEDRMDTLG 194

Query: 191 NVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKV 250
            VR +G+KVCCGGI+G+ E   +R  ++ +LANL   PES+PIN L+ + G+  ++ + +
Sbjct: 195 KVRNAGLKVCCGGIVGMNETRAERAGLIASLANLDPQPESVPINRLVKVKGTPLDDAEDL 254

Query: 251 DPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSY 310
           D  E VR I+VARI MP+S +RL+AGR+ M + +QA+CF +GANSIF GD LLT  NP  
Sbjct: 255 DWTEFVRTIAVARITMPQSYVRLSAGRSNMPEAMQAMCFMAGANSIFYGDKLLTTGNPDE 314

Query: 311 NKDTILFNRLGLIP 324
           + D IL  +L L P
Sbjct: 315 DGDRILMEKLNLYP 328


>gi|67540946|ref|XP_664247.1| hypothetical protein AN6643.2 [Aspergillus nidulans FGSC A4]
 gi|40738982|gb|EAA58172.1| hypothetical protein AN6643.2 [Aspergillus nidulans FGSC A4]
 gi|238556155|gb|ACR44940.1| biotin synthase [Emericella nidulans]
 gi|238556160|gb|ACR44944.1| biotin synthase [Emericella nidulans]
 gi|259480224|tpe|CBF71159.1| TPA: biotin synthase (Eurofung) [Aspergillus nidulans FGSC A4]
          Length = 393

 Score =  294 bits (753), Expect = 9e-78,   Method: Composition-based stats.
 Identities = 144/325 (44%), Positives = 213/325 (65%), Gaps = 2/325 (0%)

Query: 5   TVVPEENPTKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGG 64
            +      T     WT  EV QIY  P N L + +  VHR+  +P+ IQ+  L+NIKTGG
Sbjct: 36  ALQEAVAATAPRTNWTRDEVQQIYETPLNQLTYAAAAVHRRFHDPSAIQMCTLMNIKTGG 95

Query: 65  CPENCGYCNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKER--DL 122
           C E+C YC QS    + LKA+K+  VD VL++A+ AK NG+TR+CMGAAWR+ + R   L
Sbjct: 96  CSEDCSYCAQSSRYSTGLKATKMSPVDDVLEKARIAKANGSTRFCMGAAWRDMRGRKTSL 155

Query: 123 SIIVDMIKGVKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTF 182
             +  M+ GV+ +G+E C+TLGM+  +QA+ L  AGL  YNHN+DTS  FYP + TT ++
Sbjct: 156 KNVKQMVSGVREMGMEVCVTLGMIDADQAKELKDAGLTAYNHNLDTSREFYPTIITTRSY 215

Query: 183 EDRLQTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGS 242
           ++RL+TL +VR +GI VC GGILGLGE   DRI ++ T+++L + PES P+N L+PI G+
Sbjct: 216 DERLKTLSHVRDAGINVCSGGILGLGEADSDRIGLIHTVSSLPSHPESFPVNALVPIKGT 275

Query: 243 KFEENKKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTL 302
              + K +   + +R ++ ARI++P + +RLAAGR  +++E Q  CF +GAN++F G+ +
Sbjct: 276 PLGDRKMISFDKLLRTVATARIVLPATIVRLAAGRISLTEEQQVACFMAGANAVFTGEKM 335

Query: 303 LTAKNPSYNKDTILFNRLGLIPDLS 327
           LT     +++D  +F+R G  P  S
Sbjct: 336 LTTDCNGWDEDRAMFDRWGFYPMRS 360


>gi|297828031|ref|XP_002881898.1| hypothetical protein ARALYDRAFT_903720 [Arabidopsis lyrata subsp.
           lyrata]
 gi|297327737|gb|EFH58157.1| hypothetical protein ARALYDRAFT_903720 [Arabidopsis lyrata subsp.
           lyrata]
          Length = 377

 Score =  294 bits (753), Expect = 1e-77,   Method: Composition-based stats.
 Identities = 151/312 (48%), Positives = 209/312 (66%), Gaps = 2/312 (0%)

Query: 15  KPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQ 74
               W+  E+  +Y+ P  DLLF    VHR       +Q   LL+IKTGGC E+C YC Q
Sbjct: 43  PRNDWSKDEIKSVYDSPVLDLLFHGAQVHRHVHNFREVQQCTLLSIKTGGCSEDCSYCPQ 102

Query: 75  SVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKER--DLSIIVDMIKGV 132
           S    + +KA +L++ D V+  AK AKE G+TR+CMGAAWR+   R  + + I++ IK +
Sbjct: 103 SSRYSTGVKAQRLMSKDAVIDAAKKAKEAGSTRFCMGAAWRDTIGRKTNFNQILEYIKEI 162

Query: 133 KSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENV 192
           + +G+E C TLGM+  +QA  L KAGL  YNHN+DTS  +YP+V TT +++DRL+TLE+V
Sbjct: 163 RGMGMEVCCTLGMIEKQQALELKKAGLTAYNHNLDTSREYYPNVITTRSYDDRLETLEHV 222

Query: 193 RKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDP 252
           R++GI VC GGI+GLGE  +DR+ +L TLA L   PES+PIN L+ + G+  E+ K V+ 
Sbjct: 223 REAGINVCSGGIIGLGEAEEDRVGLLHTLATLPMHPESVPINALLAVKGTPLEDQKPVEI 282

Query: 253 IEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNK 312
            E +R+I  ARI+MPK+ +RL+AGR   S   QALCF +GANSIF G+ LLT  N  ++ 
Sbjct: 283 WEMIRMIGTARIVMPKAMVRLSAGRVRFSMAEQALCFLAGANSIFTGEKLLTTPNNDFDA 342

Query: 313 DTILFNRLGLIP 324
           D ++F  LGLIP
Sbjct: 343 DQLMFKTLGLIP 354


>gi|15677022|ref|NP_274174.1| biotin synthetase [Neisseria meningitidis MC58]
 gi|15677058|ref|NP_274210.1| biotin synthetase [Neisseria meningitidis MC58]
 gi|81783945|sp|Q9JRW7|BIOB_NEIMB RecName: Full=Biotin synthase
 gi|7226383|gb|AAF41533.1| biotin synthetase [Neisseria meningitidis MC58]
 gi|7226421|gb|AAF41568.1| biotin synthetase [Neisseria meningitidis MC58]
 gi|325128262|gb|EGC51147.1| biotin synthase [Neisseria meningitidis N1568]
 gi|325200177|gb|ADY95632.1| biotin synthase [Neisseria meningitidis H44/76]
 gi|325202110|gb|ADY97564.1| biotin synthase [Neisseria meningitidis M01-240149]
 gi|325208136|gb|ADZ03588.1| biotin synthase [Neisseria meningitidis NZ-05/33]
          Length = 350

 Score =  294 bits (753), Expect = 1e-77,   Method: Composition-based stats.
 Identities = 151/314 (48%), Positives = 212/314 (67%)

Query: 11  NPTKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCG 70
            P    + W   +V  ++ +PF DL++ +  +HR+NF P  IQLS LL+IKTGGCPE+C 
Sbjct: 15  KPHPTARYWKKCDVEALFGLPFLDLIYQAAEIHRQNFNPREIQLSTLLSIKTGGCPEDCA 74

Query: 71  YCNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIK 130
           YC QS H+ + L   ++++VD+++++AK AK  GA+R+CMGAAWR PK +D+  +  +IK
Sbjct: 75  YCPQSAHHNTNLGKEQMMDVDEIVEKAKIAKSRGASRFCMGAAWRGPKPKDVETVSAIIK 134

Query: 131 GVKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLE 190
            VK LG+ETC T GML    A+ L +AGLDYYNHN+DT    Y  +  T   EDR+ TL 
Sbjct: 135 AVKGLGMETCGTFGMLEEGMAEDLKEAGLDYYNHNLDTDPDRYNDIIHTRQHEDRMDTLG 194

Query: 191 NVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKV 250
            VR +G+KVCCGGI+G+ E   +R  ++ +LANL   PES+PIN L+ + G+   + + +
Sbjct: 195 KVRNAGLKVCCGGIVGMNETRAERAGLIASLANLDPQPESVPINRLVKVEGTPLADAEDL 254

Query: 251 DPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSY 310
           D  E VR I+VARI MP+S +RL+AGR+ M + +QA+CF +GANSIF GD LLT  NP  
Sbjct: 255 DWTEFVRTIAVARITMPQSYVRLSAGRSNMPEAMQAMCFMAGANSIFYGDKLLTTGNPDE 314

Query: 311 NKDTILFNRLGLIP 324
           + D IL  +L L P
Sbjct: 315 DGDRILMEKLNLYP 328


>gi|162452523|ref|YP_001614890.1| biotin synthase [Sorangium cellulosum 'So ce 56']
 gi|161163105|emb|CAN94410.1| Biotin synthase [Sorangium cellulosum 'So ce 56']
          Length = 353

 Score =  294 bits (753), Expect = 1e-77,   Method: Composition-based stats.
 Identities = 150/313 (47%), Positives = 216/313 (69%), Gaps = 1/313 (0%)

Query: 14  KKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCN 73
                WT ++   ++++P  +L+  +  VHR     + +QL  LL++KTGGCPE+C YC 
Sbjct: 32  APRHDWTVQQAVALHDLPLFELIDRARAVHRAFHGEHEVQLCTLLSVKTGGCPEDCAYCP 91

Query: 74  QSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERD-LSIIVDMIKGV 132
           QS H ++++   ++++V  VL  A+ A+E G+TR+CMGAAWRE K+      ++DM++GV
Sbjct: 92  QSSHYETEVGPERMLDVGAVLAAAERAREGGSTRFCMGAAWREVKDGPAFERVLDMVRGV 151

Query: 133 KSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENV 192
           K+LGLE C TLGML+ +QA+ L +AGLD YNHN+DTS + Y  + +T T+++RL TL NV
Sbjct: 152 KALGLEACCTLGMLTDDQARRLKEAGLDAYNHNLDTSRKAYKSIISTRTYDERLVTLRNV 211

Query: 193 RKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDP 252
           R++GI VC GGI+G+GE I DR +ML+ LA L   PES+PIN L+  PG+  E    VDP
Sbjct: 212 RRAGITVCSGGIIGMGESIADRCEMLVELARLDPHPESVPINALVRSPGTPLESLPPVDP 271

Query: 253 IEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNK 312
           IE VR+I+VAR++MP++ +RL+AGR  +S E Q LC ++GANSIF GD LLT  NP  ++
Sbjct: 272 IEFVRMIAVARVMMPRAMVRLSAGRTELSRETQLLCMYAGANSIFYGDRLLTTPNPGQDE 331

Query: 313 DTILFNRLGLIPD 325
           D  L  + GL P 
Sbjct: 332 DRALIEKAGLQPM 344


>gi|302499447|ref|XP_003011719.1| hypothetical protein ARB_01947 [Arthroderma benhamiae CBS 112371]
 gi|291175272|gb|EFE31079.1| hypothetical protein ARB_01947 [Arthroderma benhamiae CBS 112371]
          Length = 407

 Score =  294 bits (753), Expect = 1e-77,   Method: Composition-based stats.
 Identities = 149/326 (45%), Positives = 216/326 (66%), Gaps = 2/326 (0%)

Query: 4   STVVPEENPTKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTG 63
           + +      +     WT +E+ QIY  P N L F +  VHR   +P  IQ+  L+NIKTG
Sbjct: 50  AALQDAIAASAPRTSWTREEITQIYQTPLNQLTFAAAAVHRNFHDPAAIQMCTLMNIKTG 109

Query: 64  GCPENCGYCNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKER--D 121
           GC E+C YC+QS    + LKA+KLI+VD VL+ A+ AKENG+TR+CMGAAWR+ + R  +
Sbjct: 110 GCSEDCSYCSQSSRYDTGLKATKLISVDSVLEAARIAKENGSTRFCMGAAWRDMRGRKSN 169

Query: 122 LSIIVDMIKGVKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHT 181
           L  I  M+ GV+ +G+E C+TLGM+  EQA+ L +AGL  YNHN+DTS  FYP + TT +
Sbjct: 170 LKNIKAMVSGVREMGMEVCVTLGMIDGEQAKELKEAGLTAYNHNVDTSREFYPSIITTRS 229

Query: 182 FEDRLQTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPG 241
           +++R+QTL +VR +GI VC GGILGLGE   DR+ ++ T+A L   PES P+N L+PI G
Sbjct: 230 YDERIQTLGHVRDAGINVCSGGILGLGEEDSDRVGLIHTVATLPAHPESFPVNALVPIKG 289

Query: 242 SKFEENKKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDT 301
           +     K ++  + +R ++ ARI++P + +RLAAGR  +++E Q  CF SGAN+IF G+ 
Sbjct: 290 TPLGNRKMIEFDKLLRTVATARIVLPATIVRLAAGRISLTEEQQVTCFMSGANAIFTGER 349

Query: 302 LLTAKNPSYNKDTILFNRLGLIPDLS 327
           +LT     +++D  +F++ G  P  S
Sbjct: 350 MLTTDCTGWDEDKKMFDKWGYYPMKS 375


>gi|116204433|ref|XP_001228027.1| hypothetical protein CHGG_10100 [Chaetomium globosum CBS 148.51]
 gi|88176228|gb|EAQ83696.1| hypothetical protein CHGG_10100 [Chaetomium globosum CBS 148.51]
          Length = 404

 Score =  294 bits (753), Expect = 1e-77,   Method: Composition-based stats.
 Identities = 147/330 (44%), Positives = 221/330 (66%), Gaps = 4/330 (1%)

Query: 2   SRSTVVPEENPTKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIK 61
           SR  +      T     WT +E+  I+  P  +L + + TVHR+   P+ +QL  L+NIK
Sbjct: 59  SRQILQNAVAATAPRHDWTREEISAIFYQPLMELAYQAATVHRRFHNPSEVQLCTLMNIK 118

Query: 62  TGGCPENCGYCNQSVHNK--SKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKE 119
           TGGC E+C YC QS   +  + L+A ++  V+ VL+ A+ AKENG+TR+CMGAAWR+ + 
Sbjct: 119 TGGCTEDCSYCAQSTRYQKGTGLEAKRVETVESVLEAARIAKENGSTRFCMGAAWRDMRG 178

Query: 120 R--DLSIIVDMIKGVKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVT 177
           R   L  I DM+ GV+++G+E+C+TLGM+  EQA+ L +AGL  YNHN+DTS  FYP V 
Sbjct: 179 RKNSLRNIKDMVAGVRAMGMESCVTLGMIDAEQAKELKEAGLTAYNHNVDTSREFYPSVI 238

Query: 178 TTHTFEDRLQTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLI 237
           +T ++++RL+TL +VR +GI VC GGILGLGE  +DR+ +L T++ L + PES P+N L+
Sbjct: 239 STRSYDERLKTLGHVRDAGINVCSGGILGLGETSEDRVGLLHTVSTLPSHPESFPVNALV 298

Query: 238 PIPGSKFEENKKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIF 297
           PI G+   +   ++    +R I+ ARI+MP + +R+AAGR  M+++ QA+CF +GAN+IF
Sbjct: 299 PIKGTPLGDRPPIEFTSMLRTIAAARIIMPATIIRIAAGRKTMAEDQQAMCFMAGANAIF 358

Query: 298 VGDTLLTAKNPSYNKDTILFNRLGLIPDLS 327
            G+ +LT +   +++D  +F R GL P  S
Sbjct: 359 TGEKMLTTECNGWDEDAAMFGRWGLQPMKS 388


>gi|225679106|gb|EEH17390.1| biotin synthase [Paracoccidioides brasiliensis Pb03]
          Length = 464

 Score =  294 bits (753), Expect = 1e-77,   Method: Composition-based stats.
 Identities = 144/311 (46%), Positives = 212/311 (68%), Gaps = 2/311 (0%)

Query: 19  WTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQSVHN 78
           WT  E+ QIY++P + L + +  VHR+  +P+ IQL  L+NIK GGC E+C YC+QS   
Sbjct: 134 WTRDEIRQIYDIPLHQLTYAAAVVHRRFHDPSAIQLCTLMNIKVGGCTEDCSYCSQSSRY 193

Query: 79  KSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKER--DLSIIVDMIKGVKSLG 136
            + LKA+K+  VD VL+ A+ AKENG+TR+C+GAAWR+ + R   L  + +MI GV+ L 
Sbjct: 194 NTGLKATKMSTVDSVLEAARIAKENGSTRFCLGAAWRDMRGRKTSLRNVKEMISGVRKLD 253

Query: 137 LETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSG 196
           +E C+TLGM+  +QA+ L +AGL  YNHN+DTS  FYP + TT ++++RLQTL +VR++G
Sbjct: 254 MEVCVTLGMIDGDQARELKEAGLTAYNHNVDTSREFYPSIITTRSYDERLQTLSHVREAG 313

Query: 197 IKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEHV 256
           I VC GGILGLGE   DR+ +L T A L   PES P+N L+PI G+   + K ++  + +
Sbjct: 314 INVCSGGILGLGEEDSDRVGLLHTAATLPAHPESFPVNALVPIKGTPLGDRKPIEFDKLL 373

Query: 257 RIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTIL 316
           R ++ ARI++PK+ +RL+AGR  M++E Q  CF +GANS+F G+ +LT     + +D  +
Sbjct: 374 RTVATARIILPKTTVRLSAGRISMTEEQQVACFMAGANSVFTGEKMLTTDCNGWEEDKKM 433

Query: 317 FNRLGLIPDLS 327
           F + G  P  +
Sbjct: 434 FAKWGFYPMQA 444


>gi|118595208|ref|ZP_01552555.1| biotin synthase [Methylophilales bacterium HTCC2181]
 gi|118440986|gb|EAV47613.1| biotin synthase [Methylophilales bacterium HTCC2181]
          Length = 336

 Score =  294 bits (753), Expect = 1e-77,   Method: Composition-based stats.
 Identities = 165/307 (53%), Positives = 220/307 (71%)

Query: 17  KVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQSV 76
           + W    + Q++N+ FNDLLF +HTVHR+NF+PN +QLS LL+IKTGGC E+C YC QS 
Sbjct: 28  QKWPKDAITQLFNLSFNDLLFKAHTVHRENFDPNSVQLSTLLSIKTGGCSEDCSYCPQSA 87

Query: 77  HNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLG 136
              +++  + ++++++V+K A  AKE GATR+CMGAAWR PK++DL ++  M+  VKS+G
Sbjct: 88  RYDTEVDNTPILSIEEVMKAALAAKEAGATRFCMGAAWRGPKQKDLDLVKTMVTSVKSIG 147

Query: 137 LETCMTLGMLSFEQAQILSKAGLDY