RPSBLAST alignment for GI: 254780485 and conserved domain: smart00729

>gnl|CDD|128968 smart00729, Elp3, Elongator protein 3, MiaB family, Radical SAM. This superfamily contains MoaA, NifB, PqqE, coproporphyrinogen III oxidase, biotin synthase and MiaB families, and includes a representative in the eukaryotic elongator subunit, Elp-3. Some members of the family are methyltransferases. Length = 216
 Score =  127 bits (320), Expect = 4e-30
 Identities = 54/219 (24%), Positives = 94/219 (42%), Gaps = 17/219 (7%)

Query: 55  SKLLNIKTGGCPENCGYCNQSVHNKSKLKASKLINVDQVLKEAKNA--KENGATRYCMGA 112
              L I T GCP  C +C+     + KL++  L  + + ++       KE       +G 
Sbjct: 1   PLALYIITRGCPRRCTFCSFPSA-RGKLRSRYLEALVREIELLAEKGEKEILVGTVFIGG 59

Query: 113 AW-----REPKERDLSIIVDMIKGVKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNID 167
                   E  E  L  I +++     + +      G L+ E  + L +AG++  +  + 
Sbjct: 60  GTPTLLSPEQLEELLEAIREILGLADDVEITIETRPGTLTEELLEALKEAGVNRVSLGVQ 119

Query: 168 T-SERFYPHVTTTHTFEDRLQTLENVRKSG-IKVCCGGILGL-GEMIDDRIDMLLTLANL 224
           + S+     +   HT ED L+ +E +R++G IKV    I+GL GE  +D  + L  L  L
Sbjct: 120 SGSDEVLKAINRGHTVEDVLEAVEKLREAGPIKVSTDLIVGLPGETEEDFEETLKLLKEL 179

Query: 225 STPPESIPINLLIPIPGSKFEENKK----VDPIEHVRII 259
              P+ + I  L P PG+   +  K     D  E + ++
Sbjct: 180 --GPDRVSIFPLSPRPGTPLAKLYKRLKPPDKEERLELL 216