RPSBLAST alignment for GI: 254780485 and conserved domain: PRK12928

>gnl|CDD|183830 PRK12928, PRK12928, lipoyl synthase; Provisional. Length = 290
 Score = 43.4 bits (103), Expect = 8e-05
 Identities = 22/75 (29%), Positives = 34/75 (45%), Gaps = 2/75 (2%)

Query: 149 EQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRK--SGIKVCCGGILG 206
           E+   +  A  D +NHN++T  R    V     ++  L  L   ++    I    G +LG
Sbjct: 154 ERLATVLAAKPDVFNHNLETVPRLQKAVRRGADYQRSLDLLARAKELAPDIPTKSGLMLG 213

Query: 207 LGEMIDDRIDMLLTL 221
           LGE  D+ I+ L  L
Sbjct: 214 LGETEDEVIETLRDL 228