RPSBLAST alignment for GI: 254780485 and conserved domain: PRK15108

>gnl|CDD|185063 PRK15108, PRK15108, biotin synthase; Provisional. Length = 345
 Score =  420 bits (1082), Expect = e-118
 Identities = 167/306 (54%), Positives = 226/306 (73%)

Query: 19  WTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQSVHN 78
           WT  +V +++  P  +LLF +  VHR++F+P  +Q+S LL+IKTG CPE+C YC QS   
Sbjct: 7   WTLSQVTELFEKPLLELLFEAQQVHRQHFDPRQVQVSTLLSIKTGACPEDCKYCPQSSRY 66

Query: 79  KSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLGLE 138
           K+ L+A +L+ V+QVL+ A+ AK  G+TR+CMGAAW+ P ERD+  +  M++GVK++GLE
Sbjct: 67  KTGLEAERLMEVEQVLESARKAKAAGSTRFCMGAAWKNPHERDMPYLEQMVQGVKAMGLE 126

Query: 139 TCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSGIK 198
           TCMTLG LS  QAQ L+ AGLDYYNHN+DTS  FY ++ TT T+++RL TLE VR +GIK
Sbjct: 127 TCMTLGTLSESQAQRLANAGLDYYNHNLDTSPEFYGNIITTRTYQERLDTLEKVRDAGIK 186

Query: 199 VCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEHVRI 258
           VC GGI+GLGE + DR  +LL LANL TPPES+PIN+L+ + G+   +N  VD  + +R 
Sbjct: 187 VCSGGIVGLGETVKDRAGLLLQLANLPTPPESVPINMLVKVKGTPLADNDDVDAFDFIRT 246

Query: 259 ISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTILFN 318
           I+VARI+MP S +RL+AGR  M+++ QA+CF +GANSIF G  LLT  NP  +KD  LF 
Sbjct: 247 IAVARIMMPTSYVRLSAGREQMNEQTQAMCFMAGANSIFYGCKLLTTPNPEEDKDLQLFR 306

Query: 319 RLGLIP 324
           +LGL P
Sbjct: 307 KLGLNP 312