RPS-BLAST 2.2.22 [Sep-27-2009]

Database: CddA 
           21,609 sequences; 6,263,737 total letters

Searching..................................................done

Query= gi|254780485|ref|YP_003064898.1| biotin synthase [Candidatus
Liberibacter asiaticus str. psy62]
         (328 letters)



>gnl|CDD|30848 COG0502, BioB, Biotin synthase and related enzymes [Coenzyme
           metabolism].
          Length = 335

 Score =  403 bits (1037), Expect = e-113
 Identities = 168/311 (54%), Positives = 221/311 (71%), Gaps = 4/311 (1%)

Query: 19  WTSKEVFQIYNMPFND-LLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQSVH 77
           WT  E   + ++P  D LLF +   HR +F+ N +QLS L++IKTG CPE+C YC+QS  
Sbjct: 14  WTLDEALALLDLPDEDELLFEAAQKHRLHFDGNEVQLSTLISIKTGCCPEDCAYCSQSAR 73

Query: 78  NKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKS-LG 136
            K+ +KA KL+ V+++L+ AK AK  GATR+CMGAA R    RD+  +V+ IK VK  LG
Sbjct: 74  YKTGVKARKLMEVEEILEAAKKAKAAGATRFCMGAAGRG-PGRDMEEVVEAIKAVKEELG 132

Query: 137 LETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSG 196
           LE C +LGML+ EQA+ L+ AG+D YNHN++TS  FY ++ TT T+EDRL TLENVR++G
Sbjct: 133 LEVCASLGMLTEEQAEKLADAGVDRYNHNLETSPEFYENIITTRTYEDRLNTLENVREAG 192

Query: 197 IKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEENKKVDPIEHV 256
           I+VC GGI+GLGE ++DR ++LL LANL   P+S+PIN L PIPG+  E  K +DP E +
Sbjct: 193 IEVCSGGIVGLGETVEDRAELLLELANLP-TPDSVPINFLNPIPGTPLENAKPLDPFEFL 251

Query: 257 RIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDTIL 316
           + I+VARI+MPKS +RL+AGR  M  ELQAL F +GANSIFVGD  LT   P  +KD  L
Sbjct: 252 KTIAVARIIMPKSMIRLSAGRETMLPELQALAFMAGANSIFVGDKYLTTPGPDEDKDLEL 311

Query: 317 FNRLGLIPDLS 327
              LGL P+L 
Sbjct: 312 LKDLGLEPELL 322


>gnl|CDD|38111 KOG2900, KOG2900, KOG2900, Biotin synthase [Coenzyme transport and
           metabolism].
          Length = 380

 Score =  356 bits (914), Expect = 6e-99
 Identities = 159/310 (51%), Positives = 215/310 (69%), Gaps = 4/310 (1%)

Query: 19  WTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQSVHN 78
           WT  E+ +IY+ P  DL F +   HRK  +P  +Q   LL+IKTGGC E+C YC QS   
Sbjct: 48  WTRSEIKEIYDTPLLDLTFAAALQHRKWHDPTKVQQCTLLSIKTGGCSEDCKYCAQSSRY 107

Query: 79  KSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERD--LSIIVDMIKGVKSLG 136
            + +KA KL+ VD+V+KEAK AK NG+TR+CMGAAWR+ K R      I++MIK V+ +G
Sbjct: 108 DTGVKAEKLMKVDEVIKEAKEAKRNGSTRFCMGAAWRDMKGRKSAFKRILEMIKEVRDMG 167

Query: 137 LETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSG 196
           +E C+TLGM+  +QA+ L  AGL  YNHN+DTS  +Y  V TT T++DRLQT++NVR++G
Sbjct: 168 MEVCVTLGMVDQQQAKELKDAGLTAYNHNLDTSREYYSKVITTRTYDDRLQTIKNVREAG 227

Query: 197 IKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIPGSKFEE--NKKVDPIE 254
           IKVC GGILGLGE  DDRI ++ TLA +   PES+PIN L+ I G+   +  +KK+   E
Sbjct: 228 IKVCSGGILGLGESEDDRIGLIHTLATMPPHPESVPINRLVAIKGTPMADEKSKKLQIDE 287

Query: 255 HVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSYNKDT 314
            +R I+ ARI+MPK+ +RLAAGR  MS+  QALCF +GANSIF G+ +LT     +++D 
Sbjct: 288 ILRTIATARIVMPKAIIRLAAGRYTMSESEQALCFMAGANSIFTGEKMLTTPCNGWDEDK 347

Query: 315 ILFNRLGLIP 324
            +F + GL P
Sbjct: 348 AMFAKWGLQP 357


>gnl|CDD|146602 pfam04055, Radical_SAM, Radical SAM superfamily.  Radical SAM
           proteins catalyse diverse reactions, including unusual
           methylations, isomerisation, sulphur insertion, ring
           formation, anaerobic oxidation and protein radical
           formation.
          Length = 165

 Score = 91.1 bits (226), Expect = 4e-19
 Identities = 44/168 (26%), Positives = 72/168 (42%), Gaps = 10/168 (5%)

Query: 60  IKTGGCPENCGYCNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMG----AAWR 115
           I T GC   C YC             + ++ +++L+EAK     G     +         
Sbjct: 2   IITPGCNLRCTYCAFPSI--RARGKGRELSPEEILEEAKELARLGVEVVILTGGEPLLLP 59

Query: 116 EPKERDLSIIVDMIKGVKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDT-SERFYP 174
           +  E    ++         + LET  TL  L  E  + L +AGLD  + ++ +  +    
Sbjct: 60  DLVELLERLLKLEELEGIRITLETNGTL--LDEELLEELKEAGLDRVSISLQSGDDEVLK 117

Query: 175 HVTTTHTFEDRLQTLENVRKSGIKVCCGGILGL-GEMIDDRIDMLLTL 221
            +   HTFE+ L+ LE +R++GI V    I+GL GE  +D  + L  L
Sbjct: 118 IINRGHTFEEVLEALELLREAGIPVVVDNIVGLPGENDEDLEETLELL 165


>gnl|CDD|100105 cd01335, Radical_SAM, Radical SAM superfamily. Enzymes of this
           family generate radicals by combining a 4Fe-4S cluster
           and S-adenosylmethionine (SAM) in close proximity. They
           are characterized by a conserved CxxxCxxC motif, which
           coordinates the conserved iron-sulfur cluster.
           Mechanistically, they share the transfer of a single
           electron from the iron-sulfur cluster to SAM, which
           leads to its reductive cleavage to methionine and a
           5'-deoxyadenosyl radical, which, in turn, abstracts a
           hydrogen from the appropriately positioned carbon atom.
           Depending on the enzyme, SAM is consumed during this
           process or it is restored and reused. Radical SAM
           enzymes catalyze steps in metabolism, DNA repair, the
           biosynthesis of vitamins and coenzymes, and the
           biosynthesis of many antibiotics. Examples are biotin
           synthase (BioB), lipoyl synthase (LipA), pyruvate
           formate-lyase (PFL), coproporphyrinogen oxidase (HemN),
           lysine 2,3-aminomutase (LAM), anaerobic ribonucleotide
           reductase (ARR), and  MoaA, an enzyme of the
           biosynthesis of molybdopterin..
          Length = 204

 Score = 77.8 bits (191), Expect = 4e-15
 Identities = 44/200 (22%), Positives = 85/200 (42%), Gaps = 8/200 (4%)

Query: 62  TGGCPENCGYCNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERD 121
           T GC  NCG+C+         ++   I  +++L     AKE G     +           
Sbjct: 4   TRGCNLNCGFCSNPASKGRGPESPPEI--EEILDIVLEAKERGVEVVILTGGEPLLYPEL 61

Query: 122 LSIIVDMIKGVKSLGLETCM-TLGMLSF-EQAQILSKAGLDYYNHNIDTSER--FYPHVT 177
             ++  + K +   G E  + T G L   E  + L + GLD    ++D+ +         
Sbjct: 62  AELLRRLKKELP--GFEISIETNGTLLTEELLKELKELGLDGVGVSLDSGDEEVADKIRG 119

Query: 178 TTHTFEDRLQTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLI 237
           +  +F++RL+ L+ +R++G+ +    ++GLG+  ++     L L      P+ + +  L+
Sbjct: 120 SGESFKERLEALKELREAGLGLSTTLLVGLGDEDEEDDLEELELLAEFRSPDRVSLFRLL 179

Query: 238 PIPGSKFEENKKVDPIEHVR 257
           P  G+  E    V P E + 
Sbjct: 180 PEEGTPLELAAPVVPAEKLL 199


>gnl|CDD|31260 COG1060, ThiH, Thiamine biosynthesis enzyme ThiH and related
           uncharacterized enzymes [Coenzyme metabolism / General
           function prediction only].
          Length = 370

 Score = 76.9 bits (189), Expect = 7e-15
 Identities = 54/255 (21%), Positives = 95/255 (37%), Gaps = 30/255 (11%)

Query: 65  CPENCGYCNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSI 124
           C  +C +C            +  ++ +++L+E + A + G T   +     E  E  L  
Sbjct: 69  CVNDCTFCAFYRKPGDP--KAYTLSPEEILEEVREAVKRGITEVLIVGG--EHPELSLEY 124

Query: 125 IVDMIKGVKSLGLETCMT------------LGMLSFEQA-QILSKAGLDYYNHNIDTSER 171
             ++ + +K    +  +              G LS+E+  + L +AGLD        +E 
Sbjct: 125 YEELFRTIKEEFPDLHIHALSAGEILFLAREGGLSYEEVLKRLKEAGLDS--MPGGGAEI 182

Query: 172 FYPHVTTTH-----TFEDRLQTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANL-- 224
               V   H     + E+ L+  E   + GI      +LG  E  +DRID L  + +L  
Sbjct: 183 LSEEVRKIHCPPKKSPEEWLEIHERAHRLGIPTTATMLLGHVETREDRIDHLEHIRDLQD 242

Query: 225 --STPPESIPINLLIPIPGSKFEENKK-VDPIEHVRIISVARILMPKSRLRLAAGRAMMS 281
                 E IP+    P  G    E        + ++ I++ARI +  +   + A      
Sbjct: 243 ETGGFQEFIPLR-FRPENGPLPAEVVPEASLEQDLKAIALARIFLDNNISNIQASWLRDG 301

Query: 282 DELQALCFFSGANSI 296
             L      SGAN +
Sbjct: 302 VILAQAALLSGANDL 316


>gnl|CDD|31235 COG1032, COG1032, Fe-S oxidoreductase [Energy production and
           conversion].
          Length = 490

 Score = 49.9 bits (118), Expect = 1e-06
 Identities = 38/240 (15%), Positives = 86/240 (35%), Gaps = 20/240 (8%)

Query: 64  GCPENCGYCNQSVHNK------SKLKASKLINVDQVLKEAKNAKEN----GATRYCMGAA 113
           GCP  C +C+ + H K       ++       +++  K      ++    G+        
Sbjct: 207 GCPRGCRFCSITKHFKYRRRRPERVVEEIKELIEEGGKRVVFFVDDIFLYGSPALNDEKR 266

Query: 114 WREPKERDLSIIVDMIKGVKSLGLETCMTLGMLSFEQ-AQILSKAGLDYYNHNIDT-SER 171
           +       +   +     V        +    ++ E+  ++L +AGL      I++ SE 
Sbjct: 267 FELLSLELIERGLRKGCRVH--ISAPSLRADTVTDEELLKLLREAGLRRVYIGIESGSEE 324

Query: 172 FYPHVTTTHTFEDRLQTLENV-RKSGIKVCCGGILGLGEMIDDRIDMLLTLANLST---P 227
               +    T E+ L+    + ++ G++V    I+GL    ++ +   + LA       P
Sbjct: 325 LLKKINKGITTEEVLEEAVKIAKEHGLRVKLYFIVGLPGETEEDVKETIELAKFIKKLGP 384

Query: 228 PESIPINLLIPIPGSKFEENKKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQAL 287
              +  +  +P+PG+  +E  K++     R       L+   R   +     M    ++ 
Sbjct: 385 KLYVSPSPFVPLPGTPLQEMPKLENELLKRRFE--GDLLQPWRPLESLASEEMYYLGRSR 442


>gnl|CDD|30668 COG0320, LipA, Lipoate synthase [Coenzyme metabolism].
          Length = 306

 Score = 47.9 bits (114), Expect = 3e-06
 Identities = 25/75 (33%), Positives = 41/75 (54%), Gaps = 14/75 (18%)

Query: 152 QILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVR--------KSGIKVCCGG 203
           +I++ AG D +NHN++T  R YP V    T+E  L  LE  +        KSG+      
Sbjct: 166 EIVADAGPDVFNHNVETVPRLYPRVRPGATYERSLSLLERAKELGPDIPTKSGL------ 219

Query: 204 ILGLGEMIDDRIDML 218
           ++GLGE  ++ I+++
Sbjct: 220 MVGLGETDEEVIEVM 234


>gnl|CDD|32041 COG1856, COG1856, Uncharacterized homolog of biotin synthetase
           [Function unknown].
          Length = 275

 Score = 46.9 bits (111), Expect = 7e-06
 Identities = 36/148 (24%), Positives = 65/148 (43%), Gaps = 13/148 (8%)

Query: 127 DMIKGVK-SLGLETCMTLGMLSFEQAQILSKAG-----LDYYNHNIDTSERFYPHVTTTH 180
           D +K +K   GL     +G +     + L +       LD+   N D  +R Y       
Sbjct: 78  DELKALKERTGLLINAHVGFVDESDLEKLKEELVDVVSLDFVGDN-DVIKRVY---KLPK 133

Query: 181 TFEDRLQTLENVRKSGIKVCCGGILGL-GEMIDDRIDMLLTLANLSTPPESIPINLLIPI 239
           + ED L++L  ++++GI+V     +GL    I      +  L N    P+++ + +LIP 
Sbjct: 134 SVEDYLRSLLLLKENGIRVVPHITIGLDFGKIHGEFKAIDILVNY--EPDALVLVVLIPT 191

Query: 240 PGSKFEENKKVDPIEHVRIISVARILMP 267
           PG+K   +      E ++++  AR   P
Sbjct: 192 PGTKMGNSPPPPVEEAIKVVKYARKKFP 219


>gnl|CDD|37883 KOG2672, KOG2672, KOG2672, Lipoate synthase [Coenzyme transport and
           metabolism].
          Length = 360

 Score = 40.0 bits (93), Expect = 8e-04
 Identities = 23/76 (30%), Positives = 38/76 (50%), Gaps = 6/76 (7%)

Query: 152 QILSKAGLDYYNHNIDTSERFYPHVTTTH-TFEDRLQTLENVRKSGIKVCCGG--ILGLG 208
           + ++K+GLD Y HN++T E   P V      +   L  L++ ++    +      +LGLG
Sbjct: 208 EKVAKSGLDVYAHNVETVEELTPFVRDPRANYRQSLSVLKHAKEVKPGLITKTSIMLGLG 267

Query: 209 EMIDDRIDMLLTLANL 224
           E  D+ I    TL +L
Sbjct: 268 ET-DEEI--KQTLKDL 280


>gnl|CDD|31435 COG1242, COG1242, Predicted Fe-S oxidoreductase [General function
           prediction only].
          Length = 312

 Score = 39.8 bits (93), Expect = 0.001
 Identities = 22/69 (31%), Positives = 35/69 (50%), Gaps = 5/69 (7%)

Query: 180 HTFEDRLQTLENVRKSGIKVCCGGILGL-GEMIDDRIDMLLTLANLS-TPPESIPINLLI 237
           H F   +  ++ +RK GIKVC   I GL GE    R +ML T   ++    + I ++ L 
Sbjct: 165 HDFACYVDAVKRLRKRGIKVCTHLINGLPGE---TRDEMLETAKIVAELGVDGIKLHPLH 221

Query: 238 PIPGSKFEE 246
            + G+  E+
Sbjct: 222 VVKGTPMEK 230


>gnl|CDD|31373 COG1180, PflA, Pyruvate-formate lyase-activating enzyme
           [Posttranslational modification, protein turnover,
           chaperones].
          Length = 260

 Score = 38.4 bits (89), Expect = 0.003
 Identities = 39/179 (21%), Positives = 67/179 (37%), Gaps = 13/179 (7%)

Query: 62  TGGCPENCGYCNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWR--EPKE 119
             GC   C YC     N    +  + ++ ++V  E    K    +    G  +   EP  
Sbjct: 42  LQGCNLRCPYC----QNPEISQRGREVSGEEVSPEVLVDKA-FYSESGGGVTFSGGEPTL 96

Query: 120 RDLSIIVDMIKGVKSLGLETCM-TLGMLSFEQAQILSKAGLDYYNHNI-DTSERFYPHVT 177
           +     +D+++  K  GL   + T G L  E  + L    LD    ++    +  Y  +T
Sbjct: 97  Q-AEFALDLLRAAKERGLHVALDTNGFLPPEALEELLPL-LDAVLLDLKAFDDELYRKLT 154

Query: 178 TTHTFEDRLQTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLL 236
                E  L+ LE +   G+ V     L +    DD  ++      ++     IPI+LL
Sbjct: 155 GA-DNEPVLENLELLADLGVHVEI-RTLVIPGYNDDEEEIRELAEFIADLGPEIPIHLL 211


>gnl|CDD|32586 COG2516, COG2516, Biotin synthase-related enzyme [General function
           prediction only].
          Length = 339

 Score = 36.5 bits (84), Expect = 0.009
 Identities = 54/236 (22%), Positives = 94/236 (39%), Gaps = 22/236 (9%)

Query: 57  LLNIKTGGCPENCGYCNQSVHNKSKLKASKLINVD------QVLKEAKNAKENGATRYCM 110
           L+    GGC  +C YC Q+  + +      L  V+      + + +          R C+
Sbjct: 33  LMTTYPGGCIADCAYCPQARSSTANPPKKVLSRVEWPAVALEEVLKRLFYDLGNFKRICI 92

Query: 111 GAAWREPKE-RDLSIIVDMIKGVKSLGLETCMTLGMLSF-EQAQILSKAGLDYYNHNIDT 168
                 P+   DL +I++ +       +     +  +S  E+ +   K G DY     D 
Sbjct: 93  QQI-AYPRALNDLKLILERLHIRLGDPITISECITAVSLKEELEEYRKLGADYLGVAEDA 151

Query: 169 -SERFYPHVTTT----HTFEDRLQTLENVR---KSGIKVCCGGILGLGEMIDDRIDMLLT 220
            +E  +  V  T    H++E   + LE V      G +V    I+GLGE   D+ D++ T
Sbjct: 152 ANEELFEKVRKTSGSPHSWERYWEFLEKVAEAFGKG-RVGIHLIVGLGE--SDK-DIVET 207

Query: 221 LANLSTPPESIPINLLIPIPGSKFEENKKVDPIEHVRIISVARILMPKSRLRLAAG 276
           +  +      + +    P+ G++ E  K   P+E  R I VAR L+    + L   
Sbjct: 208 IKRVRKRGGIVSLFAFTPLKGTQMENRKPP-PVERYRKIQVARYLIGNGEVDLEDF 262


>gnl|CDD|32291 COG2108, COG2108, Uncharacterized conserved protein related to
           pyruvate formate-lyase activating enzyme [General
           function prediction only].
          Length = 353

 Score = 35.7 bits (82), Expect = 0.017
 Identities = 38/156 (24%), Positives = 64/156 (41%), Gaps = 27/156 (17%)

Query: 55  SKLLNIKTGGCPENCGYCNQSVHNKSKLKA----SKLINVDQVLKEAKNAKENGATRYCM 110
            KL+   TG C  +C YC  S   K K         + +V+ +++EAK     GA     
Sbjct: 28  GKLVLFVTGLCNRSCFYCPVSDERKGKDVIYANERPVKSVEDIIEEAKLMDALGA----- 82

Query: 111 GAAWREPKERDLSIIVDMIKGVKS-------LGLETCMTLGMLSFEQAQILSKAGLDYYN 163
                +P    +   V+ I+ +K        + L T   L   + E  + L++AGLD   
Sbjct: 83  SITGGDPLLE-IERTVEYIRLLKDEFGEDFHIHLYTTGIL--ATEEALKALAEAGLD--- 136

Query: 164 HNIDTSERFYPHVTTTHTFEDRLQTLENVRKSGIKV 199
                  RF+P    + + E  ++ L+  +K G+ V
Sbjct: 137 -----EIRFHPPRPGSKSSEKYIENLKIAKKYGMDV 167


>gnl|CDD|29952 cd00959, DeoC, 2-deoxyribose-5-phosphate aldolase (DERA) of the
           DeoC family. DERA belongs to the class I aldolases and
           catalyzes a reversible aldol reaction between
           acetaldehyde and glyceraldehyde 3-phosphate to generate
           2-deoxyribose 5-phosphate. DERA is unique in catalyzing
           the aldol reaction between two aldehydes, and its broad
           substrate specificity confers considerable utility as a
           biocatalyst, offering an environmentally benign
           alternative to chiral transition metal catalysis of the
           asymmetric aldol reaction..
          Length = 203

 Score = 32.0 bits (73), Expect = 0.21
 Identities = 35/143 (24%), Positives = 49/143 (34%), Gaps = 24/143 (16%)

Query: 78  NKSKLKASKLIN-------VDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIK 130
             S +K   +I         +  + EA+ A  +GA    M       K  D   + + I 
Sbjct: 49  KGSGVKVCTVIGFPLGATTTEVKVAEAREAIADGADEIDMVINIGALKSGDYEAVYEEIA 108

Query: 131 GVKSLG--------LETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTF 182
            V            LET +       +  +I  +AG D+    I TS  F P      T 
Sbjct: 109 AVVEACGGAPLKVILETGLLTDEEIIKACEIAIEAGADF----IKTSTGFGP---GGATV 161

Query: 183 EDRLQTLENVRKS-GIKVCCGGI 204
           ED     E V    G+K   GGI
Sbjct: 162 EDVKLMKEAVGGRVGVKA-AGGI 183


>gnl|CDD|145988 pfam03136, Pup_ligase, Pup-ligase protein.  Pupylation is a novel
           protein modification system found in some bacteria. This
           family of proteins are the enzyme that can conjugate
           proteins of the Pup family to lysine residues in target
           proteins marking them for degradation. The archetypal
           protein in this family is PafA (proteasome accessory
           factor) from Mycobacterium tuberculosis. It has been
           suggested that these proteins are related to
           gamma-glutamyl-cysteine synthetases.
          Length = 444

 Score = 30.3 bits (69), Expect = 0.81
 Identities = 16/35 (45%), Positives = 22/35 (62%), Gaps = 2/35 (5%)

Query: 251 DPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQ 285
           DP+  +R IS    L  ++R+RLA GR M + ELQ
Sbjct: 269 DPVRAIRAIS--HDLTLRARVRLADGREMTALELQ 301


>gnl|CDD|30947 COG0602, NrdG, Organic radical activating enzymes
          [Posttranslational modification, protein turnover,
          chaperones].
          Length = 212

 Score = 30.0 bits (67), Expect = 0.87
 Identities = 8/41 (19%), Positives = 19/41 (46%), Gaps = 1/41 (2%)

Query: 60 IKTGGCPENCGYC-NQSVHNKSKLKASKLINVDQVLKEAKN 99
          ++  GC   C  C  +   + +  K    ++ D++L + K+
Sbjct: 27 VRFAGCNLRCPGCDTKYTWDFNYGKPGTPMSADEILADIKS 67


>gnl|CDD|32283 COG2100, COG2100, Predicted Fe-S oxidoreductase [General function
           prediction only].
          Length = 414

 Score = 29.9 bits (67), Expect = 0.91
 Identities = 28/113 (24%), Positives = 50/113 (44%), Gaps = 8/113 (7%)

Query: 62  TGGCPENCGYCNQSVHNKSKLKASK-LINVDQVLKE-AKNAKENG----ATRYCMGAAWR 115
           + GC  NC +C+      S+ +    +++ + +L+   K A+  G    A     G    
Sbjct: 114 STGCNLNCIFCSVDEGPYSRTRKLDYVVDPEYLLEWFEKVARFKGKGLEAHLDGQGEPLL 173

Query: 116 EPKERDLSIIVDMIKGVKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDT 168
            P   DL   +   KGV+ + ++T     +LS +    L +AGLD  N ++D 
Sbjct: 174 YPHLVDLVQALKEHKGVEVVSMQT--NGVLLSKKLVDELEEAGLDRINLSVDA 224


>gnl|CDD|38087 KOG2876, KOG2876, KOG2876, Molybdenum cofactor biosynthesis pathway
           protein [Coenzyme transport and metabolism].
          Length = 323

 Score = 29.6 bits (66), Expect = 1.1
 Identities = 44/191 (23%), Positives = 70/191 (36%), Gaps = 28/191 (14%)

Query: 31  PFNDLLFWSHTVHRKNFEPNHIQLSKLLNIKTGGCPENCGYCNQSVHNKSKLKASKLINV 90
           P  D     HT  R       I L++  N++       C YC  S     K K  KL+ V
Sbjct: 1   PLTDSFGREHTYLR-------ISLTEKCNLR-------CQYCMPSEGVPLKPKR-KLLAV 45

Query: 91  DQVLKEAKNAKENGA--TRYCMGAAWREPKERDLSIIVDMIKGVKSLGLETCMTLGMLSF 148
            ++L+ A      G    R   G          +   +  + G+KS+G+ T    G++  
Sbjct: 46  SEILRLAGLFAPQGVDKNRLTGGEPLIRQDIVPIVAGLSSLPGLKSIGITT---NGLVLA 102

Query: 149 EQAQILSKAGLDYYNHNIDTSERF-YPHVTTTHTFEDRLQTLENVRKSGIK------VCC 201
                L KAGL   N ++DT  R  +  +T    F     +++   + G        V  
Sbjct: 103 RLLPQLHKAGLSSINISLDTLVRAKFAKLTRRKGFVKVWASIQLAIELGYNPVKVNCVVM 162

Query: 202 GGILGLGEMID 212
            G+    E+ D
Sbjct: 163 KGLNE-DEVFD 172


>gnl|CDD|29940 cd00945, Aldolase_Class_I, Class I aldolases. The class I aldolases
           use an active-site lysine which stablilzes a reaction
           intermediates via Schiff base formation, and have TIM
           beta/alpha barrel fold. The members of this family
           include 2-keto-3-deoxy-6-phosphogluconate (KDPG) and
           2-keto-4-hydroxyglutarate (KHG) aldolases,
           transaldolase, dihydrodipicolinate synthase sub-family,
           Type I 3-dehydroquinate dehydratase, DeoC and DhnA
           proteins, and metal-independent
           fructose-1,6-bisphosphate aldolase. Although
           structurally similar, the class II aldolases use a
           different mechanism and are believed to have an
           independent evolutionary origin..
          Length = 201

 Score = 29.6 bits (66), Expect = 1.3
 Identities = 29/127 (22%), Positives = 44/127 (34%), Gaps = 18/127 (14%)

Query: 87  LINVDQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLG---------L 137
           L   +  + E + A + GA    +       KE D   +++ I  V             L
Sbjct: 61  LTTTEVKVAEVEEAIDLGADEIDVVINIGSLKEGDWEEVLEEIAAVVEAADGGLPLKVIL 120

Query: 138 ETCMTLG-MLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVR-KS 195
           ET          + A+I ++AG D+    I TS           T ED     E V  + 
Sbjct: 121 ETRGLKTADEIAKAARIAAEAGADF----IKTS---TGFGGGGATVEDVKLMKEAVGGRV 173

Query: 196 GIKVCCG 202
           G+K   G
Sbjct: 174 GVKAAGG 180


>gnl|CDD|30622 COG0274, DeoC, Deoxyribose-phosphate aldolase [Nucleotide transport
           and metabolism].
          Length = 228

 Score = 29.0 bits (65), Expect = 2.1
 Identities = 31/124 (25%), Positives = 42/124 (33%), Gaps = 18/124 (14%)

Query: 91  DQVLKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLG---------LETCM 141
                EA+ A ENGA    M       K  +   +   I+ V             LET +
Sbjct: 77  AVKAAEAREAIENGADEIDMVINIGALKSGNWEAVEREIRAVVEACADAVVLKVILETGL 136

Query: 142 TLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKS-GIKVC 200
                  +  +I  +AG D+    + TS  F        T ED     E V    G+K  
Sbjct: 137 LTDEEKRKACEIAIEAGADF----VKTSTGFSA---GGATVEDVKLMKETVGGRVGVKA- 188

Query: 201 CGGI 204
            GGI
Sbjct: 189 SGGI 192


>gnl|CDD|73354 cd03370, NADH_oxidase, NADPH_oxidase. Nitroreductase family
           containing NADH oxidase and other, uncharacterized
           proteins that are similar to nitroreductase.
           Nitroreductase catalyzes the reduction of nitroaromatic
           compounds such as nitrotoluenes, nitrofurans and
           nitroimidazoles. This process requires NAD(P)H as
           electron donor in an obligatory two-electron transfer
           and uses FMN as cofactor.  The enzyme is typically a
           homodimer. Members of this family are also called NADH
           dehydrogenase, oxygen-insensitive NAD(P)H nitrogenase or
           dihydropteridine reductase..
          Length = 156

 Score = 28.7 bits (64), Expect = 2.2
 Identities = 12/50 (24%), Positives = 20/50 (40%), Gaps = 4/50 (8%)

Query: 111 GAAWREPKERDLSIIVD-MIKGVKSLGLETCMTLGMLSFEQAQILSKAGL 159
             AWR    +   I    ++    +LGL T    G   F++ ++    GL
Sbjct: 80  DYAWRAEGLKQAMIAAGFLLLAATALGLATSPMTG---FDEEKVKEALGL 126


>gnl|CDD|32827 COG3010, NanE, Putative N-acetylmannosamine-6-phosphate epimerase
           [Carbohydrate transport and metabolism].
          Length = 229

 Score = 27.9 bits (62), Expect = 4.1
 Identities = 29/106 (27%), Positives = 40/106 (37%), Gaps = 10/106 (9%)

Query: 94  LKEAKNAKENGATRYCMGAAWREPKERDLSIIVDMIKGVKSLGLETCMTLGMLSFEQAQI 153
           LKE     E GA      A  R   + DL  ++  IK    L +  C T     FE+   
Sbjct: 88  LKEVDALAEAGADIIAFDATDRPRPDGDLEELIARIKYPGQLAMADCST-----FEEGLN 142

Query: 154 LSKAGLDYYNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSGIKV 199
             K G D     I T+   Y   T   T  D  Q ++ +  +G +V
Sbjct: 143 AHKLGFDI----IGTTLSGYTGYTEKPTEPD-FQLVKQLSDAGCRV 183


>gnl|CDD|30980 COG0635, HemN, Coproporphyrinogen III oxidase and related Fe-S
           oxidoreductases [Coenzyme metabolism].
          Length = 416

 Score = 28.0 bits (62), Expect = 4.3
 Identities = 35/201 (17%), Positives = 74/201 (36%), Gaps = 21/201 (10%)

Query: 65  CPENCGYCN-QSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWR---EP--- 117
           C   C YC+  S   K      + ++   +L+E +        +  +   +     P   
Sbjct: 44  CVSKCPYCDFNSHVTKRGQPVDEYLDA--LLEEIELVAALLGGQREVKTIYFGGGTPSLL 101

Query: 118 KERDLSIIVDMIK-------GVKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNI-DTS 169
               L  ++  ++           + +E     G +  E+ + L +AG++  +  +   +
Sbjct: 102 SPEQLERLLKALRELFNDLDPDAEITIEANP--GTVEAEKFKALKEAGVNRISLGVQSFN 159

Query: 170 ERFYPHVTTTHTFEDRLQTLENVRKSGIK-VCCGGILGLGEMIDDRIDMLLTLANLSTPP 228
           +     +   H  E+  + +E  RK+G   +    I GL     + +   L  A L   P
Sbjct: 160 DEVLKALGRIHDEEEAKEAVELARKAGFTSINIDLIYGLPGQTLESLKEDLEQA-LELGP 218

Query: 229 ESIPINLLIPIPGSKFEENKK 249
           + + +  L   PG+KF + K 
Sbjct: 219 DHLSLYSLAIEPGTKFAQRKI 239


>gnl|CDD|37081 KOG1870, KOG1870, KOG1870, Ubiquitin C-terminal hydrolase
           [Posttranslational modification, protein turnover,
           chaperones].
          Length = 842

 Score = 27.0 bits (59), Expect = 7.1
 Identities = 21/87 (24%), Positives = 32/87 (36%), Gaps = 9/87 (10%)

Query: 113 AWREPKERDLSIIVDMIKG--VKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSE 170
            W    +R+ S+IVD+  G    +L   TC  +  ++F+    LS   L      I   E
Sbjct: 380 VWDYHLKRNRSVIVDLFDGTYKSTLQCPTCGKVS-VTFDPFGYLS---LPLPGKEIQKLE 435

Query: 171 RFYPHVTTTHTFEDRLQTLENVRKSGI 197
              PH               +V K+G 
Sbjct: 436 VTVPHGDGFR---KPGALGVSVAKNGR 459


>gnl|CDD|35845 KOG0626, KOG0626, KOG0626, Beta-glucosidase, lactase
           phlorizinhydrolase, and related proteins [Carbohydrate
           transport and metabolism].
          Length = 524

 Score = 26.8 bits (59), Expect = 9.4
 Identities = 14/39 (35%), Positives = 21/39 (53%), Gaps = 4/39 (10%)

Query: 155 SKAGLDYYNHNIDT--SERFYPHVTTTHTFEDRLQTLEN 191
           ++AG+ +YN+ ID   +    P VT  H   D  Q LE+
Sbjct: 128 NEAGIQFYNNLIDELLANGIEPFVTLFHW--DLPQALED 164


>gnl|CDD|147113 pfam04793, Herpes_BBRF1, BRRF1-like protein.  Family of herpesvirus
           proteins including Epstein-barr virus protein BBRF1.
          Length = 284

 Score = 26.5 bits (59), Expect = 9.7
 Identities = 10/40 (25%), Positives = 20/40 (50%), Gaps = 7/40 (17%)

Query: 28  YNMPFNDLLFWS------HTVHRKNFEPNHI-QLSKLLNI 60
           +N+PFN ++FW+       +    ++  + I  +S LL  
Sbjct: 187 FNVPFNQVVFWTTVLKMFSSCIYNDYLLDSIACISALLKN 226


  Database: CddA
    Posted date:  Feb 4, 2011  9:38 PM
  Number of letters in database: 6,263,737
  Number of sequences in database:  21,609
  
Lambda     K      H
   0.319    0.135    0.400 

Gapped
Lambda     K      H
   0.267   0.0714    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 21609
Number of Hits to DB: 3,939,329
Number of extensions: 200456
Number of successful extensions: 470
Number of sequences better than 10.0: 1
Number of HSP's gapped: 458
Number of HSP's successfully gapped: 31
Length of query: 328
Length of database: 6,263,737
Length adjustment: 94
Effective length of query: 234
Effective length of database: 4,232,491
Effective search space: 990402894
Effective search space used: 990402894
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 57 (25.8 bits)