HHsearch alignment for GI: 254780486 and conserved domain: PRK05937

>PRK05937 8-amino-7-oxononanoate synthase; Provisional.
Probab=100.00  E-value=0  Score=705.78  Aligned_cols=342  Identities=27%  Similarity=0.414  Sum_probs=318.1

Q ss_pred             CCEEEECCCCCCCCCCCCHHHHHHHHHHHHHHC-------CCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCCEEEECCCC
Q ss_conf             976898034465667798899999999998637-------8688722443688589999999984012888516741660
Q gi|254780486|r   28 RQDIWDFTSHDYLALSSSTLLREKILSSLDSKI-------PIGSGGSRLLCGNYNQHLELEEEAADFFGFEKMLYFGSGY  100 (381)
Q Consensus        28 ~~~~l~f~s~dYLGl~~~p~v~~a~~~a~~~~~-------g~~~~~sr~~~G~~~~~~~lE~~lA~~~g~e~al~~~sG~  100 (381)
T Consensus         3 ~~~~lnFsSNDYLGLs~~p~v~~a~~~a~-~~y~~~~~~~g~Gs~gSrl~~G~~~~h~~LE~~lA~f~g~e~allf~sGy   81 (370)
T PRK05937          3 SSLSIDFVTNDFLGFSRSTTLVHEVEKRY-RLYCEQFPHAQLGYGGSRAILGPSSLLDDLEHKIAHFHGAPEAFIVPSGY   81 (370)
T ss_pred             CCEEEECCCCCCCCCCCCHHHHHHHHHHH-HHHHHCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCEEEECCHH
T ss_conf             77078240320038789989999999999-98731257898768687826278699999999999986999399987668


Q ss_pred             HHHHHHHHHHCCCCCCCCHHHHCCHHHHHHHHHCCCCCEEECCCCHHHHHHHHHHHHHCCCCCCCEEEECCCCCCCCCHH
Q ss_conf             24565566631689710045420267752666408764030568814789976431000247860797146215766134
Q gi|254780486|r  101 AANMAILSTLPQATDLIVYDKLVHASIREGINSGKAQAIAIPHNNINSFAENINKWRKSGGKGFPWIVVESIYSMDGDKA  180 (381)
Q Consensus       101 ~An~~~i~~l~~~~d~ii~D~~~HaSi~~g~~ls~a~~~~f~HnD~~~Le~~l~~~~~~~~~~~~~vv~egv~Sm~G~~a  180 (381)
T Consensus        82 ~AN~~~i~al~~~~d~i~~D~l~HaSi~dG~rls~a~~~~f~Hnd~~~Le~~L~~~~~~-~~~~~~iv~egVfSMdGdia  160 (370)
T PRK05937         82 MANLGLCAHLSSVTDYVLWDEQVHISVVYSLSVISGKHQSFRHNDLDHLESLLESCRAV-SFGRIFIFVCSVYSFKGTLA  160 (370)
T ss_pred             HHHHHHHHHCCCCCCEEEEECCCHHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHHC-CCCCEEEEEECCCCCCCCCC
T ss_conf             89999999608999989996306199999998649986996899989999999853311-78855999940566778755


Q ss_pred             HHHHHHHHHHHCCEEEEECCCCCCCCCCCCCCEEEEEHHCCCCCCCCCCCCCCCCCEEEEEECCCCCCCCCCCCCCCEEC
Q ss_conf             68999998631360898613112223477764011000013465210013465653026752451001000012110000
Q gi|254780486|r  181 PLDDLVKIANDYDGFIVVDEAHATGVCGPLGKGLTHIIEERNNVIVMHSCSKALGSSGALVGSNKIIYDYLINYAKPFIY  260 (381)
Q Consensus       181 pL~~i~~l~~~y~~~LivDEah~~Gv~G~~G~G~~~~~~~~~~~iv~~TlsKa~g~~GG~i~~~~~ii~~l~~~~~~~if  260 (381)
T Consensus       161 pL~~l~~l~~~y~a~l~vDeAH~~Gv~G~~GrG~~e~~g~~~~~~i~~TlsKAlGs~Ggfv~~s~~~i~~l~~~ar~~If  240 (370)
T PRK05937        161 PLEQIIALSKKYHAHLIVDEAHAMGIFGDDGKGFCHSLGYENFYAVLVTYSKALGSMGAALLSSSEVKQDLMLNSPPLRY  240 (370)
T ss_pred             CHHHHHHHHHHCCCEEEEECCHHCCCCCCCCCCHHHHCCCCCCCEEEEEHHHHHHHCCEEEECCHHHHHHHHHHCCCCCC
T ss_conf             89999999998197899733000043379997578873998877898132566210653898288999999983964003


Q ss_pred             CCCCCCCHHHHHHHHHHHHHHCCCH-HHHHHHHHHHHHHHHHCCCCCCCCCCEEEEEECCHHHHHHHHHHHHHCCEEEEE
Q ss_conf             1357750257898878988627102-247899999999876417978998972899958979999999999977918986
Q gi|254780486|r  261 TTSPSPILAVVACEALKLIKRKPAL-HKSLLQLINITDKIANKKIGFSSQSHIQSIVIGDNKSCLNIAKNLQKKGFDIRA  339 (381)
Q Consensus       261 st~l~P~~~aaa~aal~~l~~~~~~-~~~l~~~~~~~~~~~~~~~g~~~~s~I~~v~~gd~~~a~~~~~~L~~~Gi~v~~  339 (381)
T Consensus       241 StalpP~~~aa~~~al~~l~~e~~~~r~~l~~~~~~~~~----~~~~~~~~~i~pI~~~~~~~-~~~~~~L~~~Gi~v~~  315 (370)
T PRK05937        241 STGLPPHALISIQVAYDFLSQEGELARKQLFRLKEYFAQ----KFSSAAPGCVQPIFLPDISE-QELYSKLVETGIRVGV  315 (370)
T ss_pred             CCCCCHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHH----HCCCCCCCCEEEEEECCHHH-HHHHHHHHHCCEEEEE
T ss_conf             675589999999999999985959999999999999998----50667899748898083899-9999999978977986


Q ss_pred             ECCCCCCCCCCEEEEECCCCCCHHHHHHHHHHHHHHHHHHC
Q ss_conf             22888888870399962878999999999999999988738
Q gi|254780486|r  340 IRPPTVPINTARLRISITLNVDEPTIVKLFDILPQIISEGN  380 (381)
Q Consensus       340 i~~PtVp~~~~rlRi~v~a~~t~edi~~~~~~l~~v~~E~~  380 (381)
T Consensus       316 Ir~PtVP----rLRi~l~A~HT~edId~Lv~~L~~~~~~~~  352 (370)
T PRK05937        316 VCFPTKP----FLRVNLHAFNTEDEVDILVSVLHSYLEKCQ  352 (370)
T ss_pred             ECCCCCC----EEEEECCCCCCHHHHHHHHHHHHHHHHHHH
T ss_conf             8989988----378861866699999999999999999986