HHsearch alignment for GI: 254780486 and conserved domain: PRK07030

>PRK07030 adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional.
Probab=100.00  E-value=4.9e-34  Score=232.32  Aligned_cols=340  Identities=14%  Similarity=0.207  Sum_probs=229.8

Q ss_pred             HHHCCCEEEECCCCEEEECCCC---CCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHHHHHHHC--CC
Q ss_conf             9975983999289768980344---656677988999999999986378688722443688589999999984012--88
Q gi|254780486|r   16 IKSKGRHRQLLRRQDIWDFTSH---DYLALSSSTLLREKILSSLDSKIPIGSGGSRLLCGNYNQHLELEEEAADFF--GF   90 (381)
Q Consensus        16 ~~~~g~~~~~~~~~~~l~f~s~---dYLGl~~~p~v~~a~~~a~~~~~g~~~~~sr~~~G~~~~~~~lE~~lA~~~--g~   90 (381)
T Consensus        34 ~rg~G~~l~D~dG~~YlD~~sg~~~~~lGH-~~p~v~~Ai~~Q~~-~l~~~~-~~~---~~~~~~~elAe~L~~~~P~~l  107 (467)
T PRK07030         34 KRGEGVWLEDFEGKRYLDAVSSWWVNVFGH-ANPRINQRIKDQVD-QLEHVI-LAG---FSHQPVIELSERLVKITPAGL  107 (467)
T ss_pred             EECCCCEEEECCCCEEEECCCCHHHHCCCC-CCHHHHHHHHHHHH-HCCCCC-CCC---CCCHHHHHHHHHHHHHCCCCC
T ss_conf             936369899799999999454388634148-96999999999997-577724-577---687799999999997388886


Q ss_pred             CCEEEECCCCHHHHHHHHHH---------CCCCCCCCHHHHCCHHHHHHHHHCCCC------------C--EEECC----
Q ss_conf             85167416602456556663---------168971004542026775266640876------------4--03056----
Q gi|254780486|r   91 EKMLYFGSGYAANMAILSTL---------PQATDLIVYDKLVHASIREGINSGKAQ------------A--IAIPH----  143 (381)
Q Consensus        91 e~al~~~sG~~An~~~i~~l---------~~~~d~ii~D~~~HaSi~~g~~ls~a~------------~--~~f~H----  143 (381)
T Consensus       108 ~~v~f~~SGSEAvE~AiKlAr~y~~~~g~~gr~~iis~~~sYHG~T~ga~s~~~~~~~~~~~~p~~~~~~~~p~p~~~~~  187 (467)
T PRK07030        108 DRVFYADNGSSAIEVALKMSFHYWRNRGKPRKKRFVTLTNSYHGETIAAMSVGDVALFTETYKPLLLDTIKVPSPDCYLR  187 (467)
T ss_pred             CEEEEECCCHHHHHHHHHHHHHHHHHHCCCCCEEEEEECCCCCCCCHHHHHHCCCCCCCCCCCCCCCCCEECCCCCCCCC
T ss_conf             87998378489999999999999998089887079873373434217777634870114787787888667589864356


Q ss_pred             -----------CCHHHHHHHHHHHHHCCCCCCCEEEECCC-CCCCCCHHH----HHHHHHHHHHCCEEEEECCCCCCCCC
Q ss_conf             -----------88147899764310002478607971462-157661346----89999986313608986131122234
Q gi|254780486|r  144 -----------NNINSFAENINKWRKSGGKGFPWIVVESI-YSMDGDKAP----LDDLVKIANDYDGFIVVDEAHATGVC  207 (381)
Q Consensus       144 -----------nD~~~Le~~l~~~~~~~~~~~~~vv~egv-~Sm~G~~ap----L~~i~~l~~~y~~~LivDEah~~Gv~  207 (381)
T Consensus       188 ~~g~~~~~~~~~~~~~le~~l~~----~~~~iAAvi~EPiiqg~GG~~~~~~~yl~~lr~lc~~~giLlI~DEV~-tG-f  261 (467)
T PRK07030        188 PEGMSWEEHSRNMFAHMEQTLAE----HHDEIAAVIVEPLIQGAGGMRMYHPVYLKLLREACDRYGVHLIHDEIA-VG-F  261 (467)
T ss_pred             CCCCCHHHHHHHHHHHHHHHHHH----CCCCEEEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHCCCEEECCCCE-EC-C
T ss_conf             67888899999999999999984----799746999823233679972799899999999997559468725003-17-8


Q ss_pred             CCCCCE-EEEEHHCCCCCCCCCCCCCCCCCEE---EEEECCCCCCCCCCC---CCCCEE--CCCCCCCCHHHHHHHHHHH
Q ss_conf             777640-1100001346521001346565302---675245100100001---211000--0135775025789887898
Q gi|254780486|r  208 GPLGKG-LTHIIEERNNVIVMHSCSKALGSSG---ALVGSNKIIYDYLIN---YAKPFI--YTTSPSPILAVVACEALKL  278 (381)
Q Consensus       208 G~~G~G-~~~~~~~~~~~iv~~TlsKa~g~~G---G~i~~~~~ii~~l~~---~~~~~i--fst~l~P~~~aaa~aal~~  278 (381)
T Consensus       262 GRTG~~fa~e~~gv~PDii---t~aKgl~gG~~Pl~av~~~~~I~~~~~~~~~~~~~~~Hg~Ty~GnPlacAAala~L~i  338 (467)
T PRK07030        262 GRTGTMFACEQAGIRPDFL---CLSKALTGGYLPLAAVLTTDTVYQAFYDDYPTLRAFLHSHSYTGNPLACAAALATLDI  338 (467)
T ss_pred             CCCCCCCCCCCCCCCCCEE---EEECCCCCCCCCEEEEEECHHHHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHH
T ss_conf             6245853200567899889---9704311687753899874899987632565555767588999799999999999999


Q ss_pred             HHHCCCHHHHHHHHHHHHHHHHHC--CCC----CCCCCCEEEEEEC-----------CHHHHHHHHHHHHHCCEEEEEEC
Q ss_conf             862710224789999999987641--797----8998972899958-----------97999999999997791898622
Q gi|254780486|r  279 IKRKPALHKSLLQLINITDKIANK--KIG----FSSQSHIQSIVIG-----------DNKSCLNIAKNLQKKGFDIRAIR  341 (381)
Q Consensus       279 l~~~~~~~~~l~~~~~~~~~~~~~--~~g----~~~~s~I~~v~~g-----------d~~~a~~~~~~L~~~Gi~v~~i~  341 (381)
T Consensus       339 i~~e~-l~~~~~~~g~~l~~~l~~l~~~p~VgdVRG~GL~~giElv~d~~t~~p~~~~~~~~~~v~~~~~~~G~l~~~~-  416 (467)
T PRK07030        339 FEQDN-VIEANRALARRMAEATAHLADHPHVAEVRQTGMALAIEMVQDKASKTPYPWQERRGLKVYQHALERGALLRPL-  416 (467)
T ss_pred             HHHCC-HHHHHHHHHHHHHHHHHHHHCCCCEEEEECCCCEEEEEEECCCCCCCCCCHHHHHHHHHHHHHHHCCCEEEEC-
T ss_conf             99768-9999999999999999987079975888347519999970378767888546679999999999789889734-


Q ss_pred             CCCCCCCCCEEEEECCCCCCHHHHHHHHHHHHHHHHHH
Q ss_conf             88888887039996287899999999999999998873
Q gi|254780486|r  342 PPTVPINTARLRISITLNVDEPTIVKLFDILPQIISEG  379 (381)
Q Consensus       342 ~PtVp~~~~rlRi~v~a~~t~edi~~~~~~l~~v~~E~  379 (381)
T Consensus       417 ------g-nvi~~~PPL~it~~eid~~~~~l~~al~~a  447 (467)
T PRK07030        417 ------G-SVVYFLPPYVITPEQIDFLAEVASEGIDIA  447 (467)
T ss_pred             ------C-CEEEEECCCCCCHHHHHHHHHHHHHHHHHH
T ss_conf             ------9-999997992789999999999999999999