HHsearch alignment for GI: 254780486 and conserved domain: PRK07179

>PRK07179 hypothetical protein; Provisional.
Probab=100.00  E-value=0  Score=755.04  Aligned_cols=368  Identities=24%  Similarity=0.369  Sum_probs=341.6

Q ss_pred             HHHHHHHHHHHHHHCCCEEEE--CCCCEEEECCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHH
Q ss_conf             578999999999975983999--289768980344656677988999999999986378688722443688589999999
Q gi|254780486|r    5 QMSFYEERLQKIKSKGRHRQL--LRRQDIWDFTSHDYLALSSSTLLREKILSSLDSKIPIGSGGSRLLCGNYNQHLELEE   82 (381)
Q Consensus         5 ~~~~~~~~l~~~~~~g~~~~~--~~~~~~l~f~s~dYLGl~~~p~v~~a~~~a~~~~~g~~~~~sr~~~G~~~~~~~lE~   82 (381)
T Consensus        28 ~~~~~~~~~~~~~~~~~~~~~g~~~G~~~i~fsSNdYLGLs~hp~v~~a~~~ai-~~~G~g~~~Srl~~G~~~~h~~LE~  106 (408)
T PRK07179         28 RLEKYFEERVNKNWNGKHLVLGKTPGPDAIILQSNDYLNLSGHPDIIKAQIAAL-QEYGDGLVMSAVFLHDDSPKPQFEK  106 (408)
T ss_pred             HHHHHHHHHHCCCCCCCCCCCCCCCCCCEEEEECCCCCCCCCCHHHHHHHHHHH-HHHCCCCCCCCCCCCCCHHHHHHHH
T ss_conf             999999986232458985313588997356857666347889999999999999-9849998746803167589999999


Q ss_pred             HHHHHCCCCCEEEECCCCHHHHHHHHHHCCCCCCCCHHHHCCHHHHHHHHHCCCCCEEECCCCHHHHHHHHHHHHHCCCC
Q ss_conf             98401288851674166024565566631689710045420267752666408764030568814789976431000247
Q gi|254780486|r   83 EAADFFGFEKMLYFGSGYAANMAILSTLPQATDLIVYDKLVHASIREGINSGKAQAIAIPHNNINSFAENINKWRKSGGK  162 (381)
Q Consensus        83 ~lA~~~g~e~al~~~sG~~An~~~i~~l~~~~d~ii~D~~~HaSi~~g~~ls~a~~~~f~HnD~~~Le~~l~~~~~~~~~  162 (381)
T Consensus       107 ~LA~~~g~e~allf~SGy~AN~g~i~aL~~~~d~I~~D~~~HaSi~dG~rls~a~~~~f~HND~~~Le~~L~~~~-----  181 (408)
T PRK07179        107 KLAAFTGFESGLLCQSGWAANVGLLQTIADPNTPVYIDFFAHMSLWEGVRAAGAQAHPFRHNDVDHLRRQIERHG-----  181 (408)
T ss_pred             HHHHHHCCCCEEEECCHHHHHHHHHHHHCCCCCEEEEECCCCHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHCC-----
T ss_conf             999986899299987538999999999679998899988778889876761488579947999999999998469-----


Q ss_pred             CCCEEEECCCCCCCCCHHHHHHHHHHHHHCCEEEEECCCCCCCCCCCCCCEEEEEHHCCCCC-CCCCCCCCCCCCEEEEE
Q ss_conf             86079714621576613468999998631360898613112223477764011000013465-21001346565302675
Q gi|254780486|r  163 GFPWIVVESIYSMDGDKAPLDDLVKIANDYDGFIVVDEAHATGVCGPLGKGLTHIIEERNNV-IVMHSCSKALGSSGALV  241 (381)
Q Consensus       163 ~~~~vv~egv~Sm~G~~apL~~i~~l~~~y~~~LivDEah~~Gv~G~~G~G~~~~~~~~~~~-iv~~TlsKa~g~~GG~i  241 (381)
T Consensus       182 -~~iIv~egVfSMdGDiapL~~l~~la~~y~a~L~VDEAH~~Gv~G~~G~G~~~~~gl~~~vdi~~gTlsKA~G~~GGfi  260 (408)
T PRK07179        182 -PGIIVVDSVYSTTGTIAPLVDIVDIAEEFGCVLVVDESHSLGTHGPQGAGLVAELGLTSRVHFITASLAKAFAGRAGII  260 (408)
T ss_pred             -CCEEEEEECCCCCCCCCCHHHHHHHHHHHCEEEEEECCCEEEEECCCCCCHHHHCCCCCCCEEEEEEHHHHHHHCCCCE
T ss_conf             -9779997423578876689999999987267988614350523679998779984998787289937178676376634


Q ss_pred             ECCCCCCCCCCCCCCCEECCCCCCCCHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHCCCCC---CCCCCEEEEEEC
Q ss_conf             24510010000121100001357750257898878988627102247899999999876417978---998972899958
Q gi|254780486|r  242 GSNKIIYDYLINYAKPFIYTTSPSPILAVVACEALKLIKRKPALHKSLLQLINITDKIANKKIGF---SSQSHIQSIVIG  318 (381)
Q Consensus       242 ~~~~~ii~~l~~~~~~~ifst~l~P~~~aaa~aal~~l~~~~~~~~~l~~~~~~~~~~~~~~~g~---~~~s~I~~v~~g  318 (381)
T Consensus       261 ~gs~~~id~L~~~ar~~IfStal~P~~~aa~~aal~ii~~~~~~r~~L~~n~~~~r~-~L~~~G~~i~~s~spIvpi~~G  339 (408)
T PRK07179        261 TCPAELAEYFPFVSYPAIFSSTLLPHEIAGLEATLEVIESADERRARLHANARFLRE-GLSELGYNIRSSESQIIALETG  339 (408)
T ss_pred             ECCHHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHH-HHHHCCCCCCCCCCCEEEEECC
T ss_conf             237999999997187745566678999999999999986299999999999999999-9983799978999997999859


Q ss_pred             CHHHHHHHHHHHHHCCEEEEEECCCCCCCCCCEEEEECCCCCCHHHHHHHHHHHHHHHHHHC
Q ss_conf             97999999999997791898622888888870399962878999999999999999988738
Q gi|254780486|r  319 DNKSCLNIAKNLQKKGFDIRAIRPPTVPINTARLRISITLNVDEPTIVKLFDILPQIISEGN  380 (381)
Q Consensus       319 d~~~a~~~~~~L~~~Gi~v~~i~~PtVp~~~~rlRi~v~a~~t~edi~~~~~~l~~v~~E~~  380 (381)
T Consensus       340 ~~~~a~~~~~~L~~~Gi~v~~i~~PtVP~g~~rlRislsA~ht~~dId~ll~~l~~~~~e~~  401 (408)
T PRK07179        340 SERNTEVLRDALEERNVFGAVFCAPATPKNRALIRLSLNADLTKSDLDRVLEVCREARDEVD  401 (408)
T ss_pred             CHHHHHHHHHHHHHCCCEEEEECCCCCCCCCEEEEEEECCCCCHHHHHHHHHHHHHHHHHCC
T ss_conf             99999999999997896284167998999981699874877999999999999999999809