HHsearch alignment for GI: 254780486 and conserved domain: PRK09082

>PRK09082 putative aminotransferase; Validated.
Probab=99.89  E-value=3.5e-20  Score=145.96  Aligned_cols=330  Identities=13%  Similarity=0.110  Sum_probs=191.7

Q ss_pred             CCCEEEECCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCC----C-CEEEECCCCH
Q ss_conf             8976898034465667798899999999998637868872244368858999999998401288----8-5167416602
Q gi|254780486|r   27 RRQDIWDFTSHDYLALSSSTLLREKILSSLDSKIPIGSGGSRLLCGNYNQHLELEEEAADFFGF----E-KMLYFGSGYA  101 (381)
Q Consensus        27 ~~~~~l~f~s~dYLGl~~~p~v~~a~~~a~~~~~g~~~~~sr~~~G~~~~~~~lE~~lA~~~g~----e-~al~~~sG~~  101 (381)
T Consensus        28 ~~~~~I~L~~G~P-d~~~P~~i~~a~~~a~~~-~~~~Y~~~~---G~~~LReaiA~~~~~~~g~~~~p~~eI~vT~Ga~~  102 (386)
T PRK09082         28 AEHGAINLSQGFP-DFDGPPRLVEALAYAMAA-GHNQYPPMT---GVAALREAIADKTARLYGRRYDADSEITVTAGATE  102 (386)
T ss_pred             HCCCCEECCCCCC-CCCCCHHHHHHHHHHHHC-CCCCCCCCC---CCHHHHHHHHHHHHHHHCCCCCCCCCEEECCCHHH
T ss_conf             0599887279899-998789999999999965-999898987---71999999999999996899898883898778899


Q ss_pred             HHHHHHHHHCCCCCCCCHHHHCCHHHHHHHHHCCCCCEEECCC------CHHHHHHHHHHHHHCCCCCCCEEEECCCCCC
Q ss_conf             4565566631689710045420267752666408764030568------8147899764310002478607971462157
Q gi|254780486|r  102 ANMAILSTLPQATDLIVYDKLVHASIREGINSGKAQAIAIPHN------NINSFAENINKWRKSGGKGFPWIVVESIYSM  175 (381)
Q Consensus       102 An~~~i~~l~~~~d~ii~D~~~HaSi~~g~~ls~a~~~~f~Hn------D~~~Le~~l~~~~~~~~~~~~~vv~egv~Sm  175 (381)
T Consensus       103 al~~~~~al~~pGD~Vlv~~P~Y~~y~~~~~~~G~~~v~vpl~~~~~~~d~~~l~~~i~------~~tk~iil~sP~NP-  175 (386)
T PRK09082        103 ALFAAILALVRPGDEVIVFDPSYDSYAPAIELAGGRAVRVALQPPDFRVDWQRFAAAIT------PRTRLIILNTPHNP-  175 (386)
T ss_pred             HHHHHHHHHCCCCCEEEEECCCCHHHHHHHHHCCCEEEEECCCCCCCCCCHHHHHHHCC------CCCEEEEECCCCCC-
T ss_conf             99999999759999899926862879999998499899926779888879999996367------57649997999697-


Q ss_pred             CCCHH---HHHHHHHHHHHCCEEEEECCCCCCCCCC-CCCCEEEEEHHCCCCCCCCCCCCCCCCCEE---EEEECCCCCC
Q ss_conf             66134---6899999863136089861311222347-776401100001346521001346565302---6752451001
Q gi|254780486|r  176 DGDKA---PLDDLVKIANDYDGFIVVDEAHATGVCG-PLGKGLTHIIEERNNVIVMHSCSKALGSSG---ALVGSNKIIY  248 (381)
Q Consensus       176 ~G~~a---pL~~i~~l~~~y~~~LivDEah~~Gv~G-~~G~G~~~~~~~~~~~iv~~TlsKa~g~~G---G~i~~~~~ii  248 (381)
T Consensus       176 TG~v~s~~~l~~l~~la~~~~i~ii~DE~Y~~l~~d~~~~~s~~~~~~~~~~~i~i~S~SK~~~~~G~RiG~~v~p~~l~  255 (386)
T PRK09082        176 SGTVWSAADMDALAQLIAGTDILVLSDEVYEHIVFDGQGHASVLRHPELRERAFVVSSFGKTYHVTGWKVGYCVAPAALS  255 (386)
T ss_pred             CCCCCCHHHHHHHHHHHHHCCCEEEECCCHHHHCCCCCCCCCHHHCCCCCCCCCCCCCCCCCCCCCCCCEEEEEECHHHH
T ss_conf             36013635599999999981947971122233113898886844486533454443244424578751059998789999


Q ss_pred             CCCCCCCCCEECCCCCCCCHHHHHHHHHHHHHHCCCHHHH----HHHHHHHH-HHHHHCCCCC-CCCCCE-EEEEECC--
Q ss_conf             0000121100001357750257898878988627102247----89999999-9876417978-998972-8999589--
Q gi|254780486|r  249 DYLINYAKPFIYTTSPSPILAVVACEALKLIKRKPALHKS----LLQLINIT-DKIANKKIGF-SSQSHI-QSIVIGD--  319 (381)
Q Consensus       249 ~~l~~~~~~~ifst~l~P~~~aaa~aal~~l~~~~~~~~~----l~~~~~~~-~~~~~~~~g~-~~~s~I-~~v~~gd--  319 (381)
T Consensus       256 ~~~~~~-~~~~~~~~~~~~Q~-a~a~~---l~~~~~~~~~~~~~y~~rrd~l~~~L~~~~~~~~~~~G~~f~~~~~~~~~  330 (386)
T PRK09082        256 AEFRKV-HQYNTFTVNTPAQL-ALADY---LRAEPEHYLELPAFYQAKRDRFRAALANSRFKLLPCEGTYFQLVDYSAIS  330 (386)
T ss_pred             HHHHHH-HHHCCCCCCHHHHH-HHHHH---HHCCCHHHHHHHHHHHHHHHHHHHHHHHCCCEEECCCCEEEEEEECCCCC
T ss_conf             999999-98645787689999-99999---96695899999999999999999999867988847992599988603489


Q ss_pred             HHHHHHHHHHH-HHCCEEEEEE-CCCCCCCCCCEEEEECCCCCCHHHHHHHHHHHHHH
Q ss_conf             79999999999-9779189862-28888888703999628789999999999999999
Q gi|254780486|r  320 NKSCLNIAKNL-QKKGFDIRAI-RPPTVPINTARLRISITLNVDEPTIVKLFDILPQI  375 (381)
Q Consensus       320 ~~~a~~~~~~L-~~~Gi~v~~i-~~PtVp~~~~rlRi~v~a~~t~edi~~~~~~l~~v  375 (381)
T Consensus       331 ~~~~~~f~~~l~~e~gV~v~PG~~F~~~~~~~~~iRl~fa~--~~e~l~ea~~RLakl  386 (386)
T PRK09082        331 DLNDVEFCQWLTREHGVAAIPLSVFYADPFPHRLVRFCFAK--QEETLDAAAERLCQL  386 (386)
T ss_pred             CCCHHHHHHHHHHHCCEEEECCHHHCCCCCCCCEEEEEECC--CHHHHHHHHHHHHHC
T ss_conf             98999999999985899998271105799999979999689--999999999998429