HHsearch alignment for GI: 254780486 and conserved domain: TIGR00699

>TIGR00699 GABAtrns_euk 4-aminobutyrate aminotransferase; InterPro: IPR004631 4-aminobutyrate aminotransferase eukaryotic (2.6.1.19 from EC) is a class III pyridoxal-phosphate-dependent aminotransferase. The enzyme catalyses the conversion of 4-aminobutanoate and 2-oxoglutarate into succinate semialdehyde and L-glutamate. The degree of sequence difference between this set and known bacterial examples is greater than the distance between either set the most similar enzyme with distinct function, and so the prokaryotic and eukaryotic sets have been placed into separate families. This family describes known eukaryotic examples of the enzyme. Alternate names include GABA transaminase, gamma-amino-N-butyrate transaminase, and beta-alanine--oxoglutarate aminotransferase.; GO: 0003867 4-aminobutyrate transaminase activity, 0009448 gamma-aminobutyric acid metabolic process.
Probab=99.62  E-value=1.2e-13  Score=105.14  Aligned_cols=330  Identities=19%  Similarity=0.226  Sum_probs=204.3

Q ss_pred             HHCCCEEEECCCCEEEECCCCC---CCCCCCCHHHHHHHHHH-----HHHHCCCCCCCCCCCCCCCHHHHHHHHHHH---
Q ss_conf             9759839992897689803446---56677988999999999-----986378688722443688589999999984---
Q gi|254780486|r   17 KSKGRHRQLLRRQDIWDFTSHD---YLALSSSTLLREKILSS-----LDSKIPIGSGGSRLLCGNYNQHLELEEEAA---   85 (381)
Q Consensus        17 ~~~g~~~~~~~~~~~l~f~s~d---YLGl~~~p~v~~a~~~a-----~~~~~g~~~~~sr~~~G~~~~~~~lE~~lA---   85 (381)
T Consensus        47 kS~GNYl~DvDGN~lLDlYsQIsSiPiGY-NnP~L~K~a~sPe~a~~LinRPAL---------Gnfp~~-~l~~~~~~g~  115 (469)
T TIGR00699        47 KSVGNYLVDVDGNVLLDLYSQISSIPIGY-NNPALLKAAQSPEMATTLINRPAL---------GNFPSK-DLAKILKSGI  115 (469)
T ss_pred             HCCCCEEEEECCCHHHHHHHHHHHCCCCC-CCHHHHHHHCCHHHHHHHHCCCCC---------CCCCHH-HHHHHHCCCC
T ss_conf             11576456314304788887775212246-687899865172457886447301---------467667-9999854881


Q ss_pred             -HH--CCCCCEEEECCCCHHHHHHHHHHC------CCC--CCCCHHHHCCHHHHHHH---------------------HH
Q ss_conf             -01--288851674166024565566631------689--71004542026775266---------------------64
Q gi|254780486|r   86 -DF--FGFEKMLYFGSGYAANMAILSTLP------QAT--DLIVYDKLVHASIREGI---------------------NS  133 (381)
Q Consensus        86 -~~--~g~e~al~~~sG~~An~~~i~~l~------~~~--d~ii~D~~~HaSi~~g~---------------------~l  133 (381)
T Consensus       116 ~k~aPKg~~~v~~~~aG~dane~AfK~af~yYr~~~RGGp~~~Fs~eE~~s~m~N~~PG~P~~siLSF~~aFHGRlfGsL  195 (469)
T TIGR00699       116 LKVAPKGQDSVYRAMAGSDANELAFKAAFMYYRSKQRGGPERDFSEEENESCMVNQAPGSPDLSILSFKAAFHGRLFGSL  195 (469)
T ss_pred             HHHCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCCCCCCCHHHHHHHHCCCCCCCCHHHHHHHCCCCHHHHHHHH
T ss_conf             23245210301144666426789999999999835898887531178877643168755850788852343103444420


Q ss_pred             CCCC----------CEEECCCC----------------------HHHHHHHHHHHHHCCCCCCCEEEECCCCCCCCCH--
Q ss_conf             0876----------40305688----------------------1478997643100024786079714621576613--
Q gi|254780486|r  134 GKAQ----------AIAIPHNN----------------------INSFAENINKWRKSGGKGFPWIVVESIYSMDGDK--  179 (381)
Q Consensus       134 s~a~----------~~~f~HnD----------------------~~~Le~~l~~~~~~~~~~~~~vv~egv~Sm~G~~--  179 (381)
T Consensus       196 sTT~SKpiHKlD~PaF~WP~A~FP~LkYPLeE~~~~N~~Ee~rCL~~vE~L~~~~~~p-krtVaA~IvEPIQSEGGDNHA  274 (469)
T TIGR00699       196 STTRSKPIHKLDIPAFDWPQAPFPSLKYPLEEHVEENAKEEQRCLEEVEDLIKKWHKP-KRTVAAIIVEPIQSEGGDNHA  274 (469)
T ss_pred             HHCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHCCCC-CCEEEEEEECCCCCCCCCCCC
T ss_conf             0034776031786577746777876678702325754558889999999999731798-615888886243478885343


Q ss_pred             H--HHHHHHHHHHHCCEEEEECCCCCCCCCCCCCC-EEEEEHHCC-CCCCCCCCCCCCCCCEEEEEECCCCCCCCCCCCC
Q ss_conf             4--68999998631360898613112223477764-011000013-4652100134656530267524510010000121
Q gi|254780486|r  180 A--PLDDLVKIANDYDGFIVVDEAHATGVCGPLGK-GLTHIIEER-NNVIVMHSCSKALGSSGALVGSNKIIYDYLINYA  255 (381)
Q Consensus       180 a--pL~~i~~l~~~y~~~LivDEah~~Gv~G~~G~-G~~~~~~~~-~~~iv~~TlsKa~g~~GG~i~~~~~ii~~l~~~~  255 (381)
T Consensus       275 S~~Ff~KLr~i~~k~~v~FivDEVQ-TG-vGaTGklWAHe~W~L~~P~D~v--tFSKK~q-tAGyFFH~~~lrP---n--  344 (469)
T TIGR00699       275 SPDFFRKLRDITKKHNVAFIVDEVQ-TG-VGATGKLWAHEHWNLDDPPDMV--TFSKKFQ-TAGYFFHDPALRP---N--  344 (469)
T ss_pred             CHHHHHHHHHHHHHCCCEEEEEEEE-EC-CCCCCCCCCCCCCCCCCCCCCE--EECHHHH-CCCCCCCCCCCCC---C--
T ss_conf             3788899999998859568996455-08-7886331230027411138502--2045641-2764236735688---8--


Q ss_pred             CCE-ECCCC-CCCCHHHHHHHHHHHHHHCCCHHHHHHHHHHHH----HHHHHCCCC----C--CCCCCEEEEEECCHHHH
Q ss_conf             100-00135-775025789887898862710224789999999----987641797----8--99897289995897999
Q gi|254780486|r  256 KPF-IYTTS-PSPILAVVACEALKLIKRKPALHKSLLQLINIT----DKIANKKIG----F--SSQSHIQSIVIGDNKSC  323 (381)
Q Consensus       256 ~~~-ifst~-l~P~~~aaa~aal~~l~~~~~~~~~l~~~~~~~----~~~~~~~~g----~--~~~s~I~~v~~gd~~~a  323 (381)
T Consensus       345 ~pYr~FNTW~GdP~r~l~~~~i~~eI~~~~-L~~n~~~~Gd~Ly~GLe~L~~~YP~~~~nlRGKGrGTFiawD~p~~a~R  423 (469)
T TIGR00699       345 KPYRQFNTWMGDPSRALILREIIQEIKRKD-LLNNVAAVGDYLYTGLEDLQKKYPEKVQNLRGKGRGTFIAWDTPDEAKR  423 (469)
T ss_pred             CCCCCCCCCCCCHHHHHHHHHHHHHHHHHH-HHHHHHHHHHHHHHHHHHHHHHCCHHHHCCCCCCCCCEEECCCCCHHHH
T ss_conf             440003544577889999998887642257-7888998767889989999975013440344676421574049887888


Q ss_pred             HHHHHHHHHCCEEEEEECCCCCCCCCCEEEEECCCCCCHHHHHHHHHHHHHHH
Q ss_conf             99999999779189862288888887039996287899999999999999998
Q gi|254780486|r  324 LNIAKNLQKKGFDIRAIRPPTVPINTARLRISITLNVDEPTIVKLFDILPQII  376 (381)
Q Consensus       324 ~~~~~~L~~~Gi~v~~i~~PtVp~~~~rlRi~v~a~~t~edi~~~~~~l~~v~  376 (381)
T Consensus       424 d~l~~~~r~~Gvn~GGc-------G~~aiRLRP~LvF~~hHA~ilL~~~~~~~  469 (469)
T TIGR00699       424 DKLLLKARLNGVNIGGC-------GVKAIRLRPMLVFQKHHADILLEAIEKII  469 (469)
T ss_pred             HHHHHHHCCCCEEECCC-------CCCCEECCCCHHHHHHHHHHHHHHHHHCC
T ss_conf             99999622382576265-------35424237530103556899999986309