RPSBLAST alignment for GI: 254780486 and conserved domain: PLN03227

>gnl|CDD|178766 PLN03227, PLN03227, serine palmitoyltransferase-like protein; Provisional. Length = 392
 Score =  110 bits (277), Expect = 6e-25
 Identities = 77/300 (25%), Positives = 133/300 (44%), Gaps = 12/300 (4%)

Query: 34  FTSHDYLALSSSTLLREKILSSLDSKIPIGSGGSRLLCGNYNQHLELEEEAADFFGFEKM 93
           F +HD+L+ SSS  LR+  L SL      GS G R   G  + HLELE+  A+F G E  
Sbjct: 3   FATHDFLSTSSSPTLRQTALESLS-HYGCGSCGPRGFYGTIDAHLELEQCMAEFLGTESA 61

Query: 94  LYFGSGYAANMAILSTLPQATDLIVYDKLVHASIREGINSGKAQAIAIPHNNINSFAENI 153
           + +  G +   + ++   +  DL+V D+ V+ ++  G++  +A      HN++      +
Sbjct: 62  ILYSDGASTTSSTVAAFAKRGDLLVVDRGVNEALLVGVSLSRANVRWFRHNDMKDLRRVL 121

Query: 154 NKWRKS--GGKGFP-----WIVVESIYSMDGDKAPLDDLVKIANDYDGFIVVDEAHATGV 206
            + R      K  P     ++VVE +Y   G  APL +LV +  ++   +++DE+ + G 
Sbjct: 122 EQVRAQDVALKRKPTDQRRFLVVEGLYKNTGTLAPLKELVALKEEFHYRLILDESFSFGT 181

Query: 207 CGPLGKGLTHIIEERNNV---IVMHSCSKALGSSGALVGSNKIIYDYLINYAKPFIYTTS 263
            G  G+G       +  V   IV  S   A GS G +   ++ + D+       + ++ S
Sbjct: 182 LGKSGRGSLEHAGLKPMVHAEIVTFSLENAFGSVGGMTVGSEEVVDHQRLSGSGYCFSAS 241

Query: 264 PSPILAVVACEALKLIKRKPALHKSLLQLI-NITDKIANKKIGFSSQSHIQSIVIGDNKS 322
             P LA     A       P L   L   I N+   + N    ++ +   + ++  D  S
Sbjct: 242 APPFLAKADATATAGELAGPQLLNRLHDSIANLYSTLTNSSHPYALKLRNRLVITSDPIS 301