HHsearch alignment for GI: 254780487 and conserved domain: cd00984

>cd00984 DnaB_C DnaB helicase C terminal domain. The hexameric helicase DnaB unwinds the DNA duplex at the chromosome replication fork. Although the mechanism by which DnaB both couples ATP hydrolysis to translocation along DNA and denatures the duplex is unknown, a change in the quaternary structure of the protein involving dimerization of the N-terminal domain has been observed and may occur during the enzymatic cycle. This C-terminal domain contains an ATP-binding site and is therefore probably the site of ATP hydrolysis.
Probab=91.93  E-value=0.94  Score=24.13  Aligned_cols=30  Identities=27%  Similarity=0.373  Sum_probs=22.7

Q ss_pred             EEEEECCCCCCCHHHHHHHHHHHH-HCCCCC
Q ss_conf             299983589874799999999998-404861
Q gi|254780487|r    4 RLVIVGTDTSVGKTIFASALVHAL-NAYYWK   33 (217)
Q Consensus         4 ~i~I~GT~t~vGKT~vs~~L~~~l-~~~~~K   33 (217)
T Consensus        14 ~L~vi~a~~g~GKS~~~~~la~~~a~~~g~~   44 (242)
T cd00984          14 DLIIIAARPSMGKTAFALNIAENIAKKQGKP   44 (242)
T ss_pred             CEEEEEECCCCCHHHHHHHHHHHHHHHCCCC
T ss_conf             1899996899999999999999999977995