>cd02035 ArsA ArsA ATPase functionas as an efflux pump located on the inner membrane of the cell. This ATP-driven oxyanion pump catalyzes the extrusion of arsenite, antimonite and arsenate. Maintenance of a low intracellular concentration of oxyanion produces resistance to the toxic agents. The pump is composed of two subunits, the catalytic ArsA subunit and the membrane subunit ArsB, which are encoded by arsA and arsB genes respectively. Arsenic efflux in bacteria is catalyzed by either ArsB alone or by ArsAB complex. The ATP-coupled pump, however, is more efficient. ArsA is composed of two homologous halves, A1 and A2, connected by a short linker sequence.

Probab=98.38 E-value=7.3e-06 Score=56.15 Aligned_cols=71 Identities=11% Similarity=0.036 Sum_probs=48.9 Q ss_pred HHHCCEEEEECCCCCCCCCCCCCCHHHHHHH-HCCCEEEEECCCCCHHHHHHHHHHHHHHCCCEEEEEEECCCCC Q ss_conf 2328879992276555667675308999997-4794489705776504579999999984799079999769778 Q gi|254780487|r 91 PDINDSIIIEGIGGLLVPLTTEYLFIDLIER-WQFPIILCARTSLGTINHSLLSLETLRNRNINIIGIAFIGDSM 164 (217) Q Consensus 91 ~~~~D~viIEGagg~~~~~~~~~~~~dla~~-l~~~vILV~~~~~g~i~~~~l~~~~~~~~g~~i~GiIlN~~~~ 164 (217) T Consensus 111 ~~~yD~IVvDtpP---TGhtlrlL~~~~L~d~~~t~~~lVt~Pe~~~~~et~r~~~~L~~~gi~v~~vVvN~v~p 182 (217) T cd02035 111 EGLYDVIVFDTAP---TGHTLRLLVRELLTDPERTSFRLVTLPEKLPLYETERAITELALYGIPVDAVVVNRVLP 182 (217) T ss_pred CCCCCEEEECCCC---CHHHHHHHHHHHHCCCCCCEEEEEECCCCCHHHHHHHHHHHHHHCCCCCCEEEEECCCC T ss_conf 4899889982898---55699986788724888767999957762179999999999997799889898958827

HHsearch alignment for GI: 254780487 and conserved domain: cd02035