BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780487|ref|YP_003064900.1| dithiobiotin synthetase [Candidatus Liberibacter asiaticus str. psy62] (217 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780487|ref|YP_003064900.1| dithiobiotin synthetase [Candidatus Liberibacter asiaticus str. psy62] Length = 217 Score = 440 bits (1132), Expect = e-126, Method: Compositional matrix adjust. Identities = 217/217 (100%), Positives = 217/217 (100%) Query: 1 MKLRLVIVGTDTSVGKTIFASALVHALNAYYWKPIQSGMYEETDSKTIHRIGRIPKSHII 60 MKLRLVIVGTDTSVGKTIFASALVHALNAYYWKPIQSGMYEETDSKTIHRIGRIPKSHII Sbjct: 1 MKLRLVIVGTDTSVGKTIFASALVHALNAYYWKPIQSGMYEETDSKTIHRIGRIPKSHII 60 Query: 61 PEKWKLRTPASPHLAAEIDGVIIDPATINPPDINDSIIIEGIGGLLVPLTTEYLFIDLIE 120 PEKWKLRTPASPHLAAEIDGVIIDPATINPPDINDSIIIEGIGGLLVPLTTEYLFIDLIE Sbjct: 61 PEKWKLRTPASPHLAAEIDGVIIDPATINPPDINDSIIIEGIGGLLVPLTTEYLFIDLIE 120 Query: 121 RWQFPIILCARTSLGTINHSLLSLETLRNRNINIIGIAFIGDSMPKVEETIVKIGRIPHL 180 RWQFPIILCARTSLGTINHSLLSLETLRNRNINIIGIAFIGDSMPKVEETIVKIGRIPHL Sbjct: 121 RWQFPIILCARTSLGTINHSLLSLETLRNRNINIIGIAFIGDSMPKVEETIVKIGRIPHL 180 Query: 181 GRLPKIDPIDPDVLHQKFQEHFTQSLLQKYFYESLTF 217 GRLPKIDPIDPDVLHQKFQEHFTQSLLQKYFYESLTF Sbjct: 181 GRLPKIDPIDPDVLHQKFQEHFTQSLLQKYFYESLTF 217 >gi|254780270|ref|YP_003064683.1| ATP-dependent protease La [Candidatus Liberibacter asiaticus str. psy62] Length = 820 Score = 27.3 bits (59), Expect = 0.23, Method: Compositional matrix adjust. Identities = 15/44 (34%), Positives = 22/44 (50%), Gaps = 2/44 (4%) Query: 14 VGKTIFASALVHALNAYYWKPIQSGMYEETDSKTIHR--IGRIP 55 VGKT A ++ A Y + G+Y+E D + R IG +P Sbjct: 377 VGKTSLAQSIAKATGRQYVRMSLGGVYDEADIRGHRRTYIGSMP 420 >gi|254780648|ref|YP_003065061.1| GTPase ObgE [Candidatus Liberibacter asiaticus str. psy62] Length = 335 Score = 23.1 bits (48), Expect = 3.8, Method: Compositional matrix adjust. Identities = 12/34 (35%), Positives = 18/34 (52%) Query: 183 LPKIDPIDPDVLHQKFQEHFTQSLLQKYFYESLT 216 L +ID +D D L +K E TQ + + S+T Sbjct: 278 LSQIDTVDSDTLARKKNELATQCGQVPFEFSSIT 311 >gi|254781149|ref|YP_003065562.1| replicative DNA helicase [Candidatus Liberibacter asiaticus str. psy62] Length = 266 Score = 21.9 bits (45), Expect = 8.3, Method: Compositional matrix adjust. Identities = 11/28 (39%), Positives = 19/28 (67%), Gaps = 2/28 (7%) Query: 5 LVIVGTDTSVGKTIFA--SALVHALNAY 30 L+++G S+GKT FA +AL A++ + Sbjct: 144 LILIGARPSMGKTTFALSTALHMAMSGH 171 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.322 0.141 0.424 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 144,354 Number of Sequences: 1233 Number of extensions: 6160 Number of successful extensions: 19 Number of sequences better than 100.0: 11 Number of HSP's better than 100.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 9 Number of HSP's gapped (non-prelim): 11 length of query: 217 length of database: 328,796 effective HSP length: 70 effective length of query: 147 effective length of database: 242,486 effective search space: 35645442 effective search space used: 35645442 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 36 (18.5 bits)