HHsearch alignment for GI: 254780489 and conserved domain: PRK08242

>PRK08242 acetyl-CoA acetyltransferase; Validated.
Probab=99.47  E-value=3.9e-12  Score=99.18  Aligned_cols=98  Identities=15%  Similarity=0.095  Sum_probs=80.9

Q ss_pred             CCCCHHHHHHHHHHHHHHHCCCCCCCCCEEEEEEEEECC-CCCCCCCCCCCCCCCC-CCCCCCCCCCCCCCHHHHHHHHH
Q ss_conf             988799999999999864301322234425884310023-6887432211210023-86333421012310125676578
Q gi|254780489|r   50 KHETLTDIAIQAGDIALRNANIKKDSISLTLLATSTPDH-LLPPSSPLITHRLGLM-QSGAIDLTGACAGFLYALVMADS  127 (325)
Q Consensus        50 ~~e~~~~la~~Aa~~aL~~a~~~~~dId~ii~~s~t~d~-~~P~~a~~v~~~Lg~~-~~~~~di~~~C~g~l~aL~~A~~  127 (325)
T Consensus        24 ~~~~~~~L~a~~i~~~l~r~~i~~~~Id~vi~G~v~~~g~~g~n~aR~~al~aGlp~~vpa~TVnr~C~SGl~Ai~~Aa~  103 (402)
T PRK08242         24 HEVKPVRLAAGLLNALRDRNGLDTAAVDDVVLGCVTPVGDQGADIARTAVLAAGLPETVPGVQINRFCASGLEAVNLAAA  103 (402)
T ss_pred             CCCCHHHHHHHHHHHHHHHCCCCHHHCCEEEEEECCCCCCCCCCHHHHHHHHCCCCCCCCEEEECCCCHHHHHHHHHHHH
T ss_conf             98989999999999999870989899997999807765544577999999976999888647884505578999999999


Q ss_pred             HHHCCC-CEEEEEEECCCCCC
Q ss_conf             874388-50588620122444
Q gi|254780489|r  128 YINSHQ-KPVLIIAANLLSRR  147 (325)
Q Consensus       128 ~i~~g~-~~vLVv~~e~~S~~  147 (325)
T Consensus       104 ~I~~G~~dv~iAGGvEsmS~~  124 (402)
T PRK08242        104 KVRSGWDDLVIAGGVESMSRV  124 (402)
T ss_pred             HHHCCCCCEEEECCCCCCCCC
T ss_conf             996699888997661345657