>TIGR01930 AcCoA-C-Actrans acetyl-CoA acetyltransferases; InterPro: IPR002155 Two different types of thiolase , , are found both in eukaryotes and in prokaryotes: acetoacetyl-CoA thiolase (2.3.1.9 from EC) and 3-ketoacyl-CoA thiolase (2.3.1.16 from EC). 3-ketoacyl-CoA thiolase (also called thiolase I) has a broad chain-length specificity for its substrates and is involved in degradative pathways such as fatty acid beta-oxidation. Acetoacetyl-CoA thiolase (also called thiolase II) is specific for the thiolysis of acetoacetyl-CoA and involved in biosynthetic pathways such as poly beta-hydroxybutyrate synthesis or steroid biogenesis. In eukaryotes, there are two forms of 3-ketoacyl-CoA thiolase: one located in the mitochondrion and the other in peroxisomes. There are two conserved cysteine residues important for thiolase activity. The first located in the N-terminal section of the enzymes is involved in the formation of an acyl-enzyme intermediate; the second located at the C-terminal extremity is the active site base involved in deprotonation in the condensation reaction. Mammalian nonspecific lipid-transfer protein (nsL-TP) (also known as sterol carrier protein 2) is a protein which seems to exist in two different forms: a 14 Kd protein (SCP-2) and a larger 58 Kd protein (SCP-x). The former is found in the cytoplasm or the mitochondria and is involved in lipid transport; the latter is found in peroxisomes. The C-terminal part of SCP-x is identical to SCP-2 while the N-terminal portion is evolutionary related to thiolases ..

Probab=96.31 E-value=0.002 Score=42.32 Aligned_cols=132 Identities=20% Similarity=0.241 Sum_probs=77.1 Q ss_pred CCCCCEEEEEECCCCCCCCCCC--EEE-EEEECCCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCH-HHHHHHCCCHHHH Q ss_conf 2544200112205765444531--135-53213677652783069866765445565523224514-5434320100367 Q gi|254780489|r 158 IFGDAAGAVVLAPSPLKDKSGI--LGI-ELTSDGSKYDLIKIPTGGSTSPAGTNTHDFYMRITNGA-DIFYNAVKIMAQS 233 (325) Q Consensus 158 lfGDgA~A~il~~~~~~~~~~i--l~~-~~~s~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~-~v~~~~~~~~~~~ 233 (325) T Consensus 283 ~~nDGA~a~~lmSe~~a~~lGL~~~PlA~i~~~~~---------------~G~-----------dP~~~mg~G---P~~A 333 (447) T TIGR01930 283 PLNDGAAALLLMSEEKAKELGLNKTPLARIVSFAV---------------AGV-----------DPVEIMGLG---PVPA 333 (447) T ss_pred CHHHHHHHHHHHHHHHHHHHCCCCCEEEEEEEEEE---------------ECC-----------CHHHHHCCC---CHHH T ss_conf 21235642566507999980889942689941033---------------305-----------748861677---5889 Q ss_pred HHHHHHHHCCCCCCCCEEEECCCCCHHHHHHHHHCC---------------C--CHHHHHHHHH--HCCCCC---CCHHH Q ss_conf 898899740120012246305654138999999719---------------7--8657002185--409330---00599 Q gi|254780489|r 234 AKQSLRKSDLQPQDINRFIPHQANSRIIQKVCEKIG---------------L--SKRIMVNSLK--DFGNSS---SASIP 291 (325) Q Consensus 234 i~~~l~~~gl~~~did~~i~Hq~~~~~~~~~~~~lg---------------i--~~~~~~~~l~--~~GN~~---sAsi~ 291 (325) T Consensus 334 ~~~aL~kaGL~~~diDl~E~NEAFAaqvL~~~~~L~~~~~~~~~LG~~~a~~~~~~~k~NvnGGAIAlGHPlGasGARi~ 413 (447) T TIGR01930 334 IPKALKKAGLSISDIDLFEINEAFAAQVLASIKELGLDDYIRQALGRDTALLDIDLEKVNVNGGAIALGHPLGASGARIV 413 (447) T ss_pred HHHHHHHHCCCHHHCCHHHHHHHHHHHHHHHHHHHCCHHHHHHHCCCCCEECCCCCCCCCCCCCHHHCCCCCCCHHHHHH T ss_conf 99999984987335031013678999999999971784688863041110025861241766532111630023188999 Q ss_pred HHHHHHHHHC--CCCCCCEEEEEEECCCC Q ss_conf 9999999806--78999899999861551 Q gi|254780489|r 292 LSLSLENQRK--PFQKGEKILTISCRRGN 318 (325) Q Consensus 292 ~~L~~~~~~g--~i~~Gd~vll~~~G~G~ 318 (325) T Consensus 414 ~tL~~~L~~~~~g~~~G~at~C~GGGqG~ 442 (447) T TIGR01930 414 TTLLHELKRRKKGKRYGLATLCVGGGQGA 442 (447) T ss_pred HHHHHHHHHCCCCCCHHHHHHHHHHHHCE T ss_conf 99999998514895301666444550000

HHsearch alignment for GI: 254780489 and conserved domain: TIGR01930