BLAST/PSIBLAST alignment of GI: 254780489 and GI: 148558468 at iteration 1
>gi|148558468|ref|YP_001257462.1| 3-oxoacyl-(acyl carrier protein) synthase II [Brucella ovis ATCC 25840] Length = 326
>gi|148369753|gb|ABQ62625.1| putative 3-oxoacyl-(acyl-carrier-protein) synthase III [Brucella ovis ATCC 25840] Length = 326
 Score =  328 bits (840), Expect = 9e-88,   Method: Compositional matrix adjust.
 Identities = 160/323 (49%), Positives = 224/323 (69%), Gaps = 5/323 (1%)

Query: 1   MIKSSSCILGFGHAVPNQCIHNSIIERHLNLKLGVIEQKTGIKYRYWAEKHETLTDIAIQ 60
           M   SS + GFGHAVP++ + N+ IE  L L+ G IE++TGI+ R WA   ETL+ +A  
Sbjct: 1   MTVCSSRLAGFGHAVPDRRVENAEIEAQLGLETGWIERRTGIRCRRWAMPDETLSHLAAS 60

Query: 61  AGDIALRNANIKKDSISLTLLATSTPDHLLPPSSPLITHRLGLMQSGAIDLTGACAGFLY 120
           A D+AL +A I++  I+LTLLATSTPDHLLPP++PL+TH L L  SGA DL GAC GFLY
Sbjct: 61  AADMALSDAGIERSDIALTLLATSTPDHLLPPTAPLLTHWLNLQNSGAADLAGACTGFLY 120

Query: 121 ALVMADSYINSHQKPVLIIAANLLSRRINLEDKDTAIIFGDAAGAVVLAPSPLKDKSGIL 180
           ALV+AD ++ +  KPVL++AANLLSRRIN+ ++ +A++FGDAAGAVVLAPS    K+   
Sbjct: 121 ALVLADGFVRAQGKPVLVVAANLLSRRINMAERASAVLFGDAAGAVVLAPSA---KANSF 177

Query: 181 GIELTSDGSKYDLIKIPTGGSTSPAG--TNTHDFYMRITNGADIFYNAVKIMAQSAKQSL 238
             +  ++GS YDLIK+P GGS        +  +F M + +G  +F  AV+IM+ +++  L
Sbjct: 178 QSQFITNGSHYDLIKVPAGGSARAYAPERDASEFLMTMQDGRAVFTEAVRIMSGASQNVL 237

Query: 239 RKSDLQPQDINRFIPHQANSRIIQKVCEKIGLSKRIMVNSLKDFGNSSSASIPLSLSLEN 298
             + + PQ I+RF PHQAN RI+ KVCE IG+ +    ++L+ +GNSS+A+IPLSLSL N
Sbjct: 238 ASAAMLPQAIDRFFPHQANIRIVDKVCETIGVPRAKAASTLETYGNSSAATIPLSLSLAN 297

Query: 299 QRKPFQKGEKILTISCRRGNDRG 321
             +P ++GE++L  +   G   G
Sbjct: 298 LEQPLREGERLLFATAGAGMTGG 320