RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254780490|ref|YP_003064903.1| site-specific tyrosine recombinase XerC [Candidatus Liberibacter asiaticus str. psy62] (67 letters) >gnl|CDD|178942 PRK00236, xerC, site-specific tyrosine recombinase XerC; Reviewed. Length = 297 Score = 109 bits (275), Expect = 2e-25 Identities = 35/56 (62%), Positives = 45/56 (80%) Query: 4 TAHTLRHSFATHLLSNGGDLRSIQSILGHSRLSTTQIYTNVNSKRMMEIYDQTHPS 59 T H LRHSFATHLL +GGDLR++Q +LGH+ LSTTQIYT+V+ + + E+YD HP Sbjct: 241 TPHKLRHSFATHLLESGGDLRAVQELLGHASLSTTQIYTHVDFQHLAEVYDAAHPR 296 >gnl|CDD|162771 TIGR02224, recomb_XerC, tyrosine recombinase XerC. The phage integrase family describes a number of recombinases with tyrosine active sites that transiently bind covalently to DNA. Many are associated with mobile DNA elements, including phage, transposons, and phase variation loci. This model represents XerC, one of two closely related chromosomal proteins along with XerD (TIGR02225). XerC and XerD are site-specific recombinases which help resolve chromosome dimers to monomers for cell division after DNA replication. In species with a large chromosome and homologs of XerC on other replicons, the chomosomal copy was preferred for building this model. This model does not detect all XerC, as some apparent XerC examples score in the gray zone between trusted (450) and noise (410) cutoffs, along with some XerD examples. XerC and XerD interact with cell division protein FtsK. Length = 295 Score = 102 bits (257), Expect = 2e-23 Identities = 34/55 (61%), Positives = 44/55 (80%) Query: 4 TAHTLRHSFATHLLSNGGDLRSIQSILGHSRLSTTQIYTNVNSKRMMEIYDQTHP 58 H LRHSFATHLL NG DLR++Q +LGH+ LSTTQIYT+V+ + + ++YDQ HP Sbjct: 237 HPHALRHSFATHLLENGADLRAVQELLGHASLSTTQIYTHVDFQHLAKVYDQAHP 291 >gnl|CDD|162772 TIGR02225, recomb_XerD, tyrosine recombinase XerD. The phage integrase family describes a number of recombinases with tyrosine active sites that transiently bind covalently to DNA. Many are associated with mobile DNA elements, including phage, transposons, and phase variation loci. This model represents XerD, one of two closely related chromosomal proteins along with XerC (TIGR02224). XerC and XerD are site-specific recombinases which help resolve chromosome dimers to monomers for cell division after DNA replication. In species with a large chromosome and with homologs of XerD on other replicons, the chomosomal copy was preferred for building this model. This model does not detect all XerD, as some apparent XerD examples score below the trusted and noise cutoff scores. XerC and XerD interact with cell division protein FtsK. Length = 291 Score = 98.8 bits (247), Expect = 3e-22 Identities = 33/55 (60%), Positives = 44/55 (80%) Query: 4 TAHTLRHSFATHLLSNGGDLRSIQSILGHSRLSTTQIYTNVNSKRMMEIYDQTHP 58 + HTLRHSFATHLL NG DLR +Q +LGH+ +STTQIYT+V +R+ E++ + HP Sbjct: 235 SPHTLRHSFATHLLENGADLRVVQELLGHADISTTQIYTHVARERLKEVHKKHHP 289 >gnl|CDD|178959 PRK00283, xerD, site-specific tyrosine recombinase XerD; Reviewed. Length = 299 Score = 94.5 bits (236), Expect = 5e-21 Identities = 32/53 (60%), Positives = 44/53 (83%) Query: 6 HTLRHSFATHLLSNGGDLRSIQSILGHSRLSTTQIYTNVNSKRMMEIYDQTHP 58 H LRH+FATHLL++G DLR +Q +LGHS +STTQIYT+V ++R+ E++ Q HP Sbjct: 245 HVLRHAFATHLLNHGADLRVVQELLGHSDISTTQIYTHVATERLKELHAQHHP 297 >gnl|CDD|179273 PRK01287, xerC, site-specific tyrosine recombinase XerC; Reviewed. Length = 358 Score = 77.9 bits (192), Expect = 6e-16 Identities = 29/61 (47%), Positives = 41/61 (67%) Query: 6 HTLRHSFATHLLSNGGDLRSIQSILGHSRLSTTQIYTNVNSKRMMEIYDQTHPSITQKDK 65 H RH+ AT +L NG D R IQ+ILGH++L TTQIYT V+ + ++ THP+ + D+ Sbjct: 268 HLFRHAMATQMLENGADTRHIQAILGHAKLETTQIYTRVSIGHLQAVHASTHPAERKADE 327 Query: 66 K 66 K Sbjct: 328 K 328 >gnl|CDD|131303 TIGR02249, integrase_gron, integron integrase. Members of this family are integrases associated with integrons (and super-integrons), which are systems for incorporating and expressing cassettes of laterally transferred DNA. Incorporation occurs at an attI site. A super-integron, as in Vibrio sp., may include over 100 cassettes. This family belongs to the phage integrase family (pfam00589) that also includes recombinases XerC (TIGR02224) and XerD (TIGR02225), which are bacterial housekeeping proteins. Within this family of integron integrases, some are designated by class, e.g. IntI4, a class 4 integron integrase from Vibrio cholerae N16961. Length = 315 Score = 71.7 bits (176), Expect = 4e-14 Identities = 28/41 (68%), Positives = 35/41 (85%) Query: 4 TAHTLRHSFATHLLSNGGDLRSIQSILGHSRLSTTQIYTNV 44 T HTLRHSFATHLL +G D+R++Q +LGHS + TTQIYT+V Sbjct: 260 TCHTLRHSFATHLLESGADIRTVQELLGHSDVKTTQIYTHV 300 >gnl|CDD|185315 PRK15417, PRK15417, integrase/recombinase; Provisional. Length = 337 Score = 58.1 bits (140), Expect = 5e-10 Identities = 27/41 (65%), Positives = 34/41 (82%) Query: 4 TAHTLRHSFATHLLSNGGDLRSIQSILGHSRLSTTQIYTNV 44 T HTLRHSFAT LL +G D+R++Q +LGHS +STT IYT+V Sbjct: 275 TPHTLRHSFATALLRSGYDIRTVQDLLGHSDVSTTMIYTHV 315 >gnl|CDD|164996 PHA02601, int, integrase; Provisional. Length = 333 Score = 50.5 bits (121), Expect = 9e-08 Identities = 17/36 (47%), Positives = 25/36 (69%) Query: 6 HTLRHSFATHLLSNGGDLRSIQSILGHSRLSTTQIY 41 H LRH+FA+H + NGG++ +Q ILGH+ + T Y Sbjct: 279 HVLRHTFASHFMMNGGNILVLQRILGHATIEMTMAY 314 >gnl|CDD|179927 PRK05084, xerS, site-specific tyrosine recombinase XerS; Reviewed. Length = 357 Score = 46.1 bits (110), Expect = 2e-06 Identities = 16/46 (34%), Positives = 23/46 (50%) Query: 4 TAHTLRHSFATHLLSNGGDLRSIQSILGHSRLSTTQIYTNVNSKRM 49 T H LRH+ AT L D + LGH+ TT +YT++ + Sbjct: 304 TPHKLRHTLATRLYDATKDQVLVADQLGHTSTETTDLYTHIVNDEQ 349 >gnl|CDD|182125 PRK09870, PRK09870, tyrosine recombinase; Provisional. Length = 200 Score = 38.4 bits (89), Expect = 4e-04 Identities = 21/51 (41%), Positives = 26/51 (50%) Query: 6 HTLRHSFATHLLSNGGDLRSIQSILGHSRLSTTQIYTNVNSKRMMEIYDQT 56 H LRHS L + G D R IQ LGH + T YT N+ R I+D+ Sbjct: 141 HMLRHSCGFALANMGIDTRLIQDYLGHRNIRHTVWYTASNAGRFYGIWDRA 191 >gnl|CDD|182126 PRK09871, PRK09871, tyrosine recombinase; Provisional. Length = 198 Score = 38.0 bits (88), Expect = 5e-04 Identities = 22/64 (34%), Positives = 32/64 (50%), Gaps = 1/64 (1%) Query: 3 TTAHTLRHSFATHLLSNGGDLRSIQSILGHSRLSTTQIYTNVNSKRMMEIYDQTHPSITQ 62 T H LRH+ L G D R IQ LGH + T YT N+ R ++++ + I + Sbjct: 133 THPHMLRHACGYELAERGADTRLIQDYLGHRNIRHTVRYTASNAARFAGLWERNNL-INE 191 Query: 63 KDKK 66 K K+ Sbjct: 192 KLKR 195 >gnl|CDD|177485 PHA02731, PHA02731, putative integrase; Provisional. Length = 231 Score = 30.5 bits (68), Expect = 0.094 Identities = 16/51 (31%), Positives = 26/51 (50%), Gaps = 3/51 (5%) Query: 6 HTLRHSFATHLLS-NGGDLRSIQSILGHSRLSTTQIYTNVNSKRMMEIYDQ 55 H+LR++ +L G D+ I GH+ L +YT +K EI+D+ Sbjct: 179 HSLRYAGINYLAKVEGIDMAIIAKFTGHANLDQIILYT--QTKAADEIFDR 227 >gnl|CDD|178345 PLN02744, PLN02744, dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex. Length = 539 Score = 25.6 bits (56), Expect = 3.3 Identities = 8/53 (15%), Positives = 24/53 (45%), Gaps = 11/53 (20%) Query: 12 FATHLLSNGGDLRSIQSILGHSRLSTTQIYTNVNSKRMMEIYDQTHPSITQKD 64 +A+ ++++ LR++ ++L + + ++N T S+ + D Sbjct: 2 YASRIINHSKKLRNVSNLLRREHAALVRYFSN-----------STRSSLGKGD 43 >gnl|CDD|181728 PRK09250, PRK09250, fructose-bisphosphate aldolase; Provisional. Length = 348 Score = 25.2 bits (56), Expect = 3.3 Identities = 10/20 (50%), Positives = 14/20 (70%) Query: 19 NGGDLRSIQSILGHSRLSTT 38 N G LR++Q +L H RL+ T Sbjct: 45 NPGVLRNLQRLLNHGRLAGT 64 >gnl|CDD|150143 pfam09369, DUF1998, Domain of unknown function (DUF1998). This family of proteins are functionally uncharacterized. They are mainly found in helicase proteins so could be RNA binding. This family includes a probable zinc binding motif at its C-terminus. Length = 81 Score = 24.8 bits (55), Expect = 4.5 Identities = 11/43 (25%), Positives = 13/43 (30%), Gaps = 1/43 (2%) Query: 3 TTAHTLRHSFATHLLSNGGDLR-SIQSILGHSRLSTTQIYTNV 44 T H L + L + DL SI IY V Sbjct: 1 TLEHALIRALPLVLGCDRSDLGESIYPEPDTDGRPGILIYDAV 43 >gnl|CDD|183991 PRK13352, PRK13352, thiamine biosynthesis protein ThiC; Provisional. Length = 431 Score = 24.7 bits (55), Expect = 5.2 Identities = 12/28 (42%), Positives = 16/28 (57%), Gaps = 3/28 (10%) Query: 17 LSNGGDLRSI-QSILGHSRLS--TTQIY 41 LS GGDL I ++I+ S + T IY Sbjct: 97 LSTGGDLDEIRRAIIEASPVPVGTVPIY 124 >gnl|CDD|185515 PTZ00213, PTZ00213, asparagine synthetase A; Provisional. Length = 348 Score = 24.0 bits (52), Expect = 8.2 Identities = 8/18 (44%), Positives = 12/18 (66%) Query: 40 IYTNVNSKRMMEIYDQTH 57 IYT++N+ R+ E D H Sbjct: 95 IYTDMNALRVEEELDNIH 112 >gnl|CDD|131779 TIGR02732, zeta_caro_desat, carotene 7,8-desaturase. Carotene 7,8-desaturase, also called zeta-carotene desaturase, catalyzes multiple steps in the pathway from geranylgeranyl-PP to all-trans-lycopene in plants and cyanobacteria. A similar enzyme and pathway is found in the green sulfur bacterium Chlorobium tepidum. Length = 474 Score = 24.0 bits (52), Expect = 8.3 Identities = 10/17 (58%), Positives = 12/17 (70%) Query: 11 SFATHLLSNGGDLRSIQ 27 SFA LS+GG L SI+ Sbjct: 155 SFAEWFLSHGGSLGSIK 171 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.314 0.124 0.341 Gapped Lambda K H 0.267 0.0789 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 931,210 Number of extensions: 39001 Number of successful extensions: 101 Number of sequences better than 10.0: 1 Number of HSP's gapped: 101 Number of HSP's successfully gapped: 21 Length of query: 67 Length of database: 5,994,473 Length adjustment: 38 Effective length of query: 29 Effective length of database: 5,173,369 Effective search space: 150027701 Effective search space used: 150027701 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (22.9 bits)