RPS-BLAST 2.2.22 [Sep-27-2009] Database: scop70_1_75 13,730 sequences; 2,407,596 total letters Searching..................................................done Query= gi|254780490|ref|YP_003064903.1| site-specific tyrosine recombinase XerC [Candidatus Liberibacter asiaticus str. psy62] (67 letters) >d1a0pa2 d.163.1.1 (A:111-292) Recombinase XerD {Escherichia coli [TaxId: 562]} Length = 182 Score = 60.5 bits (145), Expect = 4e-11 Identities = 29/50 (58%), Positives = 42/50 (84%) Query: 4 TAHTLRHSFATHLLSNGGDLRSIQSILGHSRLSTTQIYTNVNSKRMMEIY 53 + H LRH+FATHLL++G DLR +Q +LGHS LSTTQIYT+V ++R+ +++ Sbjct: 132 SPHVLRHAFATHLLNHGADLRVVQMLLGHSDLSTTQIYTHVATERLRQLH 181 >d1f44a2 d.163.1.1 (A:130-343) Cre recombinase {Bacteriophage P1 [TaxId: 10678]} Length = 214 Score = 47.2 bits (110), Expect = 4e-07 Identities = 6/52 (11%), Positives = 17/52 (32%) Query: 1 MSTTAHTLRHSFATHLLSNGGDLRSIQSILGHSRLSTTQIYTNVNSKRMMEI 52 ++ + H+ R A + G + I G + ++ + + Sbjct: 155 LAWSGHSARVGAARDMARAGVSIPEIMQAGGWTNVNIVMNFIRNLDSETGAM 206 >d1aiha_ d.163.1.1 (A:) Integrase {Bacteriophage HP1 [TaxId: 10690]} Length = 170 Score = 42.4 bits (98), Expect = 9e-06 Identities = 18/55 (32%), Positives = 30/55 (54%), Gaps = 1/55 (1%) Query: 4 TAHTLRHSFATHLLSNGGDLRSIQSILGHSRLSTTQIYTNVNSKRMMEIYDQTHP 58 H LRH+FA+H + NGG++ ++ ILGHS + T Y + + + +P Sbjct: 111 LTHVLRHTFASHFMMNGGNILVLKEILGHSTIEMTMRYAHFAPSHLESAV-KFNP 164 >d1ae9a_ d.163.1.1 (A:) Integrase (Int) {Bacteriophage lambda [TaxId: 10710]} Length = 179 Score = 41.4 bits (95), Expect = 2e-05 Identities = 7/47 (14%), Positives = 15/47 (31%) Query: 6 HTLRHSFATHLLSNGGDLRSIQSILGHSRLSTTQIYTNVNSKRMMEI 52 S + L + Q +LGH + + + + +I Sbjct: 131 FHELRSLSARLYEKQISDKFAQHLLGHKSDTMASQFRDDRGREWDKI 177 >d1dnpa1 a.99.1.1 (A:201-469) C-terminal domain of DNA photolyase {Escherichia coli [TaxId: 562]} Length = 269 Score = 23.7 bits (50), Expect = 4.7 Identities = 8/34 (23%), Positives = 11/34 (32%) Query: 3 TTAHTLRHSFATHLLSNGGDLRSIQSILGHSRLS 36 A F + R ++ G SRLS Sbjct: 5 KAAIAQLRQFCQNGAGEYEQQRDFPAVEGTSRLS 38 >d1j98a_ d.185.1.2 (A:) Autoinducer-2 production protein LuxS {Bacillus subtilis [TaxId: 1423]} Length = 154 Score = 23.1 bits (50), Expect = 5.9 Identities = 6/17 (35%), Positives = 7/17 (41%), Gaps = 1/17 (5%) Query: 1 MSTTA-HTLRHSFATHL 16 M HTL H A + Sbjct: 45 MKPDTIHTLEHLLAFTI 61 >d1j6xa_ d.185.1.2 (A:) Autoinducer-2 production protein LuxS {Helicobacter pylori [TaxId: 210]} Length = 151 Score = 23.1 bits (50), Expect = 7.2 Identities = 5/17 (29%), Positives = 8/17 (47%), Gaps = 1/17 (5%) Query: 1 MSTTA-HTLRHSFATHL 16 M + H+L H A + Sbjct: 49 MDMPSLHSLEHLVAEII 65 >d1u3da1 a.99.1.1 (A:198-497) Cryptochrome C-terminal domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 300 Score = 22.6 bits (47), Expect = 9.0 Identities = 6/34 (17%), Positives = 8/34 (23%) Query: 3 TTAHTLRHSFATHLLSNGGDLRSIQSILGHSRLS 36 + +F L R S LS Sbjct: 21 SNGDKALTTFINGPLLEYSKNRRKADSATTSFLS 54 >d1vjea_ d.185.1.2 (A:) Autoinducer-2 production protein LuxS {Deinococcus radiodurans [TaxId: 1299]} Length = 149 Score = 22.7 bits (49), Expect = 9.1 Identities = 6/17 (35%), Positives = 9/17 (52%), Gaps = 1/17 (5%) Query: 1 MSTTA-HTLRHSFATHL 16 + A HTL H A ++ Sbjct: 44 IDPAAIHTLEHLLAGYM 60 >d1j6wa_ d.185.1.2 (A:) Autoinducer-2 production protein LuxS {Haemophilus influenzae [TaxId: 727]} Length = 161 Score = 22.4 bits (48), Expect = 9.8 Identities = 7/17 (41%), Positives = 9/17 (52%), Gaps = 1/17 (5%) Query: 1 MSTTA-HTLRHSFATHL 16 +S HTL H FA + Sbjct: 46 LSPKGIHTLEHLFAGFM 62 Database: scop70_1_75 Posted date: Mar 27, 2010 6:21 PM Number of letters in database: 2,407,596 Number of sequences in database: 13,730 Lambda K H 0.314 0.124 0.341 Gapped Lambda K H 0.267 0.0453 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 13730 Number of Hits to DB: 199,970 Number of extensions: 5768 Number of successful extensions: 20 Number of sequences better than 10.0: 1 Number of HSP's gapped: 20 Number of HSP's successfully gapped: 12 Length of query: 67 Length of database: 2,407,596 Length adjustment: 36 Effective length of query: 31 Effective length of database: 1,913,316 Effective search space: 59312796 Effective search space used: 59312796 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 47 (22.6 bits)