RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780491|ref|YP_003064904.1| Mrp protein [Candidatus Liberibacter asiaticus str. psy62] (101 letters) >gnl|CDD|39111 KOG3908, KOG3908, KOG3908, Queuine-tRNA ribosyltransferase [RNA processing and modification]. Length = 396 Score = 26.9 bits (59), Expect = 1.2 Identities = 10/44 (22%), Positives = 21/44 (47%), Gaps = 4/44 (9%) Query: 29 QRLSEIFIVH----NTVYLSITVPHTIAHQLQSLRSNAQQIIQN 68 ++ + ++ TV + H IA+QLQ +R + I ++ Sbjct: 316 KKYTRAYLHALVGKETVGCHLLTIHNIAYQLQLMRDVRESIQED 359 >gnl|CDD|107347 cd06352, PBP1_NPR_GC_like, Ligand-binding domain of membrane guanylyl-cyclase receptors. Ligand-binding domain of membrane guanylyl-cyclase receptors. Membrane guanylyl cyclases (GC) have a single membrane-spanning region and are activated by endogenous and exogenous peptides. This family can be divided into three major subfamilies: the natriuretic peptide receptors (NPRs), sensory organ-specific membrane GCs, and the enterotoxin/guanylin receptors. The binding of peptide ligands to the receptor results in the activation of the cytosolic catalytic domain. Three types of NPRs have been cloned from mammalian tissues: NPR-A/GC-A, NPR-B/ GC-B, and NPR-C. In addition, two of the GCs, GC-D and GC-G, appear to be pseudogenes in humans. Atrial natriuretic peptide (ANP) and brain natriuretic peptide (BNP) are produced in the heart, and both bind to the NPR-A. NPR-C, also termed the clearance receptor, binds each of the natriuretic peptides and can alter circulating levels of these peptides. The ligand binding domain of the NPRs exhibits strong structural similarity to the type I periplasmic binding fold protein family. Length = 389 Score = 25.7 bits (57), Expect = 3.0 Identities = 7/36 (19%), Positives = 17/36 (47%) Query: 42 YLSITVPHTIAHQLQSLRSNAQQIIQNIPTVKNAVV 77 ++TV H + + S + +I+Q+I ++ Sbjct: 164 EFNLTVSHVVFMEDNSGAEDLLEILQDIKRRSRIII 199 >gnl|CDD|29070 cd00155, RasGEF, Guanine nucleotide exchange factor for Ras-like small GTPases. Small GTP-binding proteins of the Ras superfamily function as molecular switches in fundamental events such as signal transduction, cytoskeleton dynamics and intracellular trafficking. Guanine-nucleotide-exchange factors (GEFs) positively regulate these GTP-binding proteins in response to a variety of signals. GEFs catalyze the dissociation of GDP from the inactive GTP-binding proteins. GTP can then bind and induce structural changes that allow interaction with effectors.. Length = 237 Score = 25.6 bits (56), Expect = 3.5 Identities = 12/49 (24%), Positives = 22/49 (44%), Gaps = 1/49 (2%) Query: 53 HQLQSLRSNAQQIIQNIPTVKNAVVTLTENKNPPQQRNNLNVKKFVAVA 101 + L N ++ I+ + N V + P++R L + KF+ VA Sbjct: 38 DKNIHLSPNLERFIERFNNLSNWVASEILLCTNPKKRARL-LSKFIQVA 85 >gnl|CDD|147753 pfam05772, NinB, NinB protein. The ninR region of phage lambda contains two recombination genes, orf (ninB) and rap (ninG), that have roles when the RecF and RecBCD recombination pathways of E. coli, respectively, operate on phage lambda. Length = 127 Score = 25.4 bits (56), Expect = 3.8 Identities = 12/39 (30%), Positives = 16/39 (41%), Gaps = 2/39 (5%) Query: 56 QSLRSNAQQIIQNIPT--VKNAVVTLTENKNPPQQRNNL 92 ++ NA Q I +P K VVT+ E Q L Sbjct: 5 PQIKQNAIQAILQLPVDPKKPLVVTIKERTRSLDQNAKL 43 >gnl|CDD|133246 cd05115, PTKc_Zap-70, Catalytic domain of the Protein Tyrosine Kinase, Zeta-chain-associated protein of 70kDa. Protein Tyrosine Kinase (PTK) family; Zeta-chain-associated protein of 70kDa (Zap-70); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Zap-70 is a member of the Syk subfamily of kinases, which are cytoplasmic (or nonreceptor) tyr kinases containing two Src homology 2 (SH2) domains N-terminal to the catalytic tyr kinase domain. Zap-70 is primarily expressed in T-cells and NK cells, and is a crucial component in T-cell receptor (TCR) signaling. Zap-70 binds the phosphorylated ITAM (immunoreceptor tyr activation motif) sequences of the activated TCR zeta-chain through its SH2 domains, leading to its phosphorylation and activation. It then phosphorylates target proteins, which propagate the signals to downstream pathways. Zap-70 is hardly detected in normal peripheral B-cells, but is present in some B-cell malignancies. It is used as a diagnostic marker for chronic lymphocytic leukemia (CLL) as it is associated with the more aggressive subtype of the disease. Length = 257 Score = 24.9 bits (54), Expect = 5.4 Identities = 13/29 (44%), Positives = 17/29 (58%) Query: 6 KNQIVDSLKVLSIPGEKNNIVEMQRLSEI 34 K QI ++KVL EK+ EM R +EI Sbjct: 20 KKQIDVAIKVLKNENEKSVRDEMMREAEI 48 >gnl|CDD|37248 KOG2037, KOG2037, KOG2037, Guanylate-binding protein [General function prediction only]. Length = 552 Score = 24.9 bits (54), Expect = 5.5 Identities = 9/36 (25%), Positives = 16/36 (44%) Query: 54 QLQSLRSNAQQIIQNIPTVKNAVVTLTENKNPPQQR 89 +L LR +A+ +++P N L +NP Sbjct: 253 ELVQLRVHARSCFEDLPCFLNPHPGLAVAENPAFDG 288 >gnl|CDD|143653 cd07912, Tweety_N, N-terminal domain of the protein encoded by the Drosophila tweety gene and related proteins, a family of chloride ion channels. The protein product of the Drosophila tweety (tty) gene is thought to form a trans-membrane protein with five membrane-spanning regions and a cytoplasmic C-terminus. This N-terminal domain contains the putative transmembrane spanning regions. Tweety has been suggested as a candidate for a large conductance chloride channel, both in vertebrate and insect cells. Three human homologs have been identified and designated TTYH1-3. TTYH2 has been associated with the progression of cancer, and Drosophila melanogaster tweety has been assumed to play a role in development. TTYH2, and TTYH3 bind to and are ubiquinated by Nedd4-2, a HECT type E3 ubiquitin ligase, which most likely plays a role in controlling the cellular levels of tweety family proteins. Length = 418 Score = 24.6 bits (54), Expect = 5.9 Identities = 18/57 (31%), Positives = 27/57 (47%), Gaps = 8/57 (14%) Query: 27 EMQRLSEIFI--VHNTVYLSITVPHTIAHQLQSLRSNAQQIIQNIPTVKNAVVTLTE 81 ++ L +IF V+ T YL I LQ + +NA Q + IP V+LT+ Sbjct: 146 QLTNLEDIFDARVNKTDYLQIVQ------GLQQMATNAAQQLTGIPFWSLVGVSLTK 196 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.316 0.129 0.343 Gapped Lambda K H 0.267 0.0703 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 1,056,053 Number of extensions: 43466 Number of successful extensions: 127 Number of sequences better than 10.0: 1 Number of HSP's gapped: 127 Number of HSP's successfully gapped: 18 Length of query: 101 Length of database: 6,263,737 Length adjustment: 68 Effective length of query: 33 Effective length of database: 4,794,325 Effective search space: 158212725 Effective search space used: 158212725 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 51 (23.5 bits)