RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254780491|ref|YP_003064904.1| Mrp protein [Candidatus Liberibacter asiaticus str. psy62] (101 letters) >gnl|CDD|183904 PRK13231, PRK13231, nitrogenase reductase-like protein; Reviewed. Length = 264 Score = 30.2 bits (68), Expect = 0.13 Identities = 14/49 (28%), Positives = 26/49 (53%) Query: 33 EIFIVHNTVYLSITVPHTIAHQLQSLRSNAQQIIQNIPTVKNAVVTLTE 81 E++IV + Y+S+ + IA ++ L+ II N + N V ++E Sbjct: 141 EVYIVTSGEYMSLYAANNIARGIKKLKGKLGGIICNCRGIDNEVEIVSE 189 >gnl|CDD|130706 TIGR01645, half-pint, poly-U binding splicing factor, half-pint family. In the case of PUF60 (GP|6176532), in complex with p54, and in the presence of U2AF, facilitates association of U2 snRNP with pre-mRNA. Length = 612 Score = 28.1 bits (62), Expect = 0.57 Identities = 10/38 (26%), Positives = 14/38 (36%) Query: 57 SLRSNAQQIIQNIPTVKNAVVTLTENKNPPQQRNNLNV 94 S Q + P V + L + PPQQ + V Sbjct: 1 SADIENQPVAAFRPAVSVPMPVLGDKWKPPQQTGEVKV 38 >gnl|CDD|165315 PHA03016, PHA03016, hypothetical protein; Provisional. Length = 441 Score = 26.8 bits (59), Expect = 1.4 Identities = 18/83 (21%), Positives = 37/83 (44%), Gaps = 7/83 (8%) Query: 13 LKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQQIIQNIPTV 72 L +L P +K I ++ + IF++ N + I Q+Q+L + + + I + Sbjct: 233 LDILFTPDKKIEINNIEISNNIFLIDNKQNV-------INDQIQNLFHSFIKKHKIIKEI 285 Query: 73 KNAVVTLTENKNPPQQRNNLNVK 95 N ++ + K+ N N+K Sbjct: 286 NNFIILFNKYKDELSFNINQNLK 308 >gnl|CDD|149371 pfam08283, Gemini_AL1_M, Geminivirus rep protein central domain. This is the cetral domain of the geminivirus rep proteins. Length = 106 Score = 26.2 bits (58), Expect = 1.8 Identities = 11/32 (34%), Positives = 15/32 (46%), Gaps = 3/32 (9%) Query: 42 YLSI---TVPHTIAHQLQSLRSNAQQIIQNIP 70 LSI P A QL +L NA ++ + P Sbjct: 21 ALSIIKEEFPKDWALQLHNLEYNANRLFPDPP 52 >gnl|CDD|172940 PRK14465, PRK14465, ribosomal RNA large subunit methyltransferase N; Provisional. Length = 342 Score = 25.7 bits (56), Expect = 2.6 Identities = 22/79 (27%), Positives = 35/79 (44%), Gaps = 5/79 (6%) Query: 8 QIVDS-LKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQQII 66 +IVD L+V I G++ V + E HN Y ++ +I H + A++I Sbjct: 137 EIVDQVLQVEKIVGDRATNVVFMGMGEPM--HN--YFNVIRAASILHDPDAFNLGAKRIT 192 Query: 67 QNIPTVKNAVVTLTENKNP 85 + V N + ENK P Sbjct: 193 ISTSGVVNGIRRFIENKEP 211 >gnl|CDD|178385 PLN02788, PLN02788, phenylalanine-tRNA synthetase. Length = 402 Score = 25.5 bits (56), Expect = 3.6 Identities = 7/16 (43%), Positives = 9/16 (56%) Query: 49 HTIAHQLQSLRSNAQQ 64 HT AHQ + LR+ Sbjct: 134 HTSAHQAELLRAGHTH 149 >gnl|CDD|129308 TIGR00204, dxs, 1-deoxy-D-xylulose-5-phosphate synthase. DXP synthase is a thiamine diphosphate-dependent enzyme related to transketolase and the pyruvate dehydrogenase E1-beta subunit. By an acyloin condensation of pyruvate with glyceraldehyde 3-phosphate, it produces 1-deoxy-D-xylulose 5-phosphate, a precursor of thiamine diphosphate (TPP), pyridoxal phosphate, and the isoprenoid building block isopentenyl diphosphate (IPP). Length = 617 Score = 25.1 bits (55), Expect = 4.3 Identities = 10/26 (38%), Positives = 15/26 (57%) Query: 56 QSLRSNAQQIIQNIPTVKNAVVTLTE 81 QSLR ++I +P +KN + TE Sbjct: 196 QSLRDGLKKIFSKLPPIKNYLAKRTE 221 >gnl|CDD|179998 PRK05294, carB, carbamoyl phosphate synthase large subunit; Reviewed. Length = 1066 Score = 25.1 bits (56), Expect = 4.7 Identities = 9/40 (22%), Positives = 19/40 (47%) Query: 3 QILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVY 42 + L+ + V + + +IV++ + EI +V NT Sbjct: 974 KFLREAGIPVELVNKVHEGRPHIVDLIKNGEIDLVINTPT 1013 >gnl|CDD|162144 TIGR00978, asd_EA, aspartate-semialdehyde dehydrogenase (non-peptidoglycan organisms). Two closely related families of aspartate-semialdehyde dehydrogenase are found. They differ by a deep split in phylogenetic and percent identity trees and in gap patterns. Separate models are built for the two types in order to exclude the USG-1 protein, found in several species, which is specifically related to the Bacillus subtilis type of aspartate-semialdehyde dehydrogenase. Members of this type are found primarily in organisms that lack peptidoglycan. Length = 341 Score = 24.7 bits (54), Expect = 5.2 Identities = 11/53 (20%), Positives = 24/53 (45%), Gaps = 2/53 (3%) Query: 48 PHTIAHQLQSLRSNAQQIIQNIPTVKNAVVTLTENKNPPQQRNNLNVKKFVAV 100 I L+S R Q++ +P+ + + + ++ PQ R + + +AV Sbjct: 253 IEEIREALKSFRGLPQKL--GLPSAPEKPIIVRDEEDRPQPRLDRDAGGGMAV 303 >gnl|CDD|162409 TIGR01539, portal_lambda, phage portal protein, lambda family. This model represents one of several distantly related families of phage portal protein. This protein forms a hole, or portal, that enables DNA passage during packaging and ejection. It also forms the junction between the phage head (capsid) and the tail proteins. It functions as a dodecamer of a single polypeptide of average mol. wt. of 40-90 KDa. Length = 458 Score = 24.8 bits (54), Expect = 5.5 Identities = 10/32 (31%), Positives = 18/32 (56%) Query: 51 IAHQLQSLRSNAQQIIQNIPTVKNAVVTLTEN 82 I L+ LR+ A+ +++N V NA+ +N Sbjct: 22 ILQALRLLRARARDLVRNNDIVANAIDLHKDN 53 >gnl|CDD|184766 PRK14610, PRK14610, 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase; Provisional. Length = 283 Score = 24.3 bits (53), Expect = 8.3 Identities = 17/53 (32%), Positives = 26/53 (49%), Gaps = 5/53 (9%) Query: 20 GEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQ-QIIQNIPT 71 G KN VE +I +NTV +I + H +R+N ++I+NIP Sbjct: 47 GSKNRGVEFVNSLKINRYNNTVQRAIG--LLLRH--SPVRTNVYVKVIKNIPV 95 >gnl|CDD|182591 PRK10618, PRK10618, phosphotransfer intermediate protein in two-component regulatory system with RcsBC; Provisional. Length = 894 Score = 24.1 bits (53), Expect = 8.3 Identities = 7/19 (36%), Positives = 15/19 (78%) Query: 52 AHQLQSLRSNAQQIIQNIP 70 +H+L+ LR+ ++I+ N+P Sbjct: 335 SHELRILRALNEEIVSNLP 353 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.316 0.129 0.343 Gapped Lambda K H 0.267 0.0662 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 1,502,561 Number of extensions: 77164 Number of successful extensions: 173 Number of sequences better than 10.0: 1 Number of HSP's gapped: 173 Number of HSP's successfully gapped: 30 Length of query: 101 Length of database: 5,994,473 Length adjustment: 68 Effective length of query: 33 Effective length of database: 4,525,129 Effective search space: 149329257 Effective search space used: 149329257 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.2 bits)