HHsearch alignment for GI: 254780493 and conserved domain: PRK13960

>PRK13960 phosphoribosylaminoimidazole-succinocarboxamide synthase; Provisional.
Probab=100.00  E-value=0  Score=605.81  Aligned_cols=294  Identities=32%  Similarity=0.475  Sum_probs=251.5

Q ss_pred             CCC--CCCEEEECCEEEEEECC------------------CCCEEEEEECCEEEECCCCC------CCCCHHHHHHHHHH
Q ss_conf             488--99602304402658759------------------99489998188125557657------77878899999999
Q gi|254780493|r    8 YIP--ELPNYYSGKVRENYFLS------------------DGTRITIATDRLSAFDQNIA------CIPYKGEVLNQITQ   61 (323)
Q Consensus         8 ~~~--~l~liy~GKvk~vY~~~------------------d~~ll~v~tDriSAfD~~~~------~Ip~KG~~l~~iS~   61 (323)
T Consensus        13 ~~p~~~~~~vhsgkvrsvy~l~~~ds~rli~~~~y~~~~d~~l~lmVaSDRISAFD~Vl~~e~~l~gIP~KG~vLn~iS~   92 (367)
T PRK13960         13 DLPIRTDKPVHSGKVRSVYWLTEEDSRRLIKEKGYNVPADTPLAIMVISDRISAFDCIWHGEGGLKGVPGKGAALNAISN   92 (367)
T ss_pred             CCCCCCCCCCCCCCEEEEEECCHHHHHHHHHHCCCCCCCCCCEEEEEECCCCCCEEEEECCCCCCCCCCCCCHHHHHHHH
T ss_conf             87644588754672257885266777789986398889999889999705753015750475657899970599999999


Q ss_pred             HHHHHHH--HHCCCCEECCCCCCCCEEEECCCCCCEEEEECCCCCCCCCCHHHHHHCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             9999854--10233121357763000000254650578852122443220012210247651344663212223568874
Q gi|254780493|r   62 YWFHHTS--DICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYP  139 (323)
Q Consensus        62 ~~F~~l~--~~i~tH~i~~~~~~~~~v~k~~~iPiE~VvR~y~~GS~~~~~~~~~k~~~~~~~g~~lp~gl~~~~~l~~P  139 (323)
T Consensus        93 fWF~~~~~~~l~~nHild~P~p~v~iVkKakpipIE~VVRGYLTGS~W----reY~kg~r~vCGi~LP~GL~e~qkLpep  168 (367)
T PRK13960         93 HWFKLFKENGLADSHILDIPHPFVWIVQKARPVKIEAICRQYITGSMW----RAYSKGEREFCGITLPEGLEKDQKLPEL  168 (367)
T ss_pred             HHHHHCCCCCCCCCCCCCCCCCCEEEEEECCCCEEEEEEEEEECCCCH----HHHHHCCCEEECCCCCCCHHHHCCCCCC
T ss_conf             999744766887763334788634788855552599999851124028----9886178748685667310222459875


Q ss_pred             CEEEEEECCCCC-----CCCCCCCCHHHHHHH----HCCCHHHHHHHHHHHHHHHHHHHHHHHHCCCEEEEEEEEEEE--
Q ss_conf             022321033334-----577755554566653----049989998999999999999999988679788742324455--
Q gi|254780493|r  140 VITPTTKSSESA-----SGCDQPISPNEIIHR----GILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGI--  208 (323)
Q Consensus       140 i~tpstK~~~~~-----~~~D~~i~~~~~~~~----~~~~~~~~~~i~~~sl~i~~~~~~~~~~~GliLvD~K~EFG~--  208 (323)
T Consensus       169 IfTPSTKA~~~g~~~v~~~hD~nIs~~~i~~~~~~~~~~~~~di~~~e~l~~~~f~~~~~~a~~~GiILaDTKFEFG~~~  248 (367)
T PRK13960        169 LITPSTKGILTGIPGVPEADDVNISRSDIEANYQAFNFEKAEDIDLYEKLLKEGFKVISKALAKLDQIFVDTKFEFGYVT  248 (367)
T ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHCCCEEEECCCCCCCCC
T ss_conf             50788655456887887655565699999998755311139999999999999999999999979938997671277446


Q ss_pred             CCCC--CEEEECCCCCCCCCHHHCCCHHHHHHHCCCCCCCCCHHHHHHHHHHCCC--------------CCCCCCCCCCH
Q ss_conf             0886--2576200048100000000000123312544443237888765531122--------------36799999898
Q gi|254780493|r  209 DKKQ--NIILADEIHTPDSSRYWEVETYEKSFREGITPIGLDKDFIRNWILTRCN--------------PYRDNIPDIPE  272 (323)
Q Consensus       209 ~~~g--~iiL~DEv~TPDssR~W~~~~ye~~~~~g~~~~s~DKq~~R~wl~~~~~--------------~~~~~~P~LP~  272 (323)
T Consensus       249 d~~G~~~LILiDEVlTPDSSRfW~ad~Y~~----G~~~en-sKe~FRq~ll~~~~Dpd~llnk~rm~eR~~~a~~~~lP~  323 (367)
T PRK13960        249 DANGNEKLIYMDEVGTPDSSRIWDGAAYRD----GKIVEN-SKEGFRQFLLNHFPDPDILLNKDRMPEREALARDNALPL  323 (367)
T ss_pred             CCCCCEEEEEEECCCCCCCCCCCCHHHCCC----CCCCCC-CCHHHHHHHHHCCCCCCCCCCHHHCCHHHCCCCCCCCCH
T ss_conf             888861699985578887455564321468----865556-558899999853887101246111420111477777989


Q ss_pred             HHHHHHHHHHHHHHHHHHCCCCCCCCCCCCHHHHHHHHHHH
Q ss_conf             99999999999999986088664788678999999999999
Q gi|254780493|r  273 NIILRTSQTYIAAYEKITGLKFIADNSELPPLERIRNNLRK  313 (323)
Q Consensus       273 ~vv~~~~~~Y~~~~e~lTG~~f~~~~~~~~~~erI~~~l~~  313 (323)
T Consensus       324 evv~~~S~~Yi~~~E~ItG~~~~~~~---~P~~~i~~~l~~  361 (367)
T PRK13960        324 EVMMDVSRTYTGIAEKITGAKIVLSA---NPKAEIIKILRE  361 (367)
T ss_pred             HHHHHHHHHHHHHHHHHHCCCCCCCC---CCHHHHHHHHHH
T ss_conf             99999999999999997089655788---858999999997