HHsearch alignment for GI: 254780493 and conserved domain: TIGR02735

>TIGR02735 purC_vibrio phosphoribosylaminoimidazole-succinocarboxamide synthase; InterPro: IPR014106 Members of this protein family appear to represent a novel form of phosphoribosylaminoimidazole-succinocarboxamide synthase (SAICAR synthetase), significantly different in sequence from (IPR001636 from INTERPRO), which is found in a broad range of bacteria and eukaryotes. Members of this family are found within the gammaproteobacteria in the genera Vibrio, Shewanella, and Colwellia, and also (reported as a fragment) in the primitive eukaryote Guillardia theta (Cryptomonas phi)..
Probab=100.00  E-value=0  Score=459.21  Aligned_cols=294  Identities=31%  Similarity=0.457  Sum_probs=244.9

Q ss_pred             CCCCCCEEEECCEEEEEECC--CC----------------CEEEEEECCEEEECCC------CCCCCCHHHHHHHHHHHH
Q ss_conf             48899602304402658759--99----------------4899981881255576------577787889999999999
Q gi|254780493|r    8 YIPELPNYYSGKVRENYFLS--DG----------------TRITIATDRLSAFDQN------IACIPYKGEVLNQITQYW   63 (323)
Q Consensus         8 ~~~~l~liy~GKvk~vY~~~--d~----------------~ll~v~tDriSAfD~~------~~~Ip~KG~~l~~iS~~~   63 (323)
T Consensus        14 ~i~Td~~VHSGKVRSVYWL~~~DSRRLI~~k~Y~Va~DA~LAI~viSDR~SAFDCIW~aEGG~~GVPGKGAALNAiS~~W   93 (365)
T TIGR02735        14 PIRTDEPVHSGKVRSVYWLTEEDSRRLIEEKGYPVAEDAPLAILVISDRISAFDCIWHAEGGLKGVPGKGAALNAISNHW   93 (365)
T ss_pred             CCCCCCCCCCCCEEEEEECCCHHHHHHHHHCCCCCCCCCCEEEEEEECHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHH
T ss_conf             88888852356301465158023578886368888877550466533100033300014787336686207888888999


Q ss_pred             HHHHH--HHCCCCEECCCCCCCCEEEECCCCCCEEEEECCCCCCCCCCHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCE
Q ss_conf             99854--1023312135776300000025465057885212244322001221024765134466321222356887402
Q gi|254780493|r   64 FHHTS--DICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVI  141 (323)
Q Consensus        64 F~~l~--~~i~tH~i~~~~~~~~~v~k~~~iPiE~VvR~y~~GS~~~~~~~~~k~~~~~~~g~~lp~gl~~~~~l~~Pi~  141 (323)
T Consensus        94 F~~F~~~gLA~SHIL~~PHP~vWiVQkAkPv~IEAI~RQYITGS~----WRaYaKGER~FCG~~lP~~L~~~~~LpElLi  169 (365)
T TIGR02735        94 FKLFKEAGLAESHILDIPHPFVWIVQKAKPVKIEAICRQYITGSL----WRAYAKGEREFCGIDLPEGLEKDQRLPELLI  169 (365)
T ss_pred             HHHHHHCCCCHHHHCCCCCCEEEEEECCCCEEEEEEHHHHHHHHH----HHHHCCCCCCCCCCCCCHHHHHHCCCCCEEE
T ss_conf             999874574001001589871898743762143000001232334----5421156643467755212343056882676


Q ss_pred             EEEEECCCC-C----CCCCCCCCHHHHH----HHHCCCHHHHHHHHHHHHHHHHHHHHHHHHCCCEEEEEEEEEEE----
Q ss_conf             232103333-4----5777555545666----53049989998999999999999999988679788742324455----
Q gi|254780493|r  142 TPTTKSSES-A----SGCDQPISPNEII----HRGILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGI----  208 (323)
Q Consensus       142 tpstK~~~~-~----~~~D~~i~~~~~~----~~~~~~~~~~~~i~~~sl~i~~~~~~~~~~~GliLvD~K~EFG~----  208 (323)
T Consensus       170 TPS~KGiL~G~~Gv~~~DDVNItR~dIE~~~~~~~F~~p~DIdHYE~LL~~GF~VIs~~L~~lgQlFVDTKFEFGY~td~  249 (365)
T TIGR02735       170 TPSTKGILEGIPGVPAIDDVNITRKDIERNYSAFNFEQPEDIDHYERLLREGFAVISDRLSKLGQLFVDTKFEFGYVTDV  249 (365)
T ss_pred             CCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCEEEEEEEECCEEECC
T ss_conf             68762101578886442444466788998999707898631268999986258999987732674365400101011167


Q ss_pred             CCCCCEEEECCCCCCCCCHHHCCCHHHHHHHCCCCCCCCCHHHHHHHHHH--------------CCCCCCCCCCCCCHHH
Q ss_conf             08862576200048100000000000123312544443237888765531--------------1223679999989899
Q gi|254780493|r  209 DKKQNIILADEIHTPDSSRYWEVETYEKSFREGITPIGLDKDFIRNWILT--------------RCNPYRDNIPDIPENI  274 (323)
Q Consensus       209 ~~~g~iiL~DEv~TPDssR~W~~~~ye~~~~~g~~~~s~DKq~~R~wl~~--------------~~~~~~~~~P~LP~~v  274 (323)
T Consensus       250 ~G~~~LIYMDEVGTPDSSRIW~A~~Y~~G~i~EN-----SKEgFRQ~LlN~~PD~~~LL~K~RM~ER~AlA~~~~LP~~~  324 (365)
T TIGR02735       250 EGKRKLIYMDEVGTPDSSRIWDAGAYAQGKIVEN-----SKEGFRQLLLNYFPDPDILLNKDRMVERAALARDNALPQEV  324 (365)
T ss_pred             CCCEEEEEEECCCCCCCHHHHCHHHCCCCCEEEC-----CCCHHHHHHHHCCCCHHHHCCCCCCHHHHHHHCCCCCHHHH
T ss_conf             7762336751468886012212441058827752-----75026888864078722202555405788752155574899


Q ss_pred             HHHHHHHHHHHHHHHHCCCCCCCCCCCCHHHHHHHHHHH
Q ss_conf             999999999999986088664788678999999999999
Q gi|254780493|r  275 ILRTSQTYIAAYEKITGLKFIADNSELPPLERIRNNLRK  313 (323)
Q Consensus       275 v~~~~~~Y~~~~e~lTG~~f~~~~~~~~~~erI~~~l~~  313 (323)
T Consensus       325 L~dvS~~YlgIA~~I~G~~I~l~~~---Pk~EI~~~L~~  360 (365)
T TIGR02735       325 LLDVSKTYLGIAEKITGKSITLSEN---PKAEIKAILSK  360 (365)
T ss_pred             HHHHHHHHHHHHHHHCCCCEEECCC---CHHHHHHHHHH
T ss_conf             9999999998776634870120767---36899999875