HHsearch alignment of GI: 254780493 and MMDB domain: 1kut_A_1-78_200-230

>1kut_A (A:1-78,A:200-230) Phosphoribosylaminoimidazole-succinocarboxamide synthase; structural genomics, saicar synthetase, PSI, protein structure initiative; 2.20A {Thermotoga maritima}
Probab=99.90  E-value=5.3e-24  Score=172.46  Aligned_cols=82  Identities=21%  Similarity=0.245  Sum_probs=75.5

Q ss_pred             EEECCEEEEEECCCCCEEEEEECCEEEECCCCC-CCCCHHHHHHHHHHHHHHHHHHH-CCCCEECCCCCCCCEEEECCCC
Q ss_conf             230440265875999489998188125557657-77878899999999999985410-2331213577630000002546
Q gi|254780493|r   15 YYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQITQYWFHHTSDI-CSNHTLDYPDPNVLVGQQLQMF   92 (323)
Q Consensus        15 iy~GKvk~vY~~~d~~ll~v~tDriSAfD~~~~-~Ip~KG~~l~~iS~~~F~~l~~~-i~tH~i~~~~~~~~~v~k~~~i   92 (323)
                      -|+||||+||+++| .++|+|+|||||||++++ .|||||++||+||++||++|++. ||||||+.+++++|+|++|+++
T Consensus         2 ~YeGKtKdvY~~dD-~lil~fkDriTAfDg~k~~~I~gKG~l~~~iS~~~Fe~Le~~GIpTHfI~~i~~~~mlVkk~e~~   80 (109)
T 1kut_A            2 NYEGKTKIVKVTGD-YALLEFKDDITAGDGLKHDVLTGKGSICAETTAILXKYLSEKGIKTHLVEYIPPRTLKVIPLKIF   80 (109)
T ss_dssp             -----CEEEEEETT-EEEEEECCC-----------CCSHHHHHHHHHHHHHHHHHHTTCCBSEEEEETTTEEEECCCECC
T ss_pred             CCCCCEEEEEECCC-EEEEEEECCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHCCCCCHHHHCCCCCEEEEEECCCC
T ss_conf             30020018872699-38999978845107525788997309999999999987630598812530467507887761432


Q ss_pred             CCEEE
Q ss_conf             50578
Q gi|254780493|r   93 PIELI   97 (323)
Q Consensus        93 PiE~V   97 (323)
                      .-.+-
T Consensus        81 ~~~~~   85 (109)
T 1kut_A           81 DKDVY   85 (109)
T ss_dssp             CHHHH
T ss_pred             CHHHH
T ss_conf             75888