HHsearch alignment of GI: 254780493 and MMDB domain: 2ywv_A_1-88_220-244

>2ywv_A (A:1-88,A:220-244) Phosphoribosylaminoimidazole succinocarboxamide synthetase; ADP complex, structural genomics, NPPSFA; HET: ADP; 1.75A {Geobacillus kaustophilus}
Probab=99.92  E-value=1.4e-25  Score=182.59  Aligned_cols=85  Identities=19%  Similarity=0.257  Sum_probs=78.8

Q ss_pred             CCCCCCCEEEECCEEEEEECCC-CCEEEEEECCEEEECCCCC-CCCCHHHHHHHHHHHHHHHHHHH-CCCCEECCCCCCC
Q ss_conf             5488996023044026587599-9489998188125557657-77878899999999999985410-2331213577630
Q gi|254780493|r    7 AYIPELPNYYSGKVRENYFLSD-GTRITIATDRLSAFDQNIA-CIPYKGEVLNQITQYWFHHTSDI-CSNHTLDYPDPNV   83 (323)
Q Consensus         7 ~~~~~l~liy~GKvk~vY~~~d-~~ll~v~tDriSAfD~~~~-~Ip~KG~~l~~iS~~~F~~l~~~-i~tH~i~~~~~~~   83 (323)
                      +.++..+++|+||||+||+++| +.++|+|+||+||||++++ .|||||++||+||+|||++|++. |||||++.++++.
T Consensus         2 s~m~~~~liYeGK~K~iY~~~d~~~li~~fkDriTAfDg~~~~~IpgKG~~~~~iS~~~F~~L~~~GIpTHfI~~~~~~~   81 (113)
T 2ywv_A            2 HMPTKQQLLYEGKAKKIYATDEPDVLWVEYKDSATAFNGEKKATIAGKGRLNNEISSLLFLKLREAGIANHFIEKLSPTE   81 (113)
T ss_dssp             -CCCEEEEEEECSSEEEEEESSTTEEEEEECSEEEETTTTEEEECTTHHHHHHHHHHHHHHHHHHTTCCBSEEEECSSSE
T ss_pred             CCCCCCCEEEECCCEEEEECCCCCEEEEEEECCCEEECCCCCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCE
T ss_conf             98866735562267589985999999999979954037605777688378888989999974434554322101359720


Q ss_pred             CEEEECCC
Q ss_conf             00000254
Q gi|254780493|r   84 LVGQQLQM   91 (323)
Q Consensus        84 ~~v~k~~~   91 (323)
                      |+|+||+.
T Consensus        82 ~ivkklE~   89 (113)
T 2ywv_A           82 QLVRRVTR   89 (113)
T ss_dssp             EEEECCET
T ss_pred             EEEEECCH
T ss_conf             58863134